Citrus Sinensis ID: 014135
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 430 | 2.2.26 [Sep-21-2011] | |||||||
| Q8LPH6 | 352 | Transcription factor MYB8 | no | no | 0.330 | 0.403 | 0.813 | 2e-69 | |
| P20027 | 302 | Myb-related protein Hv33 | N/A | no | 0.3 | 0.427 | 0.755 | 3e-54 | |
| P80073 | 421 | Myb-related protein Pp2 O | N/A | no | 0.304 | 0.311 | 0.679 | 3e-52 | |
| P81393 | 232 | Myb-related protein 308 O | N/A | no | 0.379 | 0.702 | 0.539 | 8e-51 | |
| O49608 | 274 | Transcription factor MYB3 | no | no | 0.309 | 0.485 | 0.631 | 1e-50 | |
| Q9SZP1 | 282 | Transcription repressor M | no | no | 0.341 | 0.521 | 0.586 | 4e-50 | |
| Q9S9K9 | 257 | Transcription factor MYB3 | no | no | 0.304 | 0.509 | 0.641 | 5e-50 | |
| Q50EX6 | 294 | Protein ODORANT1 OS=Petun | N/A | no | 0.344 | 0.503 | 0.601 | 7e-50 | |
| P20025 | 255 | Myb-related protein Zm38 | N/A | no | 0.302 | 0.509 | 0.646 | 4e-49 | |
| P81395 | 274 | Myb-related protein 330 O | N/A | no | 0.369 | 0.580 | 0.568 | 8e-49 |
| >sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 263 bits (672), Expect = 2e-69, Method: Compositional matrix adjust.
Identities = 118/145 (81%), Positives = 130/145 (89%), Gaps = 3/145 (2%)
Query: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINY 60
MGRHSCC+KQKLRKGLWSPEEDEKLLNYIT+HGHGCWSSVPKLAGLQRCGKSCRLRWINY
Sbjct: 1 MGRHSCCFKQKLRKGLWSPEEDEKLLNYITRHGHGCWSSVPKLAGLQRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFSVQEESLIVELHAVLGNRWSQIAAQLPGRTDDEIKNLWNSSIKKKLRQRG 120
LRPDLKRGAFS EESLI+ELHA LGNRWSQIA +LPGRTD+EIKN WNS +KKKLR++G
Sbjct: 61 LRPDLKRGAFSQDEESLIIELHAALGNRWSQIATRLPGRTDNEIKNFWNSCLKKKLRRKG 120
Query: 121 IDPNTHKPLSEVENDKEQQLTVINK 145
IDP THKPL ++ Q L VI++
Sbjct: 121 IDPTTHKPLI---TNELQSLNVIDQ 142
|
Probable transcription factor. Arabidopsis thaliana (taxid: 3702) |
| >sp|P20027|MYB3_HORVU Myb-related protein Hv33 OS=Hordeum vulgare GN=MYB2 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 430 | ||||||
| 224124530 | 441 | predicted protein [Populus trichocarpa] | 0.974 | 0.950 | 0.699 | 1e-156 | |
| 385843225 | 428 | putative transcription factor [Populus t | 0.967 | 0.971 | 0.692 | 1e-156 | |
| 224124896 | 446 | predicted protein [Populus trichocarpa] | 0.979 | 0.943 | 0.683 | 1e-154 | |
| 147833906 | 439 | hypothetical protein VITISV_020114 [Viti | 0.974 | 0.954 | 0.656 | 1e-147 | |
| 225450423 | 439 | PREDICTED: uncharacterized protein LOC10 | 0.974 | 0.954 | 0.656 | 1e-147 | |
| 356571044 | 434 | PREDICTED: uncharacterized protein LOC10 | 0.958 | 0.949 | 0.570 | 1e-125 | |
| 356505727 | 418 | PREDICTED: uncharacterized protein LOC77 | 0.909 | 0.935 | 0.571 | 1e-124 | |
| 356505729 | 435 | PREDICTED: uncharacterized protein LOC77 | 0.909 | 0.898 | 0.550 | 1e-121 | |
| 383290953 | 440 | R2R3-MYB transcription factor MYB2 [Epim | 0.967 | 0.945 | 0.547 | 1e-115 | |
| 356574056 | 428 | PREDICTED: uncharacterized protein LOC77 | 0.946 | 0.950 | 0.543 | 1e-113 |
| >gi|224124530|ref|XP_002330046.1| predicted protein [Populus trichocarpa] gi|222871471|gb|EEF08602.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 557 bits (1435), Expect = e-156, Method: Compositional matrix adjust.
Identities = 316/452 (69%), Positives = 372/452 (82%), Gaps = 33/452 (7%)
Query: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINY 60
MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPK A LQRCGKSCRLRWINY
Sbjct: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKQADLQRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFSVQEESLIVELHAVLGNRWSQIAAQLPGRTDDEIKNLWNSSIKKKLRQRG 120
LRPDLKRGAFS QEE+LI+ELHAVLGNRWSQIAAQLPGRTD+EIKNLWNS IKKKLRQRG
Sbjct: 61 LRPDLKRGAFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCIKKKLRQRG 120
Query: 121 IDPNTHKPLSEVENDKEQQLTVINKNSDKASAESSK--DLAAEIMHPLEVSSSSEINTNN 178
IDPNTHKPLSEVEN KE+Q +K+++K S S++ + A + P +SSSS+IN +
Sbjct: 121 IDPNTHKPLSEVENCKEKQQPTADKSNEKVSNVSNELNLIEAATLQPPAISSSSKINNSK 180
Query: 179 NNNASMLNL----------VDKFAAAASNNESSTTSCRP-DLMGYFPFQKLNYGPNIGLS 227
+ N+S N+ +D+F + +ESS SCRP DLMGYFPFQKL+Y P+IGLS
Sbjct: 181 DRNSSSSNMTNTPPTKEFFLDRFGTS---HESSPASCRPSDLMGYFPFQKLDYKPSIGLS 237
Query: 228 VNTNTSSLFFNPNSTSSEMIS-EFNS-----SIIPSISASVFQTPIRVKPSISLPSE-NP 280
+N NT +L FNPNS SSEMIS EFNS +I+PS+S S+FQTPIRVKPS+SLPS+ NP
Sbjct: 238 MNPNT-TLCFNPNS-SSEMISHEFNSCMTPPTILPSVSTSMFQTPIRVKPSVSLPSDHNP 295
Query: 281 SVGTSDINGIQNWEPSSFSNNCSTSNGSTTSIELQSSSSFFEGNVFSWGITADCGKSNDQ 340
SVG+ D+NG+QNWE SSFSNN S SNGS++SIELQS+++F+E + FSWG+ A+CGKS +
Sbjct: 296 SVGSCDVNGVQNWEASSFSNNGSGSNGSSSSIELQSNTNFYESSAFSWGL-ANCGKSGE- 353
Query: 341 EAQIRALEGD-QEDIKWSEYLNTPFFLGSTIQNHQTSQSMYSDVKPEAHFISEGSNTTTW 399
E+ +R+LE D EDIKWSEYLNT FFLGSTIQN QTSQ +YS+VKPE HFI+EGS + +W
Sbjct: 354 ESHLRSLENDTAEDIKWSEYLNTTFFLGSTIQN-QTSQHVYSEVKPETHFIAEGS-SASW 411
Query: 400 IQNQHQQASQTTPA-MYTKDLQRLSVAFGQTL 430
I NQHQQASQ PA +YTKDLQRL+VAFGQ+L
Sbjct: 412 IPNQHQQASQ--PADIYTKDLQRLAVAFGQSL 441
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|385843225|gb|AFI80906.1| putative transcription factor [Populus tomentosa] | Back alignment and taxonomy information |
|---|
| >gi|224124896|ref|XP_002319449.1| predicted protein [Populus trichocarpa] gi|222857825|gb|EEE95372.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147833906|emb|CAN62191.1| hypothetical protein VITISV_020114 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225450423|ref|XP_002276091.1| PREDICTED: uncharacterized protein LOC100240910 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356571044|ref|XP_003553691.1| PREDICTED: uncharacterized protein LOC100788976 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505727|ref|XP_003521641.1| PREDICTED: uncharacterized protein LOC778182 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505729|ref|XP_003521642.1| PREDICTED: uncharacterized protein LOC778182 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|383290953|gb|AFH03054.1| R2R3-MYB transcription factor MYB2 [Epimedium sagittatum] | Back alignment and taxonomy information |
|---|
| >gi|356574056|ref|XP_003555168.1| PREDICTED: uncharacterized protein LOC778072 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 430 | ||||||
| TAIR|locus:2012375 | 366 | MYB61 "AT1G09540" [Arabidopsis | 0.360 | 0.423 | 0.830 | 6.9e-94 | |
| TAIR|locus:2027508 | 314 | MYB50 "myb domain protein 50" | 0.360 | 0.493 | 0.797 | 1.6e-76 | |
| TAIR|locus:2133382 | 348 | MYB55 "myb domain protein 55" | 0.358 | 0.442 | 0.722 | 9.8e-68 | |
| TAIR|locus:2146804 | 352 | MYB86 "myb domain protein 86" | 0.330 | 0.403 | 0.820 | 2.6e-67 | |
| TAIR|locus:2174195 | 327 | MYB43 "myb domain protein 43" | 0.388 | 0.510 | 0.573 | 3.3e-53 | |
| TAIR|locus:2195528 | 370 | AtMYB103 "myb domain protein 1 | 0.297 | 0.345 | 0.687 | 6.1e-52 | |
| TAIR|locus:2087725 | 307 | MYB67 "myb domain protein 67" | 0.365 | 0.511 | 0.591 | 6.5e-51 | |
| TAIR|locus:2075387 | 321 | MYB107 "myb domain protein 107 | 0.304 | 0.408 | 0.641 | 1.4e-50 | |
| TAIR|locus:2023951 | 365 | MYB93 "myb domain protein 93" | 0.334 | 0.394 | 0.597 | 4.7e-50 | |
| TAIR|locus:2088187 | 367 | MYB26 "myb domain protein 26" | 0.306 | 0.359 | 0.680 | 5.8e-50 |
| TAIR|locus:2012375 MYB61 "AT1G09540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 702 (252.2 bits), Expect = 6.9e-94, Sum P(2) = 6.9e-94
Identities = 132/159 (83%), Positives = 143/159 (89%)
Query: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINY 60
MGRHSCCYKQKLRKGLWSPEEDEKLL +IT HGHGCWSSVPKLAGLQRCGKSCRLRWINY
Sbjct: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLTHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFSVQEESLIVELHAVLGNRWSQIAAQLPGRTDDEIKNLWNSSIKKKLRQRG 120
LRPDLKRGAFS +EE+LIVELHAVLGNRWSQIA++LPGRTD+EIKNLWNSSIKKKL+QRG
Sbjct: 61 LRPDLKRGAFSPEEENLIVELHAVLGNRWSQIASRLPGRTDNEIKNLWNSSIKKKLKQRG 120
Query: 121 IDPNTHKPLSEVEN--DKEQQLTVINKNS--DKASAESS 155
IDPNTHKP+SEVE+ DK++ T NK S D S SS
Sbjct: 121 IDPNTHKPISEVESFSDKDKPTTSNNKRSGNDHKSPSSS 159
|
|
| TAIR|locus:2027508 MYB50 "myb domain protein 50" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133382 MYB55 "myb domain protein 55" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146804 MYB86 "myb domain protein 86" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174195 MYB43 "myb domain protein 43" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195528 AtMYB103 "myb domain protein 103" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087725 MYB67 "myb domain protein 67" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2088187 MYB26 "myb domain protein 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 430 | |||
| PLN03091 | 459 | PLN03091, PLN03091, hypothetical protein; Provisio | 0.0 | |
| PLN03212 | 249 | PLN03212, PLN03212, Transcription repressor MYB5; | 1e-51 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 3e-16 | |
| COG5147 | 512 | COG5147, REB1, Myb superfamily proteins, including | 1e-14 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 1e-11 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 3e-11 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 1e-10 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 4e-09 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 5e-08 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 9e-07 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 2e-04 |
| >gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 589 bits (1519), Expect = 0.0
Identities = 287/466 (61%), Positives = 346/466 (74%), Gaps = 46/466 (9%)
Query: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINY 60
MGRHSCCYKQKLRKGLWSPEEDEKLL +ITK+GHGCWSSVPK AGLQRCGKSCRLRWINY
Sbjct: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFSVQEESLIVELHAVLGNRWSQIAAQLPGRTDDEIKNLWNSSIKKKLRQRG 120
LRPDLKRG FS QEE+LI+ELHAVLGNRWSQIAAQLPGRTD+EIKNLWNS +KKKLRQRG
Sbjct: 61 LRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRG 120
Query: 121 IDPNTHKPLSEVENDKEQQLTVINKNSDKAS----------AESSKDLAAEIMH------ 164
IDPNTHKPLSEVEN +++ +K+ +S A++SK LAA
Sbjct: 121 IDPNTHKPLSEVENGEDKNPPTDDKSDKASSVVSNELNLLKADNSKPLAALQEKRSSSIS 180
Query: 165 ------PLEVSSSSEINTNNNNNASMLNL----------VDKFAAAASNNESSTTSCRP- 207
+E SSSS+IN +NNNN S NL +D+F + +ESSTTSCRP
Sbjct: 181 PAGYQLEVESSSSSKINNSNNNNHSNSNLMTPTPNKDFFLDRFTTS---HESSTTSCRPS 237
Query: 208 DLMGYFPFQKLNYGPNIGLSVNTNTSSLFFNPNSTSSEMISEFNSSIIPSI-----SASV 262
DL+G+FPFQ+LNY N LS N N +L+F+ NS S EM SEF+SS+ PSI ++S
Sbjct: 238 DLVGHFPFQQLNYASNARLSTNPNP-TLWFSQNSKSFEMNSEFSSSMTPSILPPSVTSSF 296
Query: 263 FQTPIRVKPSISLPSENPSVGTSDINGIQNWEPSSFSNNCSTSNGSTTSIELQSSSSFFE 322
TP+ KPSISLPS+NPS+ + +NG++NWE +FSNN ++SNGS++SIELQS+SSFFE
Sbjct: 297 LPTPMSYKPSISLPSDNPSIPSFTVNGVRNWEAGAFSNNSNSSNGSSSSIELQSNSSFFE 356
Query: 323 GNVFSWGITADCGKSNDQEAQIRALEGDQEDIKWSEYLNTPFFLGSTIQNHQTSQSMYSD 382
++FSWG+ ADCGKS D+EAQI LE D EDIKW EYL PF + +T+QN QT Q +Y++
Sbjct: 357 NSIFSWGL-ADCGKS-DKEAQIHLLESDPEDIKWPEYLQNPFLMAATLQN-QTPQPLYNE 413
Query: 383 VKPEAHFISEGSNTTTWIQNQHQQASQTTPAMYTKDLQRLSVAFGQ 428
+KPE HFI+EGS +T W NQ QQ P +YTKDLQRL+ AFGQ
Sbjct: 414 IKPETHFITEGS-STMWPHNQQQQEPLQNPDIYTKDLQRLTAAFGQ 458
|
Length = 459 |
| >gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 430 | |||
| PLN03091 | 459 | hypothetical protein; Provisional | 100.0 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 100.0 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.97 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.86 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.85 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.82 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.79 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.76 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.59 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 99.53 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 99.49 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 99.42 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.36 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.3 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.29 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.09 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.96 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.94 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.91 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.79 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.49 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.49 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.67 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.5 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.5 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.36 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 97.1 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 97.06 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 96.72 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.64 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 96.46 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.45 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.39 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 96.36 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 95.9 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 95.85 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 95.4 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.4 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 95.1 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 95.06 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 94.53 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 94.23 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 94.15 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 93.86 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 90.53 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 90.07 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 88.62 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 87.9 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 87.4 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 85.41 |
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.3e-119 Score=913.08 Aligned_cols=416 Identities=67% Similarity=1.102 Sum_probs=364.4
Q ss_pred CCCCcccccCCCCccCCCHHHHHHHHHHHHHhCCCCccccccccCccCCccccccccccccCCCCCCCCCCHHHHHHHHH
Q 014135 1 MGRHSCCYKQKLRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGAFSVQEESLIVE 80 (430)
Q Consensus 1 mgR~~~~~kp~lkKg~WT~EEDe~Ll~lV~kyG~~nW~~IA~~l~~~Rt~~QCr~Rw~n~L~p~lkkg~WT~EED~~Lle 80 (430)
|||+.||+|++++|++||+|||++|+++|++||.++|..||+.++.+|+++|||+||.++|+|.+++++||+|||++|++
T Consensus 1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe 80 (459)
T PLN03091 1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE 80 (459)
T ss_pred CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence 99999999999999999999999999999999999999999998778999999999999999999999999999999999
Q ss_pred HHHHhCCchhHHhhhCCCCCHHHHHHHHhhhhhHHHHhCCCCCCCCCcchhhhhhhcchhhHhhccCCchhh--hhhhh-
Q 014135 81 LHAVLGNRWSQIAAQLPGRTDDEIKNLWNSSIKKKLRQRGIDPNTHKPLSEVENDKEQQLTVINKNSDKASA--ESSKD- 157 (430)
Q Consensus 81 lv~k~G~~Ws~IA~~LpgRT~~QcR~RW~~~Lkk~lkk~~~~~~edk~L~e~~~~~g~~w~~Iak~~~k~~~--~~~k~- 157 (430)
++++||++|.+||+.|+|||+++||+||+.+++++++.+++++.+++++.+.+......-.. .....++.+ ....+
T Consensus 81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~t~kpl~e~E~~~d~~p~~-~~~~~~~s~~~~~el~~ 159 (459)
T PLN03091 81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSEVENGEDKNPPT-DDKSDKASSVVSNELNL 159 (459)
T ss_pred HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCccccccccccCCcc-ccccccchhhhhhhhhh
Confidence 99999999999999999999999999999999999999999999999999877654432100 000000000 00000
Q ss_pred HHHhhcCcC--------------------ccCC-------------CcCCCCCCCCCcccccchhhhhhhhccCCCCCcc
Q 014135 158 LAAEIMHPL--------------------EVSS-------------SSEINTNNNNNASMLNLVDKFAAAASNNESSTTS 204 (430)
Q Consensus 158 ~~~~~~~~~--------------------e~ss-------------Ssn~~~~~~n~~~~~~~~d~~~~~a~~~~~~~~s 204 (430)
....+.++. |..+ .++.+....+++ ||+|+|++ +||+++++
T Consensus 160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~fld~~~~---~~~~~~~~ 233 (459)
T PLN03091 160 LKADNSKPLAALQEKRSSSISPAGYQLEVESSSSSKINNSNNNNHSNSNLMTPTPNKD---FFLDRFTT---SHESSTTS 233 (459)
T ss_pred hhhhccCccccchhcccccccccccccccccccccccccccccCCccccccCCCCcch---hhhhhhcc---ccccCccC
Confidence 111111111 1111 223344445555 89999987 89999999
Q ss_pred cCC-CCCCCCCCccCCCCCCCCCCCCCCCCcccccCCCCCcccccccccccccccc-ccccC----CCcccCCCCCCCCC
Q 014135 205 CRP-DLMGYFPFQKLNYGPNIGLSVNTNTSSLFFNPNSTSSEMISEFNSSIIPSIS-ASVFQ----TPIRVKPSISLPSE 278 (430)
Q Consensus 205 c~p-d~~~yf~~q~l~y~~~~~~~~~~~~~~l~f~~~~~~~~~~s~f~~~~~~si~-~~~~~----s~~~~~p~~~~~~~ 278 (430)
|+| |++||||||+|+|+++++++++++ ++|||+|++++|+||+||+++|+++|| |+|++ ++++|||+|+||+|
T Consensus 234 c~ps~~~~~f~~qql~y~~~~~~s~~~~-~~~~~~~~~~~~~~~~e~~~s~~~~~~~p~~~~s~~~~~~~~k~~~~~p~~ 312 (459)
T PLN03091 234 CRPSDLVGHFPFQQLNYASNARLSTNPN-PTLWFSQNSKSFEMNSEFSSSMTPSILPPSVTSSFLPTPMSYKPSISLPSD 312 (459)
T ss_pred CCCCccccccchhhcccccccccCcCCC-cceeeccCCCcccccccccccccccccCCCcccccccCccccccccCCCCC
Confidence 999 999999999999999999999999 999999999999999999999999998 67766 48999999999999
Q ss_pred CCCCCCCCCCCccccCCCCCCCCCCCCCCCCCcccccccccccCCccccccccccCCCCchHHHHHhhhcCCcccccccc
Q 014135 279 NPSVGTSDINGIQNWEPSSFSNNCSTSNGSTTSIELQSSSSFFEGNVFSWGITADCGKSNDQEAQIRALEGDQEDIKWSE 358 (430)
Q Consensus 279 ~~~~~~~~~~g~~~w~~~~~~n~~~s~~~s~~s~~~~s~s~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~e~~kw~e 358 (430)
||++++++++|++|||+++++|++++++||++|+||||+|+||||++|+|||| ||+ .+|||+|+|.++.++|||||+|
T Consensus 313 n~s~~s~~~~~~~~we~~~~sn~~~~~~~~~~s~e~qs~ss~f~n~~fsw~~~-d~~-~s~k~~q~h~~~~~~eeiKW~e 390 (459)
T PLN03091 313 NPSIPSFTVNGVRNWEAGAFSNNSNSSNGSSSSIELQSNSSFFENSIFSWGLA-DCG-KSDKEAQIHLLESDPEDIKWPE 390 (459)
T ss_pred CCCCCCcccCCccccccCCCCCCCCCCCCCCccccccccchhhccCccccccc-ccc-cchhhhhhhccccchhhcchHH
Confidence 99999999999999999999999999999999999999999999999999998 998 8999999888777799999999
Q ss_pred cccCCcccccccccccCCccccccccCCcccccCCCcccccchhh-hhhccccCcccchhhhhHHHhhhccC
Q 014135 359 YLNTPFFLGSTIQNHQTSQSMYSDVKPEAHFISEGSNTTTWIQNQ-HQQASQTTPAMYTKDLQRLSVAFGQT 429 (430)
Q Consensus 359 y~~~~~~~~~~~~~~~~~~~~y~~~k~e~~~~~~~~~~~~~~~~~-~~~~~q~~~~~~~kd~qr~~~~f~~~ 429 (430)
|||+|||||+++||| ++|+||+|||+||||++|++ +++|+|+| +|+++| ++|||+||||||+||||||
T Consensus 391 yl~~~~~~~~~~q~q-~~q~ly~~ik~et~~~~~~~-~~~w~~~q~~q~~~~-~~d~~~kdlqr~~~~fg~~ 459 (459)
T PLN03091 391 YLQNPFLMAATLQNQ-TPQPLYNEIKPETHFITEGS-STMWPHNQQQQEPLQ-NPDIYTKDLQRLTAAFGQI 459 (459)
T ss_pred Hhcchhhhhhhhhhc-Cchhhhhhccchhhcccccc-ccccccccccccccc-cccccchHHHHHHHhhccC
Confidence 999999999999999 99999999999999999999 89997755 444556 9999999999999999996
|
|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 430 | ||||
| 1a5j_A | 110 | Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe | 4e-23 | ||
| 1h88_C | 159 | Crystal Structure Of Ternary Protein-Dna Complex1 L | 9e-22 | ||
| 1h8a_C | 128 | Crystal Structure Of Ternary Protein-Dna Complex3 L | 1e-21 | ||
| 1gv2_A | 105 | Crystal Structure Of C-Myb R2r3 Length = 105 | 2e-21 | ||
| 1mse_C | 105 | Solution Structure Of A Specific Dna Complex Of The | 2e-21 | ||
| 3zqc_A | 131 | Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin | 1e-14 | ||
| 3osf_A | 126 | The Structure Of Protozoan Parasite Trichomonas Vag | 3e-11 | ||
| 2k9n_A | 107 | Solution Nmr Structure Of The R2r3 Dna Binding Doma | 2e-09 | ||
| 1mbj_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 | 1e-08 | ||
| 1idy_A | 54 | Structure Of Myb Transforming Protein, Nmr, Minimiz | 1e-08 | ||
| 1gvd_A | 52 | Crystal Structure Of C-Myb R2 V103l Mutant Length = | 1e-05 | ||
| 1gv5_A | 52 | Crystal Structure Of C-Myb R2 Length = 52 | 3e-05 | ||
| 1mbg_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | 3e-05 |
| >pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 | Back alignment and structure |
|
| >pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 | Back alignment and structure |
| >pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 | Back alignment and structure |
| >pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 | Back alignment and structure |
| >pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 | Back alignment and structure |
| >pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 | Back alignment and structure |
| >pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 | Back alignment and structure |
| >pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 | Back alignment and structure |
| >pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 | Back alignment and structure |
| >pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 | Back alignment and structure |
| >pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 | Back alignment and structure |
| >pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 | Back alignment and structure |
| >pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 | Back alignment and structure |
|---|
Score = 210 bits (536), Expect = 2e-67
Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
Query: 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGAFSVQ 73
KG ++ ED+ + Y+ ++G W + R K CR RW N+L P + + A++ +
Sbjct: 2 KGPFTEAEDDLIREYVKENGPQNWPRITSFLP-NRSPKQCRERWFNHLDPAVVKHAWTPE 60
Query: 74 EESLIVELHAVLGNRWSQIAAQLPGRTDDEIKNLWNSSIKKKLRQRGIDPNTHKPLSEVE 133
E+ I + LG++WS IA +PGRTD+ IKN WNSSI K++ P +
Sbjct: 61 EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120
Query: 134 NDKEQQ 139
Sbjct: 121 RKAADV 126
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 430 | |||
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 100.0 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.98 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.97 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.97 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.97 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.97 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.96 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.94 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.8 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.79 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.79 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.76 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.75 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.68 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.68 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.65 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.64 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.64 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.63 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.63 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.62 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.61 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.59 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.59 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.57 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.56 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.55 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.54 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.52 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.52 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.51 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.51 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.5 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.48 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.47 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.47 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.46 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.45 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.44 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.44 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.39 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.38 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.05 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.33 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.31 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.3 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.29 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.28 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.28 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.26 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.8 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.16 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.16 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.14 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.1 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.08 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 98.87 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 98.83 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.81 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.72 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.64 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.63 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.53 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.39 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.38 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.37 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.25 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.25 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.23 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.12 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.92 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 97.9 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.86 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 97.79 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 97.76 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.88 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.69 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 97.59 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.51 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 97.31 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.3 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.3 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.84 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 96.83 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 96.81 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 96.7 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.63 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 96.41 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 96.25 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 95.14 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 94.4 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 93.4 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 93.27 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 90.32 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 90.05 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 84.13 |
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-36 Score=270.51 Aligned_cols=151 Identities=23% Similarity=0.480 Sum_probs=107.8
Q ss_pred CCccCCCHHHHHHHHHHHHHhCCCCccccccccCccCCccccccccccccCCCCCCCCCCHHHHHHHHHHHHHhCC-chh
Q 014135 12 LRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGAFSVQEESLIVELHAVLGN-RWS 90 (430)
Q Consensus 12 lkKg~WT~EEDe~Ll~lV~kyG~~nW~~IA~~l~~~Rt~~QCr~Rw~n~L~p~lkkg~WT~EED~~Llelv~k~G~-~Ws 90 (430)
+++++||+|||++|+++|.+||.++|..||..|+ +|++.||++||.++|+|.+++++||+|||++|+++|.+||. +|.
T Consensus 4 ~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W~ 82 (159)
T 1h89_C 4 LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLP-NRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWS 82 (159)
T ss_dssp ----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCHH
T ss_pred CCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcC-CCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccHH
Confidence 6789999999999999999999889999999998 99999999999999999999999999999999999999995 799
Q ss_pred HHhhhCCCCCHHHHHHHHhhhhhHHHHhCCCCCCCCCcchhhhhhhcchhhHhhccCCchhhhhhhhHHHhhc
Q 014135 91 QIAAQLPGRTDDEIKNLWNSSIKKKLRQRGIDPNTHKPLSEVENDKEQQLTVINKNSDKASAESSKDLAAEIM 163 (430)
Q Consensus 91 ~IA~~LpgRT~~QcR~RW~~~Lkk~lkk~~~~~~edk~L~e~~~~~g~~w~~Iak~~~k~~~~~~k~~~~~~~ 163 (430)
.||..|+|||+.||++||..+|.+.+++.+|+++||..|++++.++|.+|..|++..+.++++.+++......
T Consensus 83 ~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt~~~~knr~~~~~ 155 (159)
T 1h89_C 83 VIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTM 155 (159)
T ss_dssp HHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCCHHHHHHHHHTTT
T ss_pred HHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999766544
|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 430 | ||||
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 6e-22 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 1e-08 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 4e-20 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 6e-07 | |
| d2ckxa1 | 83 | a.4.1.3 (A:578-660) Telomere binding protein TBP1 | 7e-17 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 4e-16 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 8e-16 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 4e-10 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 8e-16 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 7e-05 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 1e-12 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 6e-08 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 5e-12 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 6e-11 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 6e-12 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 2e-11 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 1e-06 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 4e-10 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 1e-05 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 6e-09 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 5e-08 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-08 | |
| d1ug2a_ | 95 | a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu | 2e-04 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 86.3 bits (214), Expect = 6e-22
Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
Query: 12 LRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPD 64
L KG W+ EED++L+ + K+G WS + K R GK CR RW N+L P+
Sbjct: 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 430 | |||
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.67 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.67 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.62 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.6 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.59 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.59 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.52 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.51 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.45 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.41 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.39 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.37 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.37 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.36 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.34 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.31 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.31 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.28 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.24 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.21 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.18 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.18 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.06 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.0 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.98 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.85 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.81 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.65 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.96 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 97.87 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.68 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 97.51 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 96.81 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 96.79 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.56 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 95.95 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 95.45 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 95.05 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 94.58 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 87.89 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 86.81 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 85.56 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.67 E-value=5.7e-18 Score=125.33 Aligned_cols=52 Identities=44% Similarity=0.840 Sum_probs=50.0
Q ss_pred CCccCCCHHHHHHHHHHHHHhCCCCccccccccCccCCccccccccccccCCC
Q 014135 12 LRKGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPD 64 (430)
Q Consensus 12 lkKg~WT~EEDe~Ll~lV~kyG~~nW~~IA~~l~~~Rt~~QCr~Rw~n~L~p~ 64 (430)
|+||+||+|||++|+++|++||.++|..||+.|+ +|++.||++||.++|+|+
T Consensus 1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~ 52 (52)
T d1gvda_ 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52 (52)
T ss_dssp CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence 5799999999999999999999889999999999 999999999999999985
|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|