Citrus Sinensis ID: 014100


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MTRCPNMKTFSQGIVSTPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTEEEDGDDEGCWEGNLNDTIKKLFNEMNSKEKIEPTLQVQ
cccccccccccccccccccccEEEEccccccccccccccHHHHcccccccccccEEEcccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEcccccccccccccccccccccEEEEEccccccEEccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEEccccccccccccccccccccEEEcccccccccccccccccHHHHHHHHHccccccccccccccc
cccccccEEEccccccccccEEEEEEcccccccccccccHHHHcccccccccccEEEccccccHHHHHcccccccccccccEEEEEcccccHHHcccHHHHHHHHHccEEEEcccccHHEEEEcccccccccccEEEcccccEEEEcccccccHccccccccEEcccccEEEEEccccccEEccHHHHHHHHHHcccEEcccccEEEEcccccccccccccccccEEEEEcccHcHHHHcccccccccccccccEEEEcccHHHHHcccccccccccEEEEEEcccccHEEccHHHHHHHHHHcEEEEcccHHHHEEEccccccccccEEEcccccEEEEcccccHHHccccccccccccccEEEEEcccccEEEccccccccccEEEEEccccccccHHHccccHHHHHHHHHHHcccccccccEEEEc
mtrcpnmktfsqgivstpklhevQVKGELRRWEGNLNSTIQKCYEEMIgfrdikylqlghfprlqeiwhgqalpvsffnnlrHLVVDDCTNMLSAIPANLIRCLNnlrwlevrncdsleevlhleelnadkehigplfpklfeltlmdlpklkrFCNFTENIIEMpelrylaiencpdmetfISNSVVhvttdnkepekltseenffltdqiqplfdekvafpqLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSklqklvtpswhlenlatlevskCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEelgylgldclpsltsfclgnyalefpslehvvvrqcptmkifsqgvvdapklnkvkpteeedgddegcwegnLNDTIKKLFNEMNskekieptlqvq
mtrcpnmktfsqgivstpklheVQVKgelrrwegnlnSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLtlstseslvnlGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKifsqgvvdapklnkvkpteeedgddegcwegNLNDTIKKLFnemnskekieptlqvq
MTRCPNMKTFSQGIVSTPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTeeedgddegcwegNLNDTIKKLFNEMNSKEKIEPTLQVQ
**************V*TPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTT***********ENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDA******************CWEGNLN**I********************
MTRCPNMKTFSQGIVSTPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTT*NKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQ*********CVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQ****APKLNKVKPTEEEDGDDEGCWEGNLNDTIKKLFNEMNS*EKIEPTL*V*
MTRCPNMKTFSQGIVSTPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNK***********EGCWEGNLNDTIKKLFNEMNSKE*********
MTRCPNMKTFSQGIVSTPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTEEEDGDDEGCWEGNLNDTIKKLFNEMNSKEKIEPTLQVQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRCPNMKTFSQGIVSTPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTEEEDGDDEGCWEGNLNDTIKKLFNEMNSKEKIEPTLQVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.946 0.303 0.364 2e-48
224083436 758 predicted protein [Populus trichocarpa] 0.834 0.473 0.303 3e-41
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.844 0.147 0.314 5e-40
147787802 1517 hypothetical protein VITISV_005047 [Viti 0.853 0.241 0.294 1e-37
302143647 759 unnamed protein product [Vitis vinifera] 0.860 0.487 0.282 1e-37
358344895 906 Resistance protein RGC2, partial [Medica 0.809 0.384 0.325 9e-37
357439633 1039 Rpp4 candidate [Medicago truncatula] gi| 0.823 0.340 0.284 4e-35
147826471 1271 hypothetical protein VITISV_031250 [Viti 0.830 0.280 0.284 1e-34
255574526 1232 Disease resistance protein RFL1, putativ 0.672 0.234 0.296 7e-34
255581680 1126 Disease resistance protein RPS2, putativ 0.802 0.306 0.304 4e-33
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  199 bits (506), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 161/442 (36%), Positives = 232/442 (52%), Gaps = 35/442 (7%)

Query: 1    MTRCPNM-KTFSQG---IVSTPKLHEVQVKGELRRWE-GNLNSTIQKCYEEMIGFRDIKY 55
            MTRC +M +   QG   I        V +  ELR     +L   I  C+EE +       
Sbjct: 847  MTRCKSMGEIVPQGRKEIKDGDDAVNVPLFPELRYLTLQDLPKLINFCFEENLMLSKPVS 906

Query: 56   LQLGHFPRL---QEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEV 112
               G    L    E+W+GQ L +SF  NLR L++ +C ++L   P++L + L NL  L+V
Sbjct: 907  TIAGRSTSLFNQAEVWNGQ-LSLSF-GNLRSLMMQNCMSLLKVFPSSLFQSLQNLEVLKV 964

Query: 113  RNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPE----- 167
             NC+ LEE+  LE LN D  H+G L PKL E+ L     L+        IIE+ +     
Sbjct: 965  ENCNQLEEIFDLEGLNVDGGHVG-LLPKLEEMCLTGCIPLEELILDGSRIIEIWQEQFPV 1023

Query: 168  -----LRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTD--QIQPLFDEK- 219
                 LR L+I    D+   I +S++         EKLT      + +  Q++ L DE+ 
Sbjct: 1024 ESFCRLRVLSICEYRDILVVIPSSMLQRL---HTLEKLTVRSCGSVKEVVQLEGLVDEEN 1080

Query: 220  --VAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLENL 277
               A  +LR LEL+ L ++++LWKEN      F NL  LKI +C  L  LV  S    NL
Sbjct: 1081 HFRALARLRELELNDLPELKYLWKENSNVGPHFQNLEILKIWDCDNLMNLVPSSVSFHNL 1140

Query: 278  ATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGY 337
            A+L++S C  LIN+L    ++SLV     KI    M+++++  + GE A   + F +L  
Sbjct: 1141 ASLDISYCCSLINLLPPLIAKSLVQHKIFKIGRSDMMKEVVANE-GENAGDEITFCKLEE 1199

Query: 338  LGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTEEEDGD 397
            + L  LP+LTSFC G Y+L FP LE VVV +CP MKIFSQG++  P+L++V     E G+
Sbjct: 1200 IELCVLPNLTSFCSGVYSLSFPVLERVVVEECPKMKIFSQGLLVTPRLDRV-----EVGN 1254

Query: 398  DEGCWEGNLNDTIKKLFNEMNS 419
            ++  W+ +LN TI  LFN  N+
Sbjct: 1255 NKEHWKDDLNTTIHLLFNTCNA 1276




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224083436|ref|XP_002307026.1| predicted protein [Populus trichocarpa] gi|222856475|gb|EEE94022.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143647|emb|CBI22400.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358344895|ref|XP_003636521.1| Resistance protein RGC2, partial [Medicago truncatula] gi|355502456|gb|AES83659.1| Resistance protein RGC2, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|357439633|ref|XP_003590094.1| Rpp4 candidate [Medicago truncatula] gi|355479142|gb|AES60345.1| Rpp4 candidate [Medicago truncatula] Back     alignment and taxonomy information
>gi|147826471|emb|CAN72797.1| hypothetical protein VITISV_031250 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255581680|ref|XP_002531643.1| Disease resistance protein RPS2, putative [Ricinus communis] gi|223528728|gb|EEF30739.1| Disease resistance protein RPS2, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.267 0.121 0.264 0.00074
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 117 (46.2 bits), Expect = 0.00074, Sum P(3) = 0.00074
 Identities = 33/125 (26%), Positives = 62/125 (49%)

Query:   252 NLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADC 311
             N++ + I     +Q+ + P +  +N+ T+ + +C  L ++  L  +  L   G + +++C
Sbjct:   700 NILEITIDWRCTIQREIIPQF--QNIRTMTIHRCEYLRDLTWLLLAPCL---GELSVSEC 754

Query:   312 KMIEQIIQLQVGEEAKGCVV---FEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQ 368
               +E++I         G      F+ L  L LD LP L S       L FP LE++V+R+
Sbjct:   755 PQMEEVISKDKAMAKLGNTSEQPFQNLTKLVLDGLPKLESIYWT--PLPFPVLEYLVIRR 812

Query:   369 CPTMK 373
             CP ++
Sbjct:   813 CPELR 817


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0045036 "protein targeting to chloroplast" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-06
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 49.1 bits (117), Expect = 3e-06
 Identities = 74/286 (25%), Positives = 129/286 (45%), Gaps = 38/286 (13%)

Query: 38  STIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALP-VSFFNNLRHLVVDDCTNMLSAI 96
           S ++K ++ +     ++ + L     L+EI      P +S   NL  L + DC++++  +
Sbjct: 621 SKLEKLWDGVHSLTGLRNIDLRGSKNLKEI------PDLSMATNLETLKLSDCSSLVE-L 673

Query: 97  PANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFC 156
           P++ I+ LN L  L++  C++LE +             G     L+ L L    +LK F 
Sbjct: 674 PSS-IQYLNKLEDLDMSRCENLEIL-----------PTGINLKSLYRLNLSGCSRLKSFP 721

Query: 157 NFTENIIEMPELRYLAIENCPDMETFISNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLF 216
           + + NI  + +L   AIE  P        S + +  +N +   L   ++  L +++QPL 
Sbjct: 722 DISTNISWL-DLDETAIEEFP--------SNLRL--ENLDELILCEMKSEKLWERVQPLT 770

Query: 217 D-EKVAFPQLRYLELSRLHKVQHLWKENDESNKAFANLIRLKISECSKLQKLVTPSWHLE 275
               +  P L  L LS +  +  L      S +    L  L+I  C  L+ L T   +LE
Sbjct: 771 PLMTMLSPSLTRLFLSDIPSLVEL----PSSIQNLHKLEHLEIENCINLETLPT-GINLE 825

Query: 276 NLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKM-IEQIIQL 320
           +L +L++S C  L     +ST+ S +NL R  I +    IE+   L
Sbjct: 826 SLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNL 871


syringae 6; Provisional. Length = 1153

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 430
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.69
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.69
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.6
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.58
KOG4341483 consensus F-box protein containing LRR [General fu 99.5
KOG4341483 consensus F-box protein containing LRR [General fu 99.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.38
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.36
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.36
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.29
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.14
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.09
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.84
KOG0617264 consensus Ras suppressor protein (contains leucine 98.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.76
KOG0617264 consensus Ras suppressor protein (contains leucine 98.65
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.57
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.32
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.18
PRK15386 426 type III secretion protein GogB; Provisional 98.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.06
PRK15386426 type III secretion protein GogB; Provisional 98.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.05
KOG4237498 consensus Extracellular matrix protein slit, conta 98.02
KOG4237498 consensus Extracellular matrix protein slit, conta 97.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.67
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.63
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.61
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.49
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.24
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.06
PLN03150623 hypothetical protein; Provisional 97.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.97
PLN03150623 hypothetical protein; Provisional 96.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.54
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.66
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.64
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 95.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.13
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.12
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.83
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 92.63
KOG2123388 consensus Uncharacterized conserved protein [Funct 92.24
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 90.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.75
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.66
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 88.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 88.75
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 84.52
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.91  E-value=8.3e-24  Score=231.64  Aligned_cols=300  Identities=19%  Similarity=0.305  Sum_probs=202.1

Q ss_pred             hhhhhhhhcccCCCCcceeeccccccceeeccCCCCCCCCCCCccEEEeecCcCCCcCCchhHHhhcCCCCEEEEecCCC
Q 014100           38 STIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDS  117 (430)
Q Consensus        38 ~~~~~l~~~l~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~  117 (430)
                      ..++.+|... .+.+|++|++.++. +..+|.+.    ..+++|+.|++++|.++..++.   +..+++|++|++++|..
T Consensus       599 ~~l~~lP~~f-~~~~L~~L~L~~s~-l~~L~~~~----~~l~~Lk~L~Ls~~~~l~~ip~---ls~l~~Le~L~L~~c~~  669 (1153)
T PLN03210        599 YPLRCMPSNF-RPENLVKLQMQGSK-LEKLWDGV----HSLTGLRNIDLRGSKNLKEIPD---LSMATNLETLKLSDCSS  669 (1153)
T ss_pred             CCCCCCCCcC-CccCCcEEECcCcc-cccccccc----ccCCCCCEEECCCCCCcCcCCc---cccCCcccEEEecCCCC
Confidence            4455665554 56899999999875 88888877    7899999999999877776543   66789999999999988


Q ss_pred             ccEeeccccccCCcCCCcccccccceeeccccccccccccCcccccCCCCccEEEEecCCCccccc--CCcceEEEecCC
Q 014100          118 LEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIENCPDMETFI--SNSVVHVTTDNK  195 (430)
Q Consensus       118 l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~--~~~L~~L~l~~~  195 (430)
                      +..+         |..+ ..+++|+.|++++|..++.+|..    ..+++|+.|++++|..+..+|  +.+|++|+++++
T Consensus       670 L~~l---------p~si-~~L~~L~~L~L~~c~~L~~Lp~~----i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n  735 (1153)
T PLN03210        670 LVEL---------PSSI-QYLNKLEDLDMSRCENLEILPTG----INLKSLYRLNLSGCSRLKSFPDISTNISWLDLDET  735 (1153)
T ss_pred             cccc---------chhh-hccCCCCEEeCCCCCCcCccCCc----CCCCCCCEEeCCCCCCccccccccCCcCeeecCCC
Confidence            8777         6665 88999999999999999988764    268999999999999888877  568999999998


Q ss_pred             CCCcccCCCcceeccCccccCCcCCCCCCCcEEecccCCCceeecccCc----hhhhhcccccEEeeccCcccccccCCc
Q 014100          196 EPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKEND----ESNKAFANLIRLKISECSKLQKLVTPS  271 (430)
Q Consensus       196 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~L~~L~L~~~~~l~~~~~~~~----~~~~~l~~L~~L~l~~c~~l~~l~~~~  271 (430)
                      .+..+++                ...+++|++|.+.++... .++....    .....+++|+.|++++|+.+..+|..+
T Consensus       736 ~i~~lP~----------------~~~l~~L~~L~l~~~~~~-~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si  798 (1153)
T PLN03210        736 AIEEFPS----------------NLRLENLDELILCEMKSE-KLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSI  798 (1153)
T ss_pred             ccccccc----------------cccccccccccccccchh-hccccccccchhhhhccccchheeCCCCCCccccChhh
Confidence            8665441                123556666666553211 1110000    000233567777777766666666666


Q ss_pred             ccCCCCCEEEEccCCCccccccccccccccCccEEEEcccccchhhhcccccccCCcceeecccceeecccCCCCceecC
Q 014100          272 WHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVVFEELGYLGLDCLPSLTSFCL  351 (430)
Q Consensus       272 ~~l~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~  351 (430)
                      ..+++|+.|++++|..++.+|..   ..+++|+.|++++|..+..+..           ...+|+.|++.+. .++.++.
T Consensus       799 ~~L~~L~~L~Ls~C~~L~~LP~~---~~L~sL~~L~Ls~c~~L~~~p~-----------~~~nL~~L~Ls~n-~i~~iP~  863 (1153)
T PLN03210        799 QNLHKLEHLEIENCINLETLPTG---INLESLESLDLSGCSRLRTFPD-----------ISTNISDLNLSRT-GIEEVPW  863 (1153)
T ss_pred             hCCCCCCEEECCCCCCcCeeCCC---CCccccCEEECCCCCccccccc-----------cccccCEeECCCC-CCccChH
Confidence            66777777777777666666542   2466677777777766554421           0345556665552 4555543


Q ss_pred             CCcccCCCCccEEEeccCCCCccccCCCcCCCCceEEecccCC
Q 014100          352 GNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTEEE  394 (430)
Q Consensus       352 ~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~L~~l~l~~~~  394 (430)
                      .  ...+++|++|++.+|++++.+|.....+++|+.+++++|.
T Consensus       864 s--i~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~  904 (1153)
T PLN03210        864 W--IEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCG  904 (1153)
T ss_pred             H--HhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCc
Confidence            2  2235666666666666666666555555666666665554



syringae 6; Provisional

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 52.2 bits (124), Expect = 2e-07
 Identities = 61/339 (17%), Positives = 107/339 (31%), Gaps = 89/339 (26%)

Query: 31  RWEGNLNSTIQKCYEEMIG--FRDIKYLQLGHFPRLQEIWH-GQALPVSFFNNLRH---L 84
           + E    S + + Y E     + D +     +  RLQ      QAL       LR    +
Sbjct: 99  KTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQAL-----LELRPAKNV 153

Query: 85  VVDDCTNM---------LSAIPANLIRCLNNLR--WLEVRNCDSLEEVL-HLEEL--NAD 130
           ++D    +         L    +  ++C  + +  WL ++NC+S E VL  L++L    D
Sbjct: 154 LID---GVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQID 210

Query: 131 KE-HIGPLFPKLFELTLMDL-PKLKRFCNFTENIIEMPELRYLAI----ENCPDMETFIS 184
                        +L +  +  +L+R       +   P    L +    +N      F  
Sbjct: 211 PNWTSRSDHSSNIKLRIHSIQAELRRL------LKSKPYENCLLVLLNVQNAKAWNAFNL 264

Query: 185 NSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKEND 244
           +  + +TT  K+           +TD +                 +S  H    L    D
Sbjct: 265 SCKILLTTRFKQ-----------VTDFLSA----------ATTTHISLDHHSMTL--TPD 301

Query: 245 ESNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGL-INVLTLSTSESLVNL 303
           E        +  +       Q L  P          EV   +   ++++  S  + L   
Sbjct: 302 EVKSLLLKYLDCRP------QDL--PR---------EVLTTNPRRLSIIAESIRDGLATW 344

Query: 304 GRMKIADCKMIEQIIQ--LQVGEEA------KGCVVFEE 334
              K  +C  +  II+  L V E A          VF  
Sbjct: 345 DNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPP 383


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.79
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.77
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.71
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.7
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.63
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.62
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.62
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.52
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.51
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.51
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.5
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.5
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.5
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.49
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.46
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.45
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.44
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.43
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.43
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.37
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.36
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.32
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.3
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.27
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.2
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.2
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.1
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.01
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.0
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.0
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.99
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.98
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.95
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.94
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.93
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.92
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.89
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.69
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.59
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.21
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.95
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.9
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.87
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.82
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.63
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.3
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 85.0
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.89  E-value=3.6e-22  Score=191.24  Aligned_cols=299  Identities=16%  Similarity=0.214  Sum_probs=213.5

Q ss_pred             cccceeeeEeecccccccCccchhhhhhhhcccCCCCcceeeccccccceeeccCCCCCCCCCCCccEEEeecCcCCCcC
Q 014100           16 STPKLHEVQVKGELRRWEGNLNSTIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSA   95 (430)
Q Consensus        16 ~~~~L~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~   95 (430)
                      .+++|+++.+.+          +.+..++ .+..+++|++|+++++. +..+..     ...+++|++|++++| .+...
T Consensus        42 ~l~~L~~L~l~~----------~~i~~~~-~~~~~~~L~~L~l~~n~-i~~~~~-----~~~l~~L~~L~L~~n-~i~~~  103 (347)
T 4fmz_A           42 ELESITKLVVAG----------EKVASIQ-GIEYLTNLEYLNLNGNQ-ITDISP-----LSNLVKLTNLYIGTN-KITDI  103 (347)
T ss_dssp             HHTTCSEEECCS----------SCCCCCT-TGGGCTTCCEEECCSSC-CCCCGG-----GTTCTTCCEEECCSS-CCCCC
T ss_pred             hcccccEEEEeC----------Cccccch-hhhhcCCccEEEccCCc-cccchh-----hhcCCcCCEEEccCC-cccCc
Confidence            477788888733          3334443 36678899999999875 554332     367899999999987 55553


Q ss_pred             CchhHHhhcCCCCEEEEecCCCccEeeccccccCCcCCCcccccccceeeccccccccccccCcccccCCCCccEEEEec
Q 014100           96 IPANLIRCLNNLRWLEVRNCDSLEEVLHLEELNADKEHIGPLFPKLFELTLMDLPKLKRFCNFTENIIEMPELRYLAIEN  175 (430)
Q Consensus        96 ~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~l~~L~~L~l~~  175 (430)
                       +.  +.++++|++|++++| .+..+         +.  +..+++|+.|+++++..+..++.    +..+++|++|++.+
T Consensus       104 -~~--~~~l~~L~~L~l~~n-~i~~~---------~~--~~~l~~L~~L~l~~n~~~~~~~~----~~~l~~L~~L~l~~  164 (347)
T 4fmz_A          104 -SA--LQNLTNLRELYLNED-NISDI---------SP--LANLTKMYSLNLGANHNLSDLSP----LSNMTGLNYLTVTE  164 (347)
T ss_dssp             -GG--GTTCTTCSEEECTTS-CCCCC---------GG--GTTCTTCCEEECTTCTTCCCCGG----GTTCTTCCEEECCS
T ss_pred             -hH--HcCCCcCCEEECcCC-cccCc---------hh--hccCCceeEEECCCCCCcccccc----hhhCCCCcEEEecC
Confidence             32  778999999999988 44444         22  36788999999998876665543    67888999999988


Q ss_pred             CCCccccc----CCcceEEEecCCCCCcccCCCcceeccCccccCCcCCCCCCCcEEecccCCCceeecccCchhhhhcc
Q 014100          176 CPDMETFI----SNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDESNKAFA  251 (430)
Q Consensus       176 c~~l~~~~----~~~L~~L~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~L~~L~L~~~~~l~~~~~~~~~~~~~l~  251 (430)
                      |.. +..+    .++|++|++++|.+.+..                ....+++|+.|+++++ .++....  +   ..++
T Consensus       165 ~~~-~~~~~~~~l~~L~~L~l~~n~l~~~~----------------~~~~l~~L~~L~l~~n-~l~~~~~--~---~~~~  221 (347)
T 4fmz_A          165 SKV-KDVTPIANLTDLYSLSLNYNQIEDIS----------------PLASLTSLHYFTAYVN-QITDITP--V---ANMT  221 (347)
T ss_dssp             SCC-CCCGGGGGCTTCSEEECTTSCCCCCG----------------GGGGCTTCCEEECCSS-CCCCCGG--G---GGCT
T ss_pred             CCc-CCchhhccCCCCCEEEccCCcccccc----------------cccCCCccceeecccC-CCCCCch--h---hcCC
Confidence            763 3332    568999999988876644                2456789999999885 5665433  3   7889


Q ss_pred             cccEEeeccCcccccccCCcccCCCCCEEEEccCCCccccccccccccccCccEEEEcccccchhhhcccccccCCccee
Q 014100          252 NLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEEAKGCVV  331 (430)
Q Consensus       252 ~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~  331 (430)
                      +|+.|++++| .+..+++ +..+++|+.|++++| .+..++   ....+++|++|++++| .+.++.         ....
T Consensus       222 ~L~~L~l~~n-~l~~~~~-~~~l~~L~~L~l~~n-~l~~~~---~~~~l~~L~~L~l~~n-~l~~~~---------~~~~  285 (347)
T 4fmz_A          222 RLNSLKIGNN-KITDLSP-LANLSQLTWLEIGTN-QISDIN---AVKDLTKLKMLNVGSN-QISDIS---------VLNN  285 (347)
T ss_dssp             TCCEEECCSS-CCCCCGG-GTTCTTCCEEECCSS-CCCCCG---GGTTCTTCCEEECCSS-CCCCCG---------GGGG
T ss_pred             cCCEEEccCC-ccCCCcc-hhcCCCCCEEECCCC-ccCCCh---hHhcCCCcCEEEccCC-ccCCCh---------hhcC
Confidence            9999999987 4555544 678899999999887 455554   3577899999999887 344332         2234


Q ss_pred             ecccceeecccCCCCceecCCCcccCCCCccEEEeccCCCCccccCCCcCCCCceEEecccCC
Q 014100          332 FEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTEEE  394 (430)
Q Consensus       332 ~~~L~~L~l~~c~~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~L~~l~l~~~~  394 (430)
                      +++|+.|++.+|. ++..... ....+++|++|++++|+ ++.++. ...+++|++++++++.
T Consensus       286 l~~L~~L~L~~n~-l~~~~~~-~l~~l~~L~~L~L~~n~-l~~~~~-~~~l~~L~~L~l~~N~  344 (347)
T 4fmz_A          286 LSQLNSLFLNNNQ-LGNEDME-VIGGLTNLTTLFLSQNH-ITDIRP-LASLSKMDSADFANQV  344 (347)
T ss_dssp             CTTCSEEECCSSC-CCGGGHH-HHHTCTTCSEEECCSSS-CCCCGG-GGGCTTCSEESSSCC-
T ss_pred             CCCCCEEECcCCc-CCCcChh-HhhccccCCEEEccCCc-cccccC-hhhhhccceeehhhhc
Confidence            7899999999874 4443321 23358999999999986 444433 5678999999997765



>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.45
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.41
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.41
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.41
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.36
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.28
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.25
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.84
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.81
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.54
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.5
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.34
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.15
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 89.95
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.73  E-value=1.6e-16  Score=151.40  Aligned_cols=297  Identities=13%  Similarity=0.177  Sum_probs=162.1

Q ss_pred             hhhhhhhhcccCCCCcceeeccccccceeeccCCCCCCCCCCCccEEEeecCcCCCcCCchhHHhhcCCCCEEEEecCCC
Q 014100           38 STIQKCYEEMIGFRDIKYLQLGHFPRLQEIWHGQALPVSFFNNLRHLVVDDCTNMLSAIPANLIRCLNNLRWLEVRNCDS  117 (430)
Q Consensus        38 ~~~~~l~~~l~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~  117 (430)
                      +.++.+ +++..+++|++|+++++. +++++.     ...+++|++|++++| .+..+.+   +.++++|+.|+++++ .
T Consensus        54 ~~I~~l-~gl~~L~nL~~L~Ls~N~-l~~l~~-----l~~L~~L~~L~L~~n-~i~~i~~---l~~l~~L~~L~~~~~-~  121 (384)
T d2omza2          54 LGIKSI-DGVEYLNNLTQINFSNNQ-LTDITP-----LKNLTKLVDILMNNN-QIADITP---LANLTNLTGLTLFNN-Q  121 (384)
T ss_dssp             SCCCCC-TTGGGCTTCCEEECCSSC-CCCCGG-----GTTCTTCCEEECCSS-CCCCCGG---GTTCTTCCEEECCSS-C
T ss_pred             CCCCCc-cccccCCCCCEEeCcCCc-CCCCcc-----ccCCccccccccccc-ccccccc---ccccccccccccccc-c
Confidence            334444 456677788888888764 665431     256778888888777 3444333   557778888887765 3


Q ss_pred             ccEeecccccc-------------CCcCCCcccccccceeeccccccccc---------------cccCcccccCCCCcc
Q 014100          118 LEEVLHLEELN-------------ADKEHIGPLFPKLFELTLMDLPKLKR---------------FCNFTENIIEMPELR  169 (430)
Q Consensus       118 l~~~~~~~~~~-------------~~~~~~~~~l~~L~~L~l~~~~~l~~---------------~~~~~~~~~~l~~L~  169 (430)
                      +..+.......             .................... ..+..               ..........+++++
T Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  200 (384)
T d2omza2         122 ITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQV-TDLKPLANLTTLERLDISSNKVSDISVLAKLTNLE  200 (384)
T ss_dssp             CCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESC-CCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCS
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccc-chhhhhccccccccccccccccccccccccccccc
Confidence            33221111000             00000000000000000000 00000               000001134456677


Q ss_pred             EEEEecCCCccccc----CCcceEEEecCCCCCcccCCCcceeccCccccCCcCCCCCCCcEEecccCCCceeecccCch
Q 014100          170 YLAIENCPDMETFI----SNSVVHVTTDNKEPEKLTSEENFFLTDQIQPLFDEKVAFPQLRYLELSRLHKVQHLWKENDE  245 (430)
Q Consensus       170 ~L~l~~c~~l~~~~----~~~L~~L~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~L~~L~L~~~~~l~~~~~~~~~  245 (430)
                      .+.+.++. ++.++    .++|++|++++|.+....                ....+++|+.|++.++ .++.+.+  + 
T Consensus       201 ~l~l~~n~-i~~~~~~~~~~~L~~L~l~~n~l~~~~----------------~l~~l~~L~~L~l~~n-~l~~~~~--~-  259 (384)
T d2omza2         201 SLIATNNQ-ISDITPLGILTNLDELSLNGNQLKDIG----------------TLASLTNLTDLDLANN-QISNLAP--L-  259 (384)
T ss_dssp             EEECCSSC-CCCCGGGGGCTTCCEEECCSSCCCCCG----------------GGGGCTTCSEEECCSS-CCCCCGG--G-
T ss_pred             eeeccCCc-cCCCCcccccCCCCEEECCCCCCCCcc----------------hhhcccccchhccccC-ccCCCCc--c-
Confidence            77776654 23222    456777777777655432                2445677888887775 4555432  2 


Q ss_pred             hhhhcccccEEeeccCcccccccCCcccCCCCCEEEEccCCCccccccccccccccCccEEEEcccccchhhhccccccc
Q 014100          246 SNKAFANLIRLKISECSKLQKLVTPSWHLENLATLEVSKCHGLINVLTLSTSESLVNLGRMKIADCKMIEQIIQLQVGEE  325 (430)
Q Consensus       246 ~~~~l~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~  325 (430)
                        ..+++|+.|+++++. +..++ .+..++.++.+.+..+. +..+.   ....+++++.|+++++ .++++.       
T Consensus       260 --~~~~~L~~L~l~~~~-l~~~~-~~~~~~~l~~l~~~~n~-l~~~~---~~~~~~~l~~L~ls~n-~l~~l~-------  323 (384)
T d2omza2         260 --SGLTKLTELKLGANQ-ISNIS-PLAGLTALTNLELNENQ-LEDIS---PISNLKNLTYLTLYFN-NISDIS-------  323 (384)
T ss_dssp             --TTCTTCSEEECCSSC-CCCCG-GGTTCTTCSEEECCSSC-CSCCG---GGGGCTTCSEEECCSS-CCSCCG-------
T ss_pred             --cccccCCEeeccCcc-cCCCC-ccccccccccccccccc-ccccc---ccchhcccCeEECCCC-CCCCCc-------
Confidence              666778888877653 34443 24566777777776653 33333   2456778888888775 444442       


Q ss_pred             CCcceeecccceeecccCCCCceecCCCcccCCCCccEEEeccCCCCccccCCCcCCCCceEEeccc
Q 014100          326 AKGCVVFEELGYLGLDCLPSLTSFCLGNYALEFPSLEHVVVRQCPTMKIFSQGVVDAPKLNKVKPTE  392 (430)
Q Consensus       326 ~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~L~~l~l~~  392 (430)
                        ....+++|++|++.+| .+++++.   ...+++|++|++++| +++.++. +..+++|+.+++++
T Consensus       324 --~l~~l~~L~~L~L~~n-~l~~l~~---l~~l~~L~~L~l~~N-~l~~l~~-l~~l~~L~~L~L~~  382 (384)
T d2omza2         324 --PVSSLTKLQRLFFANN-KVSDVSS---LANLTNINWLSAGHN-QISDLTP-LANLTRITQLGLND  382 (384)
T ss_dssp             --GGGGCTTCCEEECCSS-CCCCCGG---GGGCTTCCEEECCSS-CCCBCGG-GTTCTTCSEEECCC
T ss_pred             --ccccCCCCCEEECCCC-CCCCChh---HcCCCCCCEEECCCC-cCCCChh-hccCCCCCEeeCCC
Confidence              1233788888888887 5666642   334788888888766 5666553 55678888888854



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure