Citrus Sinensis ID: 014064
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 431 | ||||||
| 449440973 | 475 | PREDICTED: putative FBD-associated F-box | 0.955 | 0.867 | 0.336 | 3e-57 | |
| 255540581 | 457 | ubiquitin-protein ligase, putative [Rici | 0.911 | 0.859 | 0.362 | 2e-56 | |
| 255544812 | 464 | ubiquitin-protein ligase, putative [Rici | 0.941 | 0.875 | 0.338 | 2e-54 | |
| 302142991 | 402 | unnamed protein product [Vitis vinifera] | 0.742 | 0.796 | 0.381 | 6e-51 | |
| 357477131 | 447 | F-box family-6 [Medicago truncatula] gi| | 0.823 | 0.794 | 0.322 | 6e-41 | |
| 297736820 | 487 | unnamed protein product [Vitis vinifera] | 0.937 | 0.829 | 0.276 | 3e-33 | |
| 356544606 | 444 | PREDICTED: putative F-box protein At3g58 | 0.928 | 0.900 | 0.278 | 5e-33 | |
| 147865783 | 1789 | hypothetical protein VITISV_020815 [Viti | 0.937 | 0.225 | 0.274 | 1e-32 | |
| 242064210 | 494 | hypothetical protein SORBIDRAFT_04g00522 | 0.835 | 0.728 | 0.281 | 2e-32 | |
| 260446994 | 504 | OO_Ba0005L10-OO_Ba0081K17.27 [Oryza offi | 0.839 | 0.718 | 0.289 | 8e-32 |
| >gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 229 bits (583), Expect = 3e-57, Method: Compositional matrix adjust.
Identities = 150/446 (33%), Positives = 243/446 (54%), Gaps = 34/446 (7%)
Query: 11 DAPEKQK-ENLEDWFSRFPDDILIHIISGLTLKEAARTSVLSSRWKYLWTFTTSLDFD-- 67
+ PE ++ + D S P DIL+ I+S L LKEAARTS LS +W+ LW+F L+FD
Sbjct: 33 EEPENERCDRSVDSISHLPQDILVFILSLLPLKEAARTSTLSHKWRCLWSFIPCLNFDAH 92
Query: 68 KKVKYMSFPPD---YQQSKYISWVNKVLELHRGSRINQFRICFRLDAKHKCNITNWVNTA 124
KK+ + F + ++ +++ WVN+V++ ++GS + RI F LD+ +C++ WV A
Sbjct: 93 KKLLDLQFTDENLKSERRQFVKWVNRVIDSYKGSNLETLRIRFNLDSSFQCDVDRWVQFA 152
Query: 125 IAKNVRNFELDL---------SPGTYDNYYEIPQECYKNLQSGCGLSGIKSLRSLTLCAV 175
+ ++ FEL+L SP ++ + P+E + S SL++L L AV
Sbjct: 153 MQWKLKMFELNLSDSYDSGIYSPCSFPQLSDGPKENFPRFM----FSNSSSLKTLKLIAV 208
Query: 176 NVTGEVVEFFIHNCPLLENLRITQSPDLLSLKVVGSSIPLKCLDIQFCYSIKEIEISAPN 235
NV GE +E F+ N PLLE L + S LLSL+VVG+S+ L+ L++ C ++ +E+SAPN
Sbjct: 209 NVGGEALECFLTNSPLLEILVVEYSHCLLSLRVVGASLKLRQLEVCMCNYLESLEVSAPN 268
Query: 236 LLSFKYIGQDINLHVGSLPQLVDVVFHVTPMVQKMHCIGSIVSYLPQLKTLELDGCNEVF 295
L SFKY+G +++ + + P+L++ F V+ + + SY QL+ L LD +
Sbjct: 269 LESFKYVGPWLSMPLKNTPKLLETYFGSEFGVEIIDHFFLLSSYSSQLQKLILDLEVDFM 328
Query: 296 AQFSQREFPKLMN---LNISFTAANQETLLGLSFIMKACPFLEKLVLQIWNNGRRIGKKR 352
R++P L N L + A +L+G + ++KA P L K L++ +
Sbjct: 329 ENQGFRKWPILANLKELKLIVIAEGHSSLIGFTSLIKASPSLLKFTLKLDYLDMFEQRPL 388
Query: 353 HQISKHSHQHLKLVELQGFNGREIDFELAFYVFENATMLEKMIIKPSGSRKRTTL----- 407
++ K HQ++K+VEL GF G+ ID EL Y +NA LE++I + T+
Sbjct: 389 RKVKKFPHQYIKVVELAGFVGKPIDLELVQYFHKNAVALEEIIFDTRKPKDMGTIFEKKQ 448
Query: 408 -------KNSTNMLKAKLPRGVKLTV 426
+ N L++KL GVK+T+
Sbjct: 449 NAETIAGRECANGLRSKLFSGVKVTI 474
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|242064210|ref|XP_002453394.1| hypothetical protein SORBIDRAFT_04g005220 [Sorghum bicolor] gi|241933225|gb|EES06370.1| hypothetical protein SORBIDRAFT_04g005220 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|260446994|emb|CBG76276.1| OO_Ba0005L10-OO_Ba0081K17.27 [Oryza officinalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 431 | ||||||
| TAIR|locus:2157922 | 444 | AT5G53840 "AT5G53840" [Arabido | 0.837 | 0.813 | 0.265 | 1.7e-17 | |
| TAIR|locus:2122754 | 409 | AT4G10400 "AT4G10400" [Arabido | 0.856 | 0.902 | 0.274 | 8.2e-17 | |
| TAIR|locus:2201522 | 456 | AT1G66300 "AT1G66300" [Arabido | 0.422 | 0.399 | 0.254 | 1.9e-15 | |
| TAIR|locus:2037578 | 458 | AT1G78750 "AT1G78750" [Arabido | 0.410 | 0.386 | 0.261 | 3.5e-15 | |
| TAIR|locus:2008276 | 435 | AT1G51370 "AT1G51370" [Arabido | 0.812 | 0.804 | 0.271 | 4.3e-15 | |
| TAIR|locus:2015681 | 449 | AT1G16930 "AT1G16930" [Arabido | 0.575 | 0.552 | 0.267 | 2.2e-14 | |
| TAIR|locus:2099644 | 481 | AT3G03360 [Arabidopsis thalian | 0.501 | 0.449 | 0.295 | 2.3e-14 | |
| TAIR|locus:2162454 | 437 | AT5G22700 "AT5G22700" [Arabido | 0.424 | 0.418 | 0.262 | 5.5e-14 | |
| TAIR|locus:2155327 | 438 | AT5G44950 "AT5G44950" [Arabido | 0.524 | 0.515 | 0.291 | 7.4e-14 | |
| TAIR|locus:2010032 | 416 | AT1G13570 "AT1G13570" [Arabido | 0.559 | 0.579 | 0.270 | 8.8e-14 |
| TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 238 (88.8 bits), Expect = 1.7e-17, P = 1.7e-17
Identities = 108/407 (26%), Positives = 194/407 (47%)
Query: 21 EDWFSRFPDDILIHIISGLTLKEAARTSVLSSRWKYLWTFTTSLDFDKKVKYMSFPPDYQ 80
E+ S+ PD ++ I+S L+ K+A RTS+LS+RW+ LW LDFD + + SF
Sbjct: 17 EERLSQLPDHLICVILSHLSTKDAVRTSILSTRWRNLWQLVPVLDFDSR-ELRSF----- 70
Query: 81 QSKYISWVNKVLELHRGSRINQFRICFRLDAKHKCNITNWVNTAIAKNVRNFELDLSPGT 140
S+++S+ LH+ S I + R+C D +T+W++ +++ +D+S T
Sbjct: 71 -SEFVSFAGSFFYLHKDSYIQKLRVCI-YDLAGNYYLTSWIDLVTRHRIQH--IDISVFT 126
Query: 141 YDNYYEIPQECYK-----NLQ-SGCGLSGIK-----SLRSLTLCAVNVTGEVVEFFIHNC 189
+ IP Y +L+ S + ++ L+ L L VN T E I +C
Sbjct: 127 CSGFGVIPLSLYTCDTLVHLKLSRVTMVNVEFVSLPCLKILDLDFVNFTNETTLDKIISC 186
Query: 190 -PLLENLRITQSPDLLSLKVVG-SSIPLKCLDIQFCYSIKE-IEISAPNL--LSFK-YIG 243
P+LE L I +S + ++K++ S LK ++I + + I P L LS K +
Sbjct: 187 SPVLEELTIVKSSED-NVKIIQVRSQTLKRVEIHRRFDRHNGLVIDTPLLQFLSIKAHSI 245
Query: 244 QDIN-LHVGSLPQL-VDVVFHVTPMVQKMHCIGSIVSYLPQLKTLEL-DGC-NEVFAQFS 299
+ I +++G ++ +DV + + + ++++L + G ++F
Sbjct: 246 KSIEFINLGFTTKVDIDVNLLDPNDLSNRSMTRDFFTTISRVRSLVIRHGTIKDIFHYME 305
Query: 300 Q---REFPKLMNLNISFTAANQETLLGLSFIMKACPFLEKLVLQIWNNGRRIGKKRHQIS 356
++F L L+ + +N E LL L +K+CP LE L L++ + + KK +S
Sbjct: 306 LEPLQQFCYLSELSAVCSISNLEMLLNL---LKSCPKLESLSLKLVDYEKN--KKEEVMS 360
Query: 357 KHSH-----QHLKLVELQG-FNGREIDFELAFYVFENATMLEKMIIK 397
LK V+L+ G + ++A Y EN+T+LEK+ +K
Sbjct: 361 STVPPPCLVSSLKFVKLESQLLGCGTELKVARYFLENSTILEKLTLK 407
|
|
| TAIR|locus:2122754 AT4G10400 "AT4G10400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201522 AT1G66300 "AT1G66300" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008276 AT1G51370 "AT1G51370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162454 AT5G22700 "AT5G22700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155327 AT5G44950 "AT5G44950" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| Sb04g005220.1 | hypothetical protein (494 aa) | |||||||
(Sorghum bicolor) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 431 | |||
| pfam08387 | 51 | pfam08387, FBD, FBD | 2e-06 | |
| smart00579 | 72 | smart00579, FBD, domain in FBox and BRCT domain co | 0.001 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 0.002 |
| >gnl|CDD|203925 pfam08387, FBD, FBD | Back alignment and domain information |
|---|
Score = 44.4 bits (106), Expect = 2e-06
Identities = 17/35 (48%), Positives = 24/35 (68%)
Query: 362 HLKLVELQGFNGREIDFELAFYVFENATMLEKMII 396
L+ VE +G+ G E + ELA Y+ ENA +L+KM I
Sbjct: 15 SLETVEWRGYRGEEEELELAKYILENARVLKKMTI 49
|
This region is found in F-box (pfam00646) and other domain containing plant proteins; it is repeated in two family members. Its precise function is unknown, but it is thought to be associated with nuclear processes. In fact, several family members are annotated as being similar to transcription factors. Length = 51 |
| >gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.6 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.53 | |
| smart00579 | 72 | FBD domain in FBox and BRCT domain containing plan | 99.17 | |
| PF08387 | 51 | FBD: FBD; InterPro: IPR013596 This region is found | 98.84 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.71 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.31 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.28 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.23 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.18 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.99 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.9 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.69 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.63 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.59 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.54 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.51 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.36 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.15 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.0 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.82 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.67 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.58 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.51 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.49 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.23 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.19 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.83 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.65 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 94.75 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 94.29 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 94.25 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 93.95 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 93.62 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 93.3 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 92.49 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 92.28 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.07 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 91.94 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 91.9 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 91.61 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 91.35 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 91.17 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 90.88 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 90.43 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 89.84 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 89.61 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 89.47 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 89.37 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 88.51 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 87.59 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 87.38 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 86.12 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 85.87 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 84.74 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 84.61 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 84.56 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 84.54 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 83.39 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 82.8 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 82.69 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 82.14 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 81.38 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 81.27 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 81.09 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.60 E-value=6.6e-17 Score=149.00 Aligned_cols=341 Identities=17% Similarity=0.223 Sum_probs=196.5
Q ss_pred CCCHHHHHHHHhcCChHHHHHHHHHhhhhhhc------ccccceeeeccCcccCCCCCchhHhHHHHHHHHHHHhcCCCC
Q 014064 26 RFPDDILIHIISGLTLKEAARTSVLSSRWKYL------WTFTTSLDFDKKVKYMSFPPDYQQSKYISWVNKVLELHRGSR 99 (431)
Q Consensus 26 ~LPd~lL~~Ils~L~~~~~~r~s~vSrrWr~l------w~~~~~l~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~~ 99 (431)
.||.|++..|||+|.++...|++++|+-|..+ |.+...++|..+++ ..|-..+.++.|.+
T Consensus 74 ~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~--------------g~VV~~~~~Rcgg~ 139 (483)
T KOG4341|consen 74 SLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVD--------------GGVVENMISRCGGF 139 (483)
T ss_pred cCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCC--------------CcceehHhhhhccc
Confidence 49999999999999999999999999999864 88887776654411 22333334444566
Q ss_pred eeEEEEEEecCCCCCccHhHHHHHHh-hcCceEEEEEcCCCCCCCc-cccccccccccCCCCCCCCCCCCCEEEEeeE-E
Q 014064 100 INQFRICFRLDAKHKCNITNWVNTAI-AKNVRNFELDLSPGTYDNY-YEIPQECYKNLQSGCGLSGIKSLRSLTLCAV-N 176 (431)
Q Consensus 100 l~~l~l~~~~~~~~~~~~~~wi~~~~-~~~v~eL~l~~~~~~~~~~-~~lp~~~~~~l~lp~~~~~~~~L~~L~L~~~-~ 176 (431)
++.++++...... ....-..+. -+++++|.+..+....+.. ..+. ..|+.|++|.|..| .
T Consensus 140 lk~LSlrG~r~v~----~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla-------------~~C~~l~~l~L~~c~~ 202 (483)
T KOG4341|consen 140 LKELSLRGCRAVG----DSSLRTFASNCPNIEHLALYGCKKITDSSLLSLA-------------RYCRKLRHLNLHSCSS 202 (483)
T ss_pred cccccccccccCC----cchhhHHhhhCCchhhhhhhcceeccHHHHHHHH-------------Hhcchhhhhhhcccch
Confidence 8888886653221 111111222 2367777665553221111 1221 34566777776664 4
Q ss_pred EcchhHHHHHhcCCccceeeeccCCCCceeeee---cCCCCcceEEeeccCCcc-----eEEEeCCceeEEEEecee-ee
Q 014064 177 VTGEVVEFFIHNCPLLENLRITQSPDLLSLKVV---GSSIPLKCLDIQFCYSIK-----EIEISAPNLLSFKYIGQD-IN 247 (431)
Q Consensus 177 ~~~~~l~~ll~~cp~Le~L~L~~~~~~~~l~i~---~~~~~L~~L~l~~c~~l~-----~i~i~ap~L~~L~~~~~~-~~ 247 (431)
+++..++.+..+||+|+.|++..|..+..-.+. ..+..++.+...+|...+ .+.-..+.+..+++..+. ++
T Consensus 203 iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lT 282 (483)
T KOG4341|consen 203 ITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLT 282 (483)
T ss_pred hHHHHHHHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhcccc
Confidence 455556666666777777777766554331111 123445555555554211 122222333333321110 00
Q ss_pred -----eecCCCCCceeEEEEeecCcchhhHH-HhhhccCCCceEEEeeeceeeecccccc---cCCCccEEEEEEeecCc
Q 014064 248 -----LHVGSLPQLVDVVFHVTPMVQKMHCI-GSIVSYLPQLKTLELDGCNEVFAQFSQR---EFPKLMNLNISFTAANQ 318 (431)
Q Consensus 248 -----~~~~~~~~L~~l~i~~~~~~~~~~~~-~~~~~~~~~l~~L~l~~~~~~~~~~~~~---~~~~L~~L~l~~~~~~~ 318 (431)
.+--.+..|+.+...-... ..+.. ..+...+++|+.|.+..+.++.+..+.. ..+.|..|.+.-++.
T Consensus 283 D~~~~~i~~~c~~lq~l~~s~~t~--~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~-- 358 (483)
T KOG4341|consen 283 DEDLWLIACGCHALQVLCYSSCTD--ITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGL-- 358 (483)
T ss_pred chHHHHHhhhhhHhhhhcccCCCC--CchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccce--
Confidence 0000122233222221111 11222 2788899999999998888544433322 256677776655433
Q ss_pred ccHHHHHHHHhhCCCcceEEEEeeccccccCCCCccc---ccCccCCccEEEEeeeecCch-hHHHHHHHHhcCcccccE
Q 014064 319 ETLLGLSFIMKACPFLEKLVLQIWNNGRRIGKKRHQI---SKHSHQHLKLVELQGFNGREI-DFELAFYVFENATMLEKM 394 (431)
Q Consensus 319 ~~~~~l~~ll~~~p~L~~L~i~~~~~~~~~~~~~~~~---~~~~~~~L~~v~i~~~~g~~~-e~~l~~~ll~~a~~Le~m 394 (431)
.....+..+-.+||.|++|.++- +....++|... ..|...+|+.+++.+..+... .++. +.+++.||++
T Consensus 359 ~~d~tL~sls~~C~~lr~lslsh---ce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~d~~Le~----l~~c~~Leri 431 (483)
T KOG4341|consen 359 ITDGTLASLSRNCPRLRVLSLSH---CELITDEGIRHLSSSSCSLEGLEVLELDNCPLITDATLEH----LSICRNLERI 431 (483)
T ss_pred ehhhhHhhhccCCchhccCChhh---hhhhhhhhhhhhhhccccccccceeeecCCCCchHHHHHH----HhhCccccee
Confidence 34446889999999999999962 33334444322 268889999999999877643 3333 5688999998
Q ss_pred EEEeCCCchhhHHH
Q 014064 395 IIKPSGSRKRTTLK 408 (431)
Q Consensus 395 ~i~~~~~~~~~~~~ 408 (431)
.++...+...+.+.
T Consensus 432 ~l~~~q~vtk~~i~ 445 (483)
T KOG4341|consen 432 ELIDCQDVTKEAIS 445 (483)
T ss_pred eeechhhhhhhhhH
Confidence 88877765554433
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00579 FBD domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
| >PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 431 | |||
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 7e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-10 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-04 |
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
Score = 65.0 bits (158), Expect = 2e-11
Identities = 49/382 (12%), Positives = 124/382 (32%), Gaps = 63/382 (16%)
Query: 24 FSRFPDDILIHIISGLT----LKEAARTSVLSSRWKYL-WTFTTSLDFDKKVKYMSFPPD 78
DD++ +++ +T A+ RW + + + PD
Sbjct: 13 CVATVDDVIEQVMTYITDPKDRDSASLV---CRRWFKIDSETREHVTMA---LCYTATPD 66
Query: 79 YQQSKYISWVNKVLELHRGSRINQFRICFRLDAKHKCNITNWVNTAIAKNVRNFE-LDLS 137
++ + + L+L R F L ++ T I+ N+R + +
Sbjct: 67 RLSRRFPNL--RSLKLKGKPRAA----MFNLIPENWGGYVTPWVTEISNNLRQLKSVHFR 120
Query: 138 PGTYDNY--YEIPQECYKNLQ----SGC------GLSGI----KSLRSLTL---CAVNVT 178
+ + + +L+ C GL I + +++L +
Sbjct: 121 RMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKD 180
Query: 179 GEVVEFFIHNCPLLENLRITQSP----DLLSLKVVGSSIP-LKCLDIQFCYSIKEIEI-- 231
G+ + + LE L + L+ + + L + + ++ +
Sbjct: 181 GKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFK 240
Query: 232 SAPNL-------LSFKYIGQDINLHVGSLPQLVDV-VFHVTPMVQKMHCIGSIVSYLPQL 283
+A NL L+ + +++ +L + + ++ P + + + + Q+
Sbjct: 241 AAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGP-----NEMPILFPFAAQI 295
Query: 284 KTLELDGCNEVFAQFSQ--REFPKLMNLNISFTAANQETLLGLSFIMKACPFLEKLVLQI 341
+ L+L ++ P L L N GL + + C L++L ++
Sbjct: 296 RKLDLLYALLETEDHCTLIQKCPNLEVLETR----NVIGDRGLEVLAQYCKQLKRLRIER 351
Query: 342 WNNGRRIGKKRHQISKHSHQHL 363
+ + + + +S+ L
Sbjct: 352 GADEQGMEDEEGLVSQRGLIAL 373
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.83 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.81 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.67 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.82 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.8 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.77 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.77 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.62 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.5 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.42 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.4 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.39 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.37 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.36 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.32 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.31 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.3 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.27 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.26 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.26 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.24 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.2 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.14 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.13 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.12 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.11 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.09 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.08 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.03 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.03 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.01 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.01 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.01 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.0 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.98 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.97 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.95 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.93 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.93 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.93 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.93 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.92 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.92 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.92 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.91 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.91 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.9 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.89 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 97.88 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.84 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.82 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.82 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.82 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.81 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.81 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.81 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.8 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.8 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.8 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.79 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.79 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.78 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.75 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.74 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.74 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.74 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.71 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.7 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.7 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.68 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.67 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.65 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.64 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.63 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.6 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.58 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.57 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.56 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.55 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.55 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.54 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.53 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.52 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.52 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.51 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.49 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.49 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.46 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.46 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.43 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.4 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.4 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.39 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.34 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.33 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.33 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.32 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.24 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.19 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.19 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.17 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.16 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.07 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.03 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.02 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 96.98 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.95 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.94 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.89 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.79 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.78 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.77 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.73 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.56 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.55 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.38 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.34 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.3 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.24 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.22 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 96.13 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.13 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.11 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.01 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 95.95 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 95.7 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 95.48 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.16 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 95.09 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 95.0 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 94.85 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 94.7 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 94.53 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 93.81 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 93.77 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 93.74 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 93.3 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 92.88 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 92.14 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 92.06 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 91.99 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 91.98 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 91.9 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 91.72 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 90.44 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 89.73 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 87.09 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 86.61 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 86.08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 83.16 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 82.68 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 82.07 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 80.34 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.83 E-value=6.5e-20 Score=187.85 Aligned_cols=152 Identities=14% Similarity=0.197 Sum_probs=89.8
Q ss_pred CCcCCCCCHHHHHHHHhcCC-hHHHHHHHHHhhhhhhccc-ccceeeeccCcccCCCCCchhHhHHHHHHHHHHHhcCCC
Q 014064 21 EDWFSRFPDDILIHIISGLT-LKEAARTSVLSSRWKYLWT-FTTSLDFDKKVKYMSFPPDYQQSKYISWVNKVLELHRGS 98 (431)
Q Consensus 21 ~D~is~LPd~lL~~Ils~L~-~~~~~r~s~vSrrWr~lw~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~ 98 (431)
.|+|+.||||||.+||+||| .+|+++++.|||||+++.. ....+++... ... . . ...+... +
T Consensus 3 ~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~-~~~-----~-~-------~~~~~~~--~ 66 (594)
T 2p1m_B 3 KRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNC-YAV-----S-P-------ATVIRRF--P 66 (594)
T ss_dssp -------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESST-TSS-----C-H-------HHHHHHC--T
T ss_pred ccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccc-ccc-----C-H-------HHHHhhC--C
Confidence 48999999999999999999 9999999999999998721 1223344322 110 0 0 1222222 3
Q ss_pred CeeEEEEEEecCC--------CCCccHhHHHHHHhh--cCceEEEEEcCCCCCCCccccccccccccCCCCCCCCCCCCC
Q 014064 99 RINQFRICFRLDA--------KHKCNITNWVNTAIA--KNVRNFELDLSPGTYDNYYEIPQECYKNLQSGCGLSGIKSLR 168 (431)
Q Consensus 99 ~l~~l~l~~~~~~--------~~~~~~~~wi~~~~~--~~v~eL~l~~~~~~~~~~~~lp~~~~~~l~lp~~~~~~~~L~ 168 (431)
.++++.+...... .....+..|+..... .++++|++..+.........+. .++++|+
T Consensus 67 ~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~~l~-------------~~~~~L~ 133 (594)
T 2p1m_B 67 KVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIA-------------KSFKNFK 133 (594)
T ss_dssp TCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHH-------------HHCTTCC
T ss_pred CceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHHHHH-------------HhCCCCc
Confidence 4888888653110 112456788887764 3899999976532211001111 1457777
Q ss_pred EEEEeeE-EEcchhHHHHHhcCCccceeeeccCC
Q 014064 169 SLTLCAV-NVTGEVVEFFIHNCPLLENLRITQSP 201 (431)
Q Consensus 169 ~L~L~~~-~~~~~~l~~ll~~cp~Le~L~L~~~~ 201 (431)
+|.|.++ .+++..+..++.+||+|++|.|.+|.
T Consensus 134 ~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~ 167 (594)
T 2p1m_B 134 VLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD 167 (594)
T ss_dssp EEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE
T ss_pred EEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc
Confidence 7777777 55555566767777777777777664
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 431 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 2e-06 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 7e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 4e-04 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 43.9 bits (103), Expect = 2e-06
Identities = 20/102 (19%), Positives = 35/102 (34%), Gaps = 8/102 (7%)
Query: 22 DWFSRFPDDILIHIISGLTLKEAARTSVLSSRWKYLWTFTTSLDFDKKVKYMSFPPDYQQ 81
D + P +I + I + L ++ + +S W + +TSL + P
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFN 63
Query: 82 SKYISWVNKVLELHRGSRINQFRICFRLDAKHKCNI-TNWVN 122
S + K +L + + RL I NW N
Sbjct: 64 SLNLKLSQKYPKLSQ-------QDRLRLSFLENIFILKNWYN 98
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.94 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.81 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.63 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.62 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.24 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.07 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.98 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.93 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.91 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.87 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.64 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.58 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.58 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.27 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.19 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.85 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.8 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 96.8 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.76 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.71 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.46 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.24 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.22 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.22 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.1 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.05 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 95.96 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.88 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.58 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.39 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.22 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.57 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.57 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.03 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 93.85 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 92.77 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 91.91 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 91.89 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 90.57 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 89.83 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 89.64 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 85.0 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 81.58 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.03 E-value=5.3e-11 Score=72.90 Aligned_cols=35 Identities=34% Similarity=0.585 Sum_probs=32.8
Q ss_pred CCCCCHHHHHHHHhcCChHHHHHHHHHhhhhhhcc
Q 014064 24 FSRFPDDILIHIISGLTLKEAARTSVLSSRWKYLW 58 (431)
Q Consensus 24 is~LPd~lL~~Ils~L~~~~~~r~s~vSrrWr~lw 58 (431)
++.||+||+.+||+|||.+|.++++.|||+|+++-
T Consensus 1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~ 35 (41)
T d1fs1a1 1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLA 35 (41)
T ss_dssp CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHH
T ss_pred CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Confidence 57899999999999999999999999999999863
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|