Citrus Sinensis ID: 014057

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MANEEEEPVPVNDDEQAASHIAAEPQLQRVENATEIVEVTSPSQPQRQHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRRVNFSPMPSPCFGKINDFPVPSSSKSKTTFKSLLPKLSFKYRNTTSDIEKAAILALGSSFTETREKPRIARASSLTKLLTPRMKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEGSGTTSSNTFPSNTTDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFYSH
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcEEEEcc
cccHHcccccccccccccccccccccccccccccccEEcccccccccccccEEEcccccccccccccEEEcccccccccccEEccccccccccccccccccccccccccHHccccccccccccccccccHccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccEEEEcEccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccHHHcEEEEEEEccccccccEEEccccccHHHHHHHHHHHHHHHHccccEEEEccEEEEEccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHccc
maneeeepvpvnddeqaashiaaepqlqrvENATEIVevtspsqpqrqhdlvlnipsrtieEVEEgfvridmpstpttsrrvnfspmpspcfgkindfpvpssskskttfksllpklsfkyrntTSDIEKAAILALGssftetrekpriARASSLTKLltprmkktssfpvtpvshsnpesihgglttdllnsakgaplpihrsrsvpllnkdgsirqmdslggvfrvipttprvaegsgttssntfpsnttdkkddggedipeeEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFsikgnktcEVCKQEVENLPVTLLRLQNvqasslpdsgaqvtryrvwqDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTtattmashagchscsaVHICWVwnhngwnfysh
maneeeepvpvnddeqAASHIAAEPQLQRVENATEIVEvtspsqpqrqhdlvlNIPSRTIEEveegfvridmpstpttsrrvnfspMPSPCFGKINDFPVPSSSKSKTTFKSLLPKLSFKYRNTTSDIEKAAILAlgssftetrekpriarassltklltprmkktssfpvtpvshsnPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPttprvaegsgttssntfpsnttdkkddggedIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVqasslpdsgaqvtRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFYSH
MAneeeepvpvnddeQAASHIAAEPQLQRVENATEIVEVTSPSQPQRQHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRRVNFSPMPSPCFGKINDFPVpssskskttfksllpklsFKYRNTTSDIEKAAILALGSSFTETREKPRIARASSLTKLLTPRMKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEgsgttssntfpsnttDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLasttattmashaGCHSCSAVHICWVWNHNGWNFYSH
******************************************************************FV*********************************************LPKLSFKYRNTTSDIEKAAILAL*************************************************************************************LGGVFRVI*************************************AVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFY**
****************************************************************************************************************************************************************************************************************************************************************************CRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFYSH
*************DEQAASHIAAEPQLQRVENATEIVE*********QHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRRVNFSPMPSPCFGKINDFPVPSSSKSKTTFKSLLPKLSFKYRNTTSDIEKAAILALGSSFTETREKPRIARASSLTKLLTPRMKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRV*************************DIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFYSH
************************************V******QPQRQHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRRVN*****************************************************************************PRMKKTSSFP*****************************PIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPR**************************DIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQN**************RYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFYSH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANEEEEPVPVNDDEQAASHIAAEPQLQRVENATEIVEVTSPSQPQRQHDLVLNIPSRTIEEVEEGFVRIDMPSTPTTSRRVNFSPMPSPCFGKINDFPVPSSSKSKTTFKSLLPKLSFKYRNTTSDIEKAAILALGSSFTETREKPRIARASSLTKLLTPRMKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEGSGTTSSNTFPSNTTDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMASHAGCHSCSAVHICWVWNHNGWNFYSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query431 2.2.26 [Sep-21-2011]
Q5XIV2790 Probable E3 ubiquitin-pro yes no 0.116 0.063 0.448 1e-06
Q8NA82808 Probable E3 ubiquitin-pro yes no 0.116 0.061 0.448 2e-06
Q5XI50692 E3 ubiquitin-protein liga no no 0.125 0.078 0.338 7e-05
Q9WV66693 E3 ubiquitin-protein liga no no 0.167 0.103 0.264 9e-05
Q9H992704 E3 ubiquitin-protein liga no no 0.122 0.075 0.344 0.0001
Q5R9W2707 E3 ubiquitin-protein liga no no 0.122 0.074 0.344 0.0001
P90495 333 E3 ubiquitin-protein liga no no 0.113 0.147 0.465 0.0001
Q9DBD2286 E3 ubiquitin-protein liga no no 0.129 0.195 0.368 0.0002
Q6ZQ89 909 E3 ubiquitin-protein liga no no 0.192 0.091 0.311 0.0002
Q5R9W1 910 E3 ubiquitin-protein liga no no 0.192 0.091 0.311 0.0003
>sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH10 OS=Rattus norvegicus GN=March10 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 269 CRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGN--------KTCEVCKQ 318
           CRIC I  G   + L   CGC G L F H+EC  KW  +K          KTCE+CKQ
Sbjct: 641 CRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLSTVKTCEMCKQ 698
E3 ubiquitin-protein ligase (Probable). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Rattus norvegicus (taxid: 10116)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8NA82|MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARCH10 OS=Homo sapiens GN=MARCH10 PE=2 SV=3 Back     alignment and function description
>sp|Q5XI50|MARH7_RAT E3 ubiquitin-protein ligase MARCH7 OS=Rattus norvegicus GN=March7 PE=2 SV=1 Back     alignment and function description
>sp|Q9WV66|MARH7_MOUSE E3 ubiquitin-protein ligase MARCH7 OS=Mus musculus GN=March7 PE=2 SV=1 Back     alignment and function description
>sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Homo sapiens GN=MARCH7 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pongo abelii GN=MARCH7 PE=2 SV=1 Back     alignment and function description
>sp|P90495|MIR1_HHV8P E3 ubiquitin-protein ligase MIR1 OS=Human herpesvirus 8 type P (isolate GK18) GN=K3 PE=1 SV=1 Back     alignment and function description
>sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 Back     alignment and function description
>sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
359481363516 PREDICTED: uncharacterized protein LOC10 0.925 0.773 0.670 1e-147
255557024512 protein binding protein, putative [Ricin 0.925 0.779 0.660 1e-147
147770084457 hypothetical protein VITISV_005071 [Viti 0.851 0.803 0.655 1e-130
224069416444 predicted protein [Populus trichocarpa] 0.819 0.795 0.643 1e-124
147790869 750 hypothetical protein VITISV_024209 [Viti 0.974 0.56 0.539 1e-113
356548242507 PREDICTED: uncharacterized protein LOC10 0.872 0.741 0.575 1e-112
255578868495 protein binding protein, putative [Ricin 0.902 0.785 0.557 1e-111
225435303 557 PREDICTED: uncharacterized protein LOC10 0.858 0.664 0.572 1e-109
356570750450 PREDICTED: uncharacterized protein LOC10 0.874 0.837 0.527 1e-105
449462085485 PREDICTED: uncharacterized protein LOC10 0.904 0.804 0.505 1e-104
>gi|359481363|ref|XP_002280929.2| PREDICTED: uncharacterized protein LOC100265508 [Vitis vinifera] gi|297741592|emb|CBI32724.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 275/410 (67%), Positives = 320/410 (78%), Gaps = 11/410 (2%)

Query: 1   MANEEEEPVPVNDDEQAASHIAAEPQLQRVENATEIVEVTSPSQPQRQHDLVLNIPSRTI 60
           M  EEE  V V ++  A ++   +P +Q+V  ++EI+E     Q QR  +L+L IPSRT 
Sbjct: 1   MGAEEESSVGVGNNGGACNN-TLDPPIQKVGISSEIMEEAPRGQQQRHQNLILEIPSRTH 59

Query: 61  EEVEEGFVRIDMPSTP-TTSRRVNFSPMPSPCFGKINDFPVPSSSKSKTTFKSLLPKLSF 119
           E   E FVRI+MP TP +T +RVNFSPMPSP + KIN  P PS SK +++ KSLLPKLSF
Sbjct: 60  EGSTEDFVRINMPPTPNSTPKRVNFSPMPSPSYTKINVSPGPSPSKGRSSIKSLLPKLSF 119

Query: 120 KYRNTTSDIEKAAILALGSSFTETREKPRIARASSLTKLLTPRMKKTSSFPVTPVSHSNP 179
           KYR++TS+IEKAAILALG+S T TREKP   R SSLTKL TP+MK+TSS PV+P++HSNP
Sbjct: 120 KYRSSTSEIEKAAILALGASSTGTREKPLTPRTSSLTKLFTPKMKRTSSLPVSPIAHSNP 179

Query: 180 ESIHGGLTTDLLNSAKGAP-LPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEG 238
           ES+HGG T DLL+SAKG   LPIHRS SVP++NKD SIRQMDSLGGVFRV+PTTPRVAE 
Sbjct: 180 ESMHGGNTIDLLDSAKGGSLLPIHRSHSVPVINKDESIRQMDSLGGVFRVVPTTPRVAE- 238

Query: 239 SGTTSSNTFPSNTTDK--KDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFA 296
              T +    S T D    DD GEDIPEEEAVCRIC IELGEG D LKMEC CKGELA A
Sbjct: 239 --VTVATAIASPTVDAGGNDDDGEDIPEEEAVCRICMIELGEGADTLKMECSCKGELALA 296

Query: 297 HRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDS---GAQVTRYRVWQD 353
           H+ECAVKWFSIKGNKTC+VCKQEV+NLPVTLLR+QN QA +L  +    A+ T YRVWQD
Sbjct: 297 HQECAVKWFSIKGNKTCDVCKQEVQNLPVTLLRIQNAQALNLQGNRGRQAEATGYRVWQD 356

Query: 354 VPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTM 403
           VP+LVIVSMLAYFCFLE+LLV KM S AIAISLPFSCILGLLAS T+TT+
Sbjct: 357 VPVLVIVSMLAYFCFLEQLLVRKMGSSAIAISLPFSCILGLLASMTSTTL 406

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255557024|ref|XP_002519545.1| protein binding protein, putative [Ricinus communis] gi|223541408|gb|EEF42959.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147770084|emb|CAN69885.1| hypothetical protein VITISV_005071 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224069416|ref|XP_002326349.1| predicted protein [Populus trichocarpa] gi|222833542|gb|EEE72019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147790869|emb|CAN77236.1| hypothetical protein VITISV_024209 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548242|ref|XP_003542512.1| PREDICTED: uncharacterized protein LOC100787963 [Glycine max] Back     alignment and taxonomy information
>gi|255578868|ref|XP_002530288.1| protein binding protein, putative [Ricinus communis] gi|223530186|gb|EEF32095.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225435303|ref|XP_002282323.1| PREDICTED: uncharacterized protein LOC100257089 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356570750|ref|XP_003553548.1| PREDICTED: uncharacterized protein LOC100789854 [Glycine max] Back     alignment and taxonomy information
>gi|449462085|ref|XP_004148772.1| PREDICTED: uncharacterized protein LOC101213858 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
TAIR|locus:2075064491 AT3G09760 [Arabidopsis thalian 0.832 0.731 0.513 3.2e-88
TAIR|locus:2175158494 AT5G60580 [Arabidopsis thalian 0.837 0.730 0.502 1.3e-82
TAIR|locus:2081076426 AT3G06330 [Arabidopsis thalian 0.554 0.561 0.378 3.5e-36
TAIR|locus:2144890411 AT5G18760 "AT5G18760" [Arabido 0.540 0.566 0.357 8.8e-31
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.153 0.318 0.449 3.9e-12
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.134 0.281 0.437 1.7e-10
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.127 0.269 0.457 1.7e-08
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.257 0.480 0.300 3.2e-07
TAIR|locus:505006426218 PIT1 "pitchoun 1" [Arabidopsis 0.111 0.220 0.48 7.3e-07
TAIR|locus:2154109307 AT5G62460 [Arabidopsis thalian 0.252 0.355 0.298 9e-07
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 881 (315.2 bits), Expect = 3.2e-88, P = 3.2e-88
 Identities = 202/393 (51%), Positives = 250/393 (63%)

Query:    19 SHIAAEPQLQRVENATEIV---EVTSPSQPQRQHDLVLNIPSRTIEEV--EEGFVR-IDM 72
             SH      LQR  N+ EI    E++SP +   +  LVL++PS T E+   ++ F R   +
Sbjct:    15 SHQHNHSPLQRDGNSAEIAQGQELSSPGRDLWRRGLVLDLPSTTPEDTTRDDLFRRNASL 74

Query:    73 PSTPTTSRRVNFSPMPSPCFGK--INDFPVXXXXXXXXXXXXXXXXX----XFKYRNTTS 126
              S+P  ++RVNFSPM SP  G+   +  P                       FK RN+ +
Sbjct:    75 TSSPV-AKRVNFSPMSSPRVGQRGASLSPSSSTSSSSRNKPNSLKNLIPKLSFKNRNSNN 133

Query:   127 D---IEKAAILALGSSFTETREKPRIARASSLTKLLTPRMKKTSSFPVTPVSHSNPESIH 183
             D   IEKAA L   SS +    + R     +LT +LTPR+KKT S PVTP++HSNPES H
Sbjct:   134 DNVDIEKAADLGFVSSPSSGNGRDR--STWTLTNILTPRLKKTESLPVTPIAHSNPESTH 191

Query:   184 GGLTTDLLNSAK-GAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEXXXXX 242
             G    DL+ S K G PLPIHRSRSVP  NKDGS RQ+    GVFRVIPT P ++      
Sbjct:   192 GRFAVDLVTSTKKGPPLPIHRSRSVPAFNKDGSQRQL----GVFRVIPT-PNMSPTRNTI 246

Query:   243 XXXXXXXXXXDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAV 302
                       D   DG ED+PEEEAVCRIC +ELGE  +A KMEC C+GELA AH+EC +
Sbjct:   247 KLN-------DANVDGAEDVPEEEAVCRICLVELGEDSEAFKMECLCRGELALAHKECTI 299

Query:   303 KWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQAS-SLPDSGAQVTRYRVWQDVPILVIVS 361
             KWF+IKGN+TC+VCKQEV+NLPVTLLR+QN + S   PD  A+   Y +WQDVPILVIVS
Sbjct:   300 KWFTIKGNRTCDVCKQEVQNLPVTLLRMQNSRGSIGAPD--AEAAHYSLWQDVPILVIVS 357

Query:   362 MLAYFCFLEELLVGKMKSGAIAISLPFSCILGL 394
             MLAYFCFLE+LL+ KM+SGAIA+SLPFSC+LGL
Sbjct:   358 MLAYFCFLEQLLLTKMQSGAIAVSLPFSCVLGL 390
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006426 PIT1 "pitchoun 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154109 AT5G62460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023186001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (513 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 3e-18
pfam1290647 pfam12906, RINGv, RING-variant domain 9e-15
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 3e-08
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 3e-05
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 77.7 bits (192), Expect = 3e-18
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 268 VCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCK 317
           +CRIC  E  EG D L   C CKG L + H+EC  +W +  GNKTCE+CK
Sbjct: 1   ICRICHDEGDEG-DPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 431
PHA02825162 LAP/PHD finger-like protein; Provisional 99.69
KOG1609323 consensus Protein involved in mRNA turnover and st 99.63
PHA02862156 5L protein; Provisional 99.63
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.6
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.53
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.47
KOG3053 293 consensus Uncharacterized conserved protein [Funct 99.24
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.02
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.0
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.15
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.1
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.02
PHA02929238 N1R/p28-like protein; Provisional 97.01
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.91
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.88
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.87
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.78
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.74
COG52191525 Uncharacterized conserved protein, contains RING Z 96.43
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 96.33
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.18
KOG149384 consensus Anaphase-promoting complex (APC), subuni 95.91
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 95.78
PHA02926242 zinc finger-like protein; Provisional 95.53
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.39
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.84
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 94.25
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.24
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.16
PF1463444 zf-RING_5: zinc-RING finger domain 92.93
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 92.52
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.4
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 92.38
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 91.98
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 88.24
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 88.12
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 87.0
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 83.69
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 83.23
KOG4445368 consensus Uncharacterized conserved protein, conta 81.88
KOG0825 1134 consensus PHD Zn-finger protein [General function 81.45
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 80.51
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 80.34
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information 
Probab=99.69  E-value=5.1e-17  Score=148.68  Aligned_cols=62  Identities=29%  Similarity=0.647  Sum_probs=53.8

Q ss_pred             CCCCCCCCcceeeccccCCCCCceecccCCCCcccccCHHHHHHHHHhcCCcccccccceeeeccc
Q 014057          260 EDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPV  325 (431)
Q Consensus       260 Edi~Eee~vCRICl~e~~e~~~~Li~PC~CkGsLk~VH~~CL~kW~~~sgs~~CEICk~~y~n~pv  325 (431)
                      ||..+.++.||||+++..    .+..||.|+|+++|||++||++|+..+++..||+|+++|.....
T Consensus         2 ~~~s~~~~~CRIC~~~~~----~~~~PC~CkGs~k~VH~sCL~rWi~~s~~~~CeiC~~~Y~i~~~   63 (162)
T PHA02825          2 EDVSLMDKCCWICKDEYD----VVTNYCNCKNENKIVHKECLEEWINTSKNKSCKICNGPYNIKKN   63 (162)
T ss_pred             CCcCCCCCeeEecCCCCC----CccCCcccCCCchHHHHHHHHHHHhcCCCCcccccCCeEEEEEe
Confidence            455567899999997742    34689999999999999999999999999999999999988743

>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
1vyx_A60 Solution Structure Of The Kshv K3 N-Terminal Domain 4e-06
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 1e-04
>pdb|1VYX|A Chain A, Solution Structure Of The Kshv K3 N-Terminal Domain Length = 60 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 9/58 (15%)
Query: 260 EDIPEEEAVCRICFIELG-EGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVC 316
           ED+P    VC IC  ELG E F A    CGC GEL   HR C   W +I  N  C++C
Sbjct: 4   EDVP----VCWICNEELGNERFRA----CGCTGELENVHRSCLSTWLTISRNTACQIC 53
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 6e-20
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 2e-19
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 3e-05
3nw0_A238 Non-structural maintenance of chromosomes element 2e-04
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 82.7 bits (204), Expect = 6e-20
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 256 DDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEV 315
             G    P  + +CRIC  E G+    L   C C G L F H+ C  +W      + CE+
Sbjct: 5   SSGTSITPSSQDICRICHCE-GDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCEL 63

Query: 316 CKQE 319
           CK E
Sbjct: 64  CKYE 67
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.68
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.58
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.41
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.3
2ect_A78 Ring finger protein 126; metal binding protein, st 98.22
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.19
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.15
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.12
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.99
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.95
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.94
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.88
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.87
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.85
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.84
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.75
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.73
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.65
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.64
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.63
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.63
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.61
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.61
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.61
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.58
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.56
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.55
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.54
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.48
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.48
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.46
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.31
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.2
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.04
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.02
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.0
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.91
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.86
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.86
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.83
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.81
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.78
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.72
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.66
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.5
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.49
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.3
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.17
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.17
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.08
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.08
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 95.92
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 95.84
2ea5_A68 Cell growth regulator with ring finger domain prot 95.51
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 95.49
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.3
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 95.13
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 94.95
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 94.65
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 94.51
3nw0_A238 Non-structural maintenance of chromosomes element 94.44
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 94.16
2f42_A179 STIP1 homology and U-box containing protein 1; cha 93.69
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.58
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 93.48
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 90.58
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 90.5
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 89.75
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 88.11
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 87.68
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 85.21
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 82.07
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.68  E-value=1.5e-17  Score=128.00  Aligned_cols=56  Identities=38%  Similarity=0.805  Sum_probs=50.0

Q ss_pred             CCCCcceeeccccCCCCCceecccCCCCcccccCHHHHHHHHHhcCCcccccccceeee
Q 014057          264 EEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVEN  322 (431)
Q Consensus       264 Eee~vCRICl~e~~e~~~~Li~PC~CkGsLk~VH~~CL~kW~~~sgs~~CEICk~~y~n  322 (431)
                      +++..||||+++.   ++.+++||.|+|++++||+.||.+|+..+++.+||+|+++|..
T Consensus         4 ~~~~~CrIC~~~~---~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            4 EDVPVCWICNEEL---GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEEC---SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCEeEEeecCC---CCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            3578999999874   3457899999999999999999999999999999999999864
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 431
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 7e-09
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.004
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 49.5 bits (117), Expect = 7e-09
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 264 EEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQE 319
           E+  VC IC  ELG         CGC GEL   HR C   W +I  N  C++C   
Sbjct: 4   EDVPVCWICNEELGNER---FRACGCTGELENVHRSCLSTWLTISRNTACQICGVV 56
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.42
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.36
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.03
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.96
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.85
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.82
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.78
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.74
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.83
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.67
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.36
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.21
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.29
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 95.06
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 94.85
d2c2la280 STIP1 homology and U box-containing protein 1, STU 94.73
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 92.75
d1wema_76 Death associated transcription factor 1, Datf1 (DI 82.2
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.42  E-value=3.4e-14  Score=106.35  Aligned_cols=56  Identities=38%  Similarity=0.805  Sum_probs=49.8

Q ss_pred             CCCCcceeeccccCCCCCceecccCCCCcccccCHHHHHHHHHhcCCcccccccceeee
Q 014057          264 EEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVEN  322 (431)
Q Consensus       264 Eee~vCRICl~e~~e~~~~Li~PC~CkGsLk~VH~~CL~kW~~~sgs~~CEICk~~y~n  322 (431)
                      |+..+|+||+++.   ++.++.||.|+|..+++|+.||.+|+..+++.+|++|+++|..
T Consensus         4 ed~~~C~IC~~~~---~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           4 EDVPVCWICNEEL---GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEEC---SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCccCCccC---CCceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            4568999999765   3467899999999999999999999999999999999999874
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure