Citrus Sinensis ID: 014151

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MVAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNLEKGNLKELCSH
ccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccEEEEccEEEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccEEEcccccHHHHHHHHHHHHHHHHcccccccccHHHHccc
cccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccEEEEcccEEEEEcccHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccEHcccccEEEEEccEcccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccc
mvaagnglffPIIGFASCVAFIYMSfgglnvsypkepemgfvtrngthfmldgKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTwafndggynslqispgqfDERVFKALDHVIVEARKNGVRLLLSLVNNLqayggktqyVNWAWEegigisssndsfffdpsihKYFKHYVKTVLTRkntitgveyrndptIFAWELineprcmsdpsgdtLQDWIDEMSAFVKSIDKKHLVTVglegfygpkspkrltvnpemWASALgsdfirnsnndnidfasvhiypdhwfhdlefedDLKFVTKWMLSHIedgdkelnkpvffTEYGLsnlikgfepslRDKLYKTILDIVYKSakrkrsgaGALIWQLFVEGMEeynddfgivpwertsTYKLlteqscglgrisrlnlekgnlkelcsh
MVAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTrkntitgveyrndpTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLegfygpkspkrltVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIedgdkelnkPVFFTEYGLSNlikgfepslrdKLYKTILDIVYksakrkrsgagALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTeqscglgrisrlnlekgnlkelcsh
MVAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGIsssndsfffdpsIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNLEKGNLKELCSH
****GNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNL***********
******GLFFPIIGFASCVAFIYMSFGGLN**********FVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRIS******GNL*ELCS*
MVAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNLEKGNLKELCSH
*VAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLN*EKGN*K**CS*
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNLEKGNLKELCSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query430 2.2.26 [Sep-21-2011]
Q7Y223433 Mannan endo-1,4-beta-mann yes no 0.993 0.986 0.749 0.0
Q9M0H6431 Mannan endo-1,4-beta-mann no no 0.997 0.995 0.720 0.0
Q0JJD4445 Mannan endo-1,4-beta-mann no no 0.993 0.959 0.573 1e-147
Q0DCM5440 Mannan endo-1,4-beta-mann no no 0.872 0.852 0.516 1e-113
Q9LZV3448 Mannan endo-1,4-beta-mann no no 0.886 0.850 0.476 1e-106
Q0JKM9432 Mannan endo-1,4-beta-mann no no 0.867 0.863 0.5 1e-102
Q9FJZ3431 Mannan endo-1,4-beta-mann no no 0.886 0.883 0.443 1e-98
Q9SG94414 Mannan endo-1,4-beta-mann no no 0.869 0.903 0.437 7e-98
Q9SG95408 Putative mannan endo-1,4- no no 0.913 0.963 0.44 1e-96
Q2RBB1379 Mannan endo-1,4-beta-mann no no 0.839 0.952 0.476 9e-96
>sp|Q7Y223|MAN2_ARATH Mannan endo-1,4-beta-mannosidase 2 OS=Arabidopsis thaliana GN=MAN2 PE=2 SV=1 Back     alignment and function desciption
 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/427 (74%), Positives = 368/427 (86%)

Query: 4   AGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNS 63
            GNG   PI+GF +CVAFIY+SFG L      E E+ FV RNGT F++DGKALYVNGWNS
Sbjct: 5   TGNGPVIPILGFLTCVAFIYLSFGDLWFGLKTEGELAFVKRNGTQFVVDGKALYVNGWNS 64

Query: 64  YWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALD 123
           YW MDHAV+D+SR RV AML+AGAKMGLTVCRTWAFNDGGYN+LQISPG+FDERVFKALD
Sbjct: 65  YWFMDHAVNDHSRHRVSAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALD 124

Query: 124 HVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKH 183
           HVI EA+ +GVRLLLSLVNNLQAYGGKTQYVNWAW+EG+G+SSSNDSFFFDPSI +YFK+
Sbjct: 125 HVIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKN 184

Query: 184 YVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKK 243
           Y+  +LTRKN++TG+EYRNDPTIFAWELINEPRCMSD SGDTLQDWI+EM+AF+KSID K
Sbjct: 185 YLTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKSIDNK 244

Query: 244 HLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLE 303
           HL+TVGLEGFYGP SPK+LTVNPE WAS LGSDF+RNS++ NIDFASVHIYPDHWFHD  
Sbjct: 245 HLLTVGLEGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQG 304

Query: 304 FEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKS 363
           FE+ LKFV KWMLSHIEDGDKEL KPV FTE+GLSNL K ++PS RD+ Y+TI D++YKS
Sbjct: 305 FEEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKS 364

Query: 364 AKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNLEKGN 423
           AKRKRSGAG L+WQ  +EGME +NDDFGIVPWE+ S  +L+ EQSC L RI+  +L    
Sbjct: 365 AKRKRSGAGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITGRHLLDKK 424

Query: 424 LKELCSH 430
             E+CSH
Sbjct: 425 SIEMCSH 431

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 7EC: 8
>sp|Q9M0H6|MAN5_ARATH Mannan endo-1,4-beta-mannosidase 5 OS=Arabidopsis thaliana GN=MAN5 PE=2 SV=1 Back     alignment and function description
>sp|Q0JJD4|MAN2_ORYSJ Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica GN=MAN2 PE=2 SV=2 Back     alignment and function description
>sp|Q0DCM5|MAN6_ORYSJ Mannan endo-1,4-beta-mannosidase 6 OS=Oryza sativa subsp. japonica GN=MAN6 PE=2 SV=2 Back     alignment and function description
>sp|Q9LZV3|MAN6_ARATH Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana GN=MAN6 PE=2 SV=1 Back     alignment and function description
>sp|Q0JKM9|MAN1_ORYSJ Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica GN=MAN1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FJZ3|MAN7_ARATH Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana GN=MAN7 PE=2 SV=1 Back     alignment and function description
>sp|Q9SG94|MAN3_ARATH Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis thaliana GN=MAN3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SG95|MAN4_ARATH Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana GN=MAN4 PE=2 SV=1 Back     alignment and function description
>sp|Q2RBB1|MAN7_ORYSJ Mannan endo-1,4-beta-mannosidase 7 OS=Oryza sativa subsp. japonica GN=MAN7 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
118488294435 unknown [Populus trichocarpa] 0.993 0.981 0.773 0.0
224121924435 predicted protein [Populus trichocarpa] 0.993 0.981 0.773 0.0
297832668432 glycosyl hydrolase family 5 protein [Ara 1.0 0.995 0.748 0.0
225007946443 endo-beta-mannanase [Malus x domestica] 1.0 0.970 0.753 0.0
30681096433 mannan endo-1,4-beta-mannosidase 2 [Arab 0.993 0.986 0.749 0.0
225446370437 PREDICTED: mannan endo-1,4-beta-mannosid 0.997 0.981 0.732 0.0
302143296432 unnamed protein product [Vitis vinifera] 0.997 0.993 0.732 0.0
449444366431 PREDICTED: mannan endo-1,4-beta-mannosid 0.993 0.990 0.731 0.0
255553737431 hydrolase, hydrolyzing O-glycosyl compou 0.993 0.990 0.742 0.0
297799142431 glycosyl hydrolase family 5 protein [Ara 0.997 0.995 0.725 0.0
>gi|118488294|gb|ABK95966.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/428 (77%), Positives = 382/428 (89%), Gaps = 1/428 (0%)

Query: 2   VAAGNGLFFPIIGFASCVAFIYMSFGGLNVSYPKE-PEMGFVTRNGTHFMLDGKALYVNG 60
           + AGNGL +PI+GFASCVAFIYMSFGG  ++  +E  E+ FV RNGT FM+DG+A Y+NG
Sbjct: 4   MVAGNGLLYPILGFASCVAFIYMSFGGFILTNHQEHRELSFVERNGTQFMVDGRAFYING 63

Query: 61  WNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFK 120
           WNSYWLMDH+V +  + RVGAML+AGAKMGLTVCRTWAFNDGGYN+LQ+SPG+FDERV +
Sbjct: 64  WNSYWLMDHSVDEDRKPRVGAMLEAGAKMGLTVCRTWAFNDGGYNALQVSPGRFDERVLR 123

Query: 121 ALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKY 180
           ALD+VI EAR++GVRLLLSLVNNL+AYGGKTQYVNWAWEEGIG+SSSNDSFFFDPSI +Y
Sbjct: 124 ALDYVIAEARQHGVRLLLSLVNNLKAYGGKTQYVNWAWEEGIGLSSSNDSFFFDPSIKRY 183

Query: 181 FKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSI 240
           FKHYVKT+LTRKNTITG+EYRNDPTIFAWEL+NEPRCMSDPSGDTLQDWI+EMSAFVK+I
Sbjct: 184 FKHYVKTLLTRKNTITGIEYRNDPTIFAWELMNEPRCMSDPSGDTLQDWIEEMSAFVKTI 243

Query: 241 DKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFH 300
           DK HL+TVGLEGFYGPK+PKRLTVNPE WAS+LGSDF+RNS    IDFASVHIYPDHWF 
Sbjct: 244 DKNHLLTVGLEGFYGPKNPKRLTVNPESWASSLGSDFVRNSKAPAIDFASVHIYPDHWFP 303

Query: 301 DLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIV 360
             EFED LK+V+KWMLSHIEDG  EL+KPVFFTE+GLSNL K F+PS RD+ YKTI DI+
Sbjct: 304 HQEFEDKLKYVSKWMLSHIEDGHYELSKPVFFTEFGLSNLNKDFQPSQRDRFYKTIFDII 363

Query: 361 YKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRISRLNLE 420
           YKS+KRKR+GAGALIWQLFVEGM+++NDDFGIVPWER ST ++LT+QSC L RI  ++ +
Sbjct: 364 YKSSKRKRAGAGALIWQLFVEGMDDFNDDFGIVPWERESTNRILTDQSCRLARIHGISPQ 423

Query: 421 KGNLKELC 428
              LKELC
Sbjct: 424 NKYLKELC 431

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224121924|ref|XP_002330687.1| predicted protein [Populus trichocarpa] gi|222872291|gb|EEF09422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297832668|ref|XP_002884216.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. lyrata] gi|297330056|gb|EFH60475.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225007946|gb|ACN78665.1| endo-beta-mannanase [Malus x domestica] Back     alignment and taxonomy information
>gi|30681096|ref|NP_179660.2| mannan endo-1,4-beta-mannosidase 2 [Arabidopsis thaliana] gi|75233455|sp|Q7Y223.1|MAN2_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 2; AltName: Full=Endo-beta-1,4-mannanase 2; Short=AtMAN2; Flags: Precursor gi|30793940|gb|AAP40422.1| putative glycosyl hydrolase family 5 protein/cellulase ((1-4)-beta-mannan endohydrolase) [Arabidopsis thaliana] gi|109134159|gb|ABG25077.1| At2g20680 [Arabidopsis thaliana] gi|110737068|dbj|BAF00487.1| hypothetical protein [Arabidopsis thaliana] gi|330251962|gb|AEC07056.1| mannan endo-1,4-beta-mannosidase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225446370|ref|XP_002273772.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143296|emb|CBI21857.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449444366|ref|XP_004139946.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cucumis sativus] gi|449475777|ref|XP_004154548.1| PREDICTED: mannan endo-1,4-beta-mannosidase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255553737|ref|XP_002517909.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223542891|gb|EEF44427.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297799142|ref|XP_002867455.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. lyrata] gi|297313291|gb|EFH43714.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
TAIR|locus:2051399433 MAN2 "endo-beta-mannase 2" [Ar 0.988 0.981 0.725 1.1e-176
TAIR|locus:2123628431 MAN5 "endo-beta-mannase 5" [Ar 0.997 0.995 0.693 6.6e-168
TAIR|locus:2180987448 MAN6 "endo-beta-mannase 6" [Ar 0.865 0.830 0.469 1.8e-94
TAIR|locus:2154905431 MAN7 "AT5G66460" [Arabidopsis 0.876 0.874 0.430 5.1e-90
TAIR|locus:2103262414 AT3G10890 [Arabidopsis thalian 0.867 0.900 0.428 8.6e-88
TAIR|locus:2103197408 AT3G10900 [Arabidopsis thalian 0.913 0.963 0.425 4.3e-86
TAIR|locus:2204878411 MAN1 "endo-beta-mannanase 1" [ 0.846 0.885 0.431 1.1e-80
ASPGD|ASPL0000036201383 AN3358 [Emericella nidulans (t 0.527 0.592 0.329 2.7e-34
UNIPROTKB|Q5B7X2383 manA "Mannan endo-1,4-beta-man 0.527 0.592 0.329 2.7e-34
ASPGD|ASPL0000003297399 manC [Emericella nidulans (tax 0.611 0.659 0.349 2.3e-32
TAIR|locus:2051399 MAN2 "endo-beta-mannase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1716 (609.1 bits), Expect = 1.1e-176, P = 1.1e-176
 Identities = 310/427 (72%), Positives = 360/427 (84%)

Query:     5 GNGLFFPIIGFASCVAFIYMSFGGLNVSYPKEPEMGFVTRNGTHFMLDGKALYVNGWNSY 64
             GNG   PI+GF +CVAFIY+SFG L      E E+ FV RNGT F++DGKALYVNGWNSY
Sbjct:     6 GNGPVIPILGFLTCVAFIYLSFGDLWFGLKTEGELAFVKRNGTQFVVDGKALYVNGWNSY 65

Query:    65 WLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVFKALDH 124
             W MDHAV+D+SR RV AML+AGAKMGLTVCRTWAFNDGGYN+LQISPG+FDERVFKALDH
Sbjct:    66 WFMDHAVNDHSRHRVSAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFKALDH 125

Query:   125 VIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGIXXXXXXXXXXXXIHKYFKHY 184
             VI EA+ +GVRLLLSLVNNLQAYGGKTQYVNWAW+EG+G+            I +YFK+Y
Sbjct:   126 VIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRRYFKNY 185

Query:   185 VKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKH 244
             +  +LTRKN++TG+EYRNDPTIFAWELINEPRCMSD SGDTLQDWI+EM+AF+KSID KH
Sbjct:   186 LTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKSIDNKH 245

Query:   245 LVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEF 304
             L+TVGLEGFYGP SPK+LTVNPE WAS LGSDF+RNS++ NIDFASVHIYPDHWFHD  F
Sbjct:   246 LLTVGLEGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWFHDQGF 305

Query:   305 EDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDIVYKSA 364
             E+ LKFV KWMLSHIEDGDKEL KPV FTE+GLSNL K ++PS RD+ Y+TI D++YKSA
Sbjct:   306 EEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDVIYKSA 365

Query:   365 KRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRIS-RLNLEKGN 423
             KRKRSGAG L+WQ  +EGME +NDDFGIVPWE+ S  +L+ EQSC L RI+ R  L+K +
Sbjct:   366 KRKRSGAGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITGRHLLDKKS 425

Query:   424 LKELCSH 430
             + E+CSH
Sbjct:   426 I-EMCSH 431
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
TAIR|locus:2123628 MAN5 "endo-beta-mannase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180987 MAN6 "endo-beta-mannase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154905 MAN7 "AT5G66460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103262 AT3G10890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103197 AT3G10900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204878 MAN1 "endo-beta-mannanase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000036201 AN3358 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5B7X2 manA "Mannan endo-1,4-beta-mannosidase A" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
ASPGD|ASPL0000003297 manC [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7Y223MAN2_ARATH3, ., 2, ., 1, ., 7, 80.74940.99300.9861yesno
Q9M0H6MAN5_ARATH3, ., 2, ., 1, ., 7, 80.72090.99760.9953nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.10.983
3rd Layer3.2.1.780.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
COG3934 587 COG3934, COG3934, Endo-beta-mannanase [Carbohydrat 1e-26
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 1e-07
COG2730407 COG2730, BglC, Endoglucanase [Carbohydrate transpo 4e-05
pfam1287687 pfam12876, Cellulase-like, Sugar-binding cellulase 0.002
>gnl|CDD|226444 COG3934, COG3934, Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score =  112 bits (281), Expect = 1e-26
 Identities = 66/290 (22%), Positives = 104/290 (35%), Gaps = 58/290 (20%)

Query: 114 FDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFF 173
                       +  A    +++L++L+  L+  GG    + WA E+      S D+  +
Sbjct: 61  NAGSNVWYAAWFLAPAGYLDLKVLITLIVGLKHMGGTNWRIPWAGEQ------SPDNVIY 114

Query: 174 DPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEM 233
           DP      K YV+ ++          Y+ DPTI  W L NEP   +  S +   DW  EM
Sbjct: 115 DPKFRGPGKKYVEDLVK--------PYKLDPTIAGWALRNEPLVEAPISVNNFWDWSGEM 166

Query: 234 SAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNNDNI-DFASVH 292
            A++K +D  HLV+VG      P                         N     D+A+ H
Sbjct: 167 YAYIKWLDDGHLVSVGDPASPWP--------------------QYAPYNARFYVDYAANH 206

Query: 293 IYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKL 352
           +Y  H+   L      +  T +   +++       +PV   E+G S              
Sbjct: 207 LYR-HYDTSLV----SRVSTVYGKPYLDIPTIMGWQPVNLEEFGFSTAF----GQENSPA 257

Query: 353 YKTILDIVYKSAKRKRSGAGALIWQL--FVEG-------MEEYNDDFGIV 393
           Y   + +   +      G GALIW L  F  G             +FGI+
Sbjct: 258 YFIWIRLALDTG-----GDGALIWCLSDFHLGSDDSEYTWGPMELEFGII 302

Length = 587
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information
>gnl|CDD|225344 COG2730, BglC, Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|221824 pfam12876, Cellulase-like, Sugar-binding cellulase-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 430
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.97
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 99.96
PRK10150604 beta-D-glucuronidase; Provisional 99.94
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 99.9
TIGR03356427 BGL beta-galactosidase. 99.87
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 99.86
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 99.86
PLN02998497 beta-glucosidase 99.86
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 99.86
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 99.86
PLN02814504 beta-glucosidase 99.85
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 99.85
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 99.85
PRK13511469 6-phospho-beta-galactosidase; Provisional 99.85
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 99.84
PLN02849503 beta-glucosidase 99.84
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 99.83
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 99.81
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 99.81
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 99.64
COG3250 808 LacZ Beta-galactosidase/beta-glucuronidase [Carboh 99.64
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 99.59
PLN03059 840 beta-galactosidase; Provisional 99.59
KOG0626524 consensus Beta-glucosidase, lactase phlorizinhydro 99.55
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 99.52
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 99.5
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 99.48
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 99.39
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.35
KOG0496 649 consensus Beta-galactosidase [Carbohydrate transpo 99.22
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 99.18
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 99.16
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 98.99
PF01229 486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 98.81
KOG2230 867 consensus Predicted beta-mannosidase [Carbohydrate 98.79
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 98.61
PF14488166 DUF4434: Domain of unknown function (DUF4434) 98.49
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 98.45
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 98.44
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 98.26
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 97.67
COG5520433 O-Glycosyl hydrolase [Cell envelope biogenesis, ou 97.5
PF02055496 Glyco_hydro_30: O-Glycosyl hydrolase family 30; In 97.49
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 97.37
PF03662319 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-t 97.0
PF13200316 DUF4015: Putative glycosyl hydrolase domain 96.79
COG1649418 Uncharacterized protein conserved in bacteria [Fun 96.41
PRK10785598 maltodextrin glucosidase; Provisional 96.16
PLN00197573 beta-amylase; Provisional 96.05
PLN02161531 beta-amylase 95.96
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 95.95
PLN02705681 beta-amylase 95.89
PLN02801 517 beta-amylase 95.87
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 95.86
PLN02905702 beta-amylase 95.84
PRK12313633 glycogen branching enzyme; Provisional 95.81
PLN02803 548 beta-amylase 95.79
PRK05402726 glycogen branching enzyme; Provisional 95.69
COG3534 501 AbfA Alpha-L-arabinofuranosidase [Carbohydrate tra 95.66
PF12891239 Glyco_hydro_44: Glycoside hydrolase family 44; Int 95.51
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 95.33
PRK14706 639 glycogen branching enzyme; Provisional 95.02
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 94.87
PRK12568730 glycogen branching enzyme; Provisional 94.76
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 94.68
PRK147051224 glycogen branching enzyme; Provisional 94.54
smart00642166 Aamy Alpha-amylase domain. 94.48
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 94.47
PLN02447 758 1,4-alpha-glucan-branching enzyme 93.71
PLN02960 897 alpha-amylase 93.39
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 93.38
COG3664 428 XynB Beta-xylosidase [Carbohydrate transport and m 93.24
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 93.17
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 92.98
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 92.73
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 92.5
PLN02361401 alpha-amylase 91.75
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 90.99
PRK09936296 hypothetical protein; Provisional 90.97
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 90.96
COG3623287 SgaU Putative L-xylulose-5-phosphate 3-epimerase [ 90.68
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 90.67
PLN00196428 alpha-amylase; Provisional 90.15
smart00812384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 89.48
cd06570311 GH20_chitobiase-like_1 A functionally uncharacteri 89.35
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 89.3
PF01373402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 89.17
KOG2566518 consensus Beta-glucocerebrosidase [Carbohydrate tr 89.16
PF00728351 Glyco_hydro_20: Glycosyl hydrolase family 20, cata 89.06
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 88.98
PF05089333 NAGLU: Alpha-N-acetylglucosaminidase (NAGLU) tim-b 88.97
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 88.83
KOG2233 666 consensus Alpha-N-acetylglucosaminidase [Intracell 88.82
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 86.68
cd06547339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 86.62
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 86.56
PRK03705 658 glycogen debranching enzyme; Provisional 86.49
PF07488328 Glyco_hydro_67M: Glycosyl hydrolase family 67 midd 86.4
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 86.1
PLN02877 970 alpha-amylase/limit dextrinase 85.54
PRK09441479 cytoplasmic alpha-amylase; Reviewed 85.39
PLN02784894 alpha-amylase 84.88
PRK14582671 pgaB outer membrane N-deacetylase; Provisional 84.13
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 83.9
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 83.74
PRK09505683 malS alpha-amylase; Reviewed 83.63
PRK14511 879 maltooligosyl trehalose synthase; Provisional 83.2
PF03659386 Glyco_hydro_71: Glycosyl hydrolase family 71 ; Int 83.01
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 83.0
PF14883294 GHL13: Hypothetical glycosyl hydrolase family 13 82.78
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 82.31
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 82.24
PRK09856275 fructoselysine 3-epimerase; Provisional 81.63
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 81.54
PF07555306 NAGidase: beta-N-acetylglucosaminidase ; InterPro: 80.63
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 80.1
COG3589360 Uncharacterized conserved protein [Function unknow 80.08
COG3661 684 AguA Alpha-glucuronidase [Carbohydrate transport a 80.02
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=99.97  E-value=2.1e-29  Score=243.71  Aligned_cols=265  Identities=25%  Similarity=0.408  Sum_probs=184.8

Q ss_pred             CCeEEEEEeeeccccccccCCCCCHHHHHHHHHHHHHcCCCEEEEccccCCCCCccc-cCCC-CCChHHHHHHHHHHHHH
Q 014151           52 DGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQ-ISPG-QFDERVFKALDHVIVEA  129 (430)
Q Consensus        52 ~G~~~~~~G~N~~~~~~~~~~~~~~~~~~~~~~~~~~~G~n~vR~~~~~~g~~~~~~-~~pg-~~de~~l~~lD~~l~~A  129 (430)
                      +|+++.+.|+|.+|...        ...+++|+.++++|+|+||+++.    |..++ +.|+ .++++.+++||++|++|
T Consensus         4 ~G~~v~~~G~n~~w~~~--------~~~~~~~~~~~~~G~n~VRi~v~----~~~~~~~~~~~~~~~~~~~~ld~~v~~a   71 (281)
T PF00150_consen    4 NGKPVNWRGFNTHWYNP--------SITEADFDQLKALGFNTVRIPVG----WEAYQEPNPGYNYDETYLARLDRIVDAA   71 (281)
T ss_dssp             TSEBEEEEEEEETTSGG--------GSHHHHHHHHHHTTESEEEEEEE----STSTSTTSTTTSBTHHHHHHHHHHHHHH
T ss_pred             CCCeEEeeeeecccCCC--------CCHHHHHHHHHHCCCCEEEeCCC----HHHhcCCCCCccccHHHHHHHHHHHHHH
Confidence            89999999999885432        25889999999999999999775    44454 4555 58999999999999999


Q ss_pred             HHcCCEEEEeccCCcccCCCcchhhhhhhhhCCCCCCCCCCCCCCHHHHHHHHHHHHHHHhccCCcccccccCCCceeEE
Q 014151          130 RKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAW  209 (430)
Q Consensus       130 ~~~Gi~vil~l~~~w~~~gg~~~y~~W~~~~G~~~~~~~~~f~~d~~~~~~~~~~~~~lv~R~n~~tg~~yk~~p~I~~w  209 (430)
                      +++||+|||++|..          +.|..        ....+...+...+.+.++|+.+++|        |+++|.|++|
T Consensus        72 ~~~gi~vild~h~~----------~~w~~--------~~~~~~~~~~~~~~~~~~~~~la~~--------y~~~~~v~~~  125 (281)
T PF00150_consen   72 QAYGIYVILDLHNA----------PGWAN--------GGDGYGNNDTAQAWFKSFWRALAKR--------YKDNPPVVGW  125 (281)
T ss_dssp             HHTT-EEEEEEEES----------TTCSS--------STSTTTTHHHHHHHHHHHHHHHHHH--------HTTTTTTEEE
T ss_pred             HhCCCeEEEEeccC----------ccccc--------cccccccchhhHHHHHhhhhhhccc--------cCCCCcEEEE
Confidence            99999999999874          12210        0111223456788899999999999        9999999999


Q ss_pred             eecCCCCCCCCC------ChHHHHHHHHHHHHHHHhcCCCCEEEEccCCccCCCCCCCcccCccchhhccCcchhhccCC
Q 014151          210 ELINEPRCMSDP------SGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRNSNN  283 (430)
Q Consensus       210 el~NEp~~~~~~------~~~~~~~w~~~~~~~Ir~~dp~~lV~~G~~g~~~~~~~~~~~~np~~w~~~~g~df~~~~~~  283 (430)
                      ||+|||......      ..+.+.+|++++.++||+++|+++|+++..++...         +...      ........
T Consensus       126 el~NEP~~~~~~~~w~~~~~~~~~~~~~~~~~~Ir~~~~~~~i~~~~~~~~~~---------~~~~------~~~~P~~~  190 (281)
T PF00150_consen  126 ELWNEPNGGNDDANWNAQNPADWQDWYQRAIDAIRAADPNHLIIVGGGGWGAD---------PDGA------AADNPNDA  190 (281)
T ss_dssp             ESSSSGCSTTSTTTTSHHHTHHHHHHHHHHHHHHHHTTSSSEEEEEEHHHHTB---------HHHH------HHHSTTTT
T ss_pred             EecCCccccCCccccccccchhhhhHHHHHHHHHHhcCCcceeecCCCccccc---------cchh------hhcCcccc
Confidence            999999986431      13678899999999999999999999985332110         0000      00000113


Q ss_pred             CCcceEEeeecCCCCCCCcc----hhhhHHHHHHHHHHHHHhhhhcCCCcEEEEecCCCCCCCCCChhHHHHHHHHHHHH
Q 014151          284 DNIDFASVHIYPDHWFHDLE----FEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDI  359 (430)
Q Consensus       284 ~~iD~~s~H~Y~~~w~~~~~----~~~~~~~~~~~l~~~~~~a~~~~gkPv~v~EfG~~~~~~~~~~~~r~~~~~~~~~~  359 (430)
                      ...+++++|.|++ +.....    ...........+......+.+ .++||+|||||.......    ...++...+++.
T Consensus       191 ~~~~~~~~H~Y~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~pv~~gE~G~~~~~~~----~~~~~~~~~~~~  264 (281)
T PF00150_consen  191 DNNDVYSFHFYDP-YDFSDQWNPGNWGDASALESSFRAALNWAKK-NGKPVVVGEFGWSNNDGN----GSTDYADAWLDY  264 (281)
T ss_dssp             TTSEEEEEEEETT-TCHHTTTSTCSHHHHHHHHHHHHHHHHHHHH-TTSEEEEEEEESSTTTSC----HHHHHHHHHHHH
T ss_pred             cCceeEEeeEeCC-CCcCCccccccchhhhHHHHHHHHHHHHHHH-cCCeEEEeCcCCcCCCCC----cCHHHHHHHHHH
Confidence            4677999999985 221110    011123344556666666664 899999999999754311    233444444444


Q ss_pred             HHHHHhcCCCcccceeeeeccC
Q 014151          360 VYKSAKRKRSGAGALIWQLFVE  381 (430)
Q Consensus       360 ~~~~~~~~~~~~G~~~W~~~~~  381 (430)
                      +.+      ...|+++|+|+.+
T Consensus       265 ~~~------~~~g~~~W~~~~~  280 (281)
T PF00150_consen  265 LEQ------NGIGWIYWSWKPN  280 (281)
T ss_dssp             HHH------TTCEEEECEESSS
T ss_pred             HHH------CCCeEEEEecCCC
Confidence            432      2689999999875

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0496 consensus Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2230 consensus Predicted beta-mannosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>COG5520 O-Glycosyl hydrolase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02055 Glyco_hydro_30: O-Glycosyl hydrolase family 30; InterPro: IPR001139 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03662 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-terminal domain ; InterPro: IPR005199 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG3534 AbfA Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12891 Glyco_hydro_44: Glycoside hydrolase family 44; InterPro: IPR024745 This is a family of putative bacterial glycoside hydrolases Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3664 XynB Beta-xylosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>PRK09936 hypothetical protein; Provisional Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2566 consensus Beta-glucocerebrosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PF05089 NAGLU: Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain; InterPro: IPR024733 Alpha-N-acetylglucosaminidase is a lysosomal enzyme that is required for the stepwise degradation of heparan sulphate [] Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PF07488 Glyco_hydro_67M: Glycosyl hydrolase family 67 middle domain; InterPro: IPR011100 Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK14582 pgaB outer membrane N-deacetylase; Provisional Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PF03659 Glyco_hydro_71: Glycosyl hydrolase family 71 ; InterPro: IPR005197 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3661 AguA Alpha-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
1rh9_A373 Family Gh5 Endo-Beta-Mannanase From Lycopersicon Es 6e-84
3pz9_A383 Native Structure Of Endo-1,4-Beta-D-Mannanase From 1e-43
4awe_A387 The Crystal Structure Of Chrysonilia Sitophila Endo 4e-34
1qno_A344 The 3-d Structure Of A Trichoderma Reesei B-mannana 2e-32
1uuq_A440 Exo-mannosidase From Cellvibrio Mixtus Length = 440 1e-25
>pdb|1RH9|A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum (Tomato) Length = 373 Back     alignment and structure 
Iteration: 1

 Score =  307 bits (787), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 157/375 (41%), Positives = 228/375 (60%), Gaps = 7/375 (1%)
Query: 41  FVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFN 100
           FV  +GTHF L+GK+LY+NG+N+YWLM  A    +R +V    Q  +K  + V RTWAF+
Sbjct: 6   FVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVARTWAFS 65
Query: 101 DGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEE 160
            GG   LQ +PG ++E++F+ LD VI EA+K G+ L++SLVNN  A+GGK QYV WA + 
Sbjct: 66  HGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEWAVQR 125
Query: 161 GIGIXXXXXXXXXXXXIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMSD 220
           G  +            +  ++K+ VK VLTR NTIT V Y++DPTI +WELINEPRC SD
Sbjct: 126 GQKL-TSDDDFFTNPMVKGFYKNNVKVVLTRVNTITKVAYKDDPTILSWELINEPRCPSD 184
Query: 221 PSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIRN 280
            SG T Q+W+ EM+ ++KSID  HL+ +GLEGFYG    +    NP  +    G++FI N
Sbjct: 185 LSGKTFQNWVLEMAGYLKSIDSNHLLEIGLEGFYGNDMRQ---YNPNSY--IFGTNFISN 239
Query: 281 SNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNL 340
           +    IDF ++H+YP+ W   L  E   K+ ++W+  HI+D  K L KP+   E+G S  
Sbjct: 240 NQVQGIDFTTIHMYPNQWLPGLTQEAQDKWASQWIQVHIDD-SKMLKKPLLIAEFGKSTK 298
Query: 341 IKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTST 400
             G+  + RD  ++ I   ++  AK      G L WQ+  +GM  ++D + +V  E  ST
Sbjct: 299 TPGYTVAKRDNYFEKIYGTIFNCAKSGGPCGGGLFWQVLGQGMSSFDDGYQVVLQESPST 358
Query: 401 YKLLTEQSCGLGRIS 415
            +++  QS  L ++S
Sbjct: 359 SRVILLQSLRLSKLS 373
>pdb|3PZ9|A Chain A, Native Structure Of Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila Rku-1 Length = 383 Back     alignment and structure
>pdb|4AWE|A Chain A, The Crystal Structure Of Chrysonilia Sitophila Endo-Beta-D- 1,4-Mannanase Length = 387 Back     alignment and structure
>pdb|1QNO|A Chain A, The 3-d Structure Of A Trichoderma Reesei B-mannanase From Glycoside Hydrolase Family 5 Length = 344 Back     alignment and structure
>pdb|1UUQ|A Chain A, Exo-mannosidase From Cellvibrio Mixtus Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 1e-120
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 2e-96
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 2e-95
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 4e-78
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 1e-66
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 2e-19
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 2e-15
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 1e-11
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 2e-08
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 2e-07
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 2e-07
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 6e-07
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 1e-06
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 1e-06
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 2e-06
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 2e-06
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 3e-06
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 5e-06
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 9e-06
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 2e-05
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 2e-05
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 2e-05
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 2e-05
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 6e-05
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 1e-04
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 1e-04
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 2e-04
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 2e-04
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 3e-04
3cmg_A667 Putative beta-galactosidase; structural genomics, 4e-04
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 4e-04
3fn9_A 692 Putative beta-galactosidase; structural genomics, 5e-04
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Length = 373 Back     alignment and structure
 Score =  354 bits (908), Expect = e-120
 Identities = 162/376 (43%), Positives = 236/376 (62%), Gaps = 7/376 (1%)

Query: 40  GFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAF 99
            FV  +GTHF L+GK+LY+NG+N+YWLM  A    +R +V    Q  +K  + V RTWAF
Sbjct: 5   NFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVARTWAF 64

Query: 100 NDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWE 159
           + GG   LQ +PG ++E++F+ LD VI EA+K G+ L++SLVNN  A+GGK QYV WA +
Sbjct: 65  SHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEWAVQ 124

Query: 160 EGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMS 219
            G  ++S +D FF +P +  ++K+ VK VLTR NTIT V Y++DPTI +WELINEPRC S
Sbjct: 125 RGQKLTSDDD-FFTNPMVKGFYKNNVKVVLTRVNTITKVAYKDDPTILSWELINEPRCPS 183

Query: 220 DPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIR 279
           D SG T Q+W+ EM+ ++KSID  HL+ +GLEGFYG    +    NP  +    G++FI 
Sbjct: 184 DLSGKTFQNWVLEMAGYLKSIDSNHLLEIGLEGFYGNDMRQ---YNPNSY--IFGTNFIS 238

Query: 280 NSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSN 339
           N+    IDF ++H+YP+ W   L  E   K+ ++W+  HI+D  K L KP+   E+G S 
Sbjct: 239 NNQVQGIDFTTIHMYPNQWLPGLTQEAQDKWASQWIQVHIDDS-KMLKKPLLIAEFGKST 297

Query: 340 LIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTS 399
              G+  + RD  ++ I   ++  AK      G L WQ+  +GM  ++D + +V  E  S
Sbjct: 298 KTPGYTVAKRDNYFEKIYGTIFNCAKSGGPCGGGLFWQVLGQGMSSFDDGYQVVLQESPS 357

Query: 400 TYKLLTEQSCGLGRIS 415
           T +++  QS  L ++S
Sbjct: 358 TSRVILLQSLRLSKLS 373
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Length = 440 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Length = 383 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Length = 344 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Length = 353 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Length = 463 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Length = 645 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Length = 613 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Length = 605 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Length = 667 Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Length = 503 Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Length = 692 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 100.0
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 100.0
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 100.0
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 100.0
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 100.0
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 100.0
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 100.0
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 100.0
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 100.0
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 100.0
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 100.0
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 100.0
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.97
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.97
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.97
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.97
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.97
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.96
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.96
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.96
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.96
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.96
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.96
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.96
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.95
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 99.95
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.95
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.95
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.95
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.94
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.94
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.94
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 99.94
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.93
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.93
3fn9_A 692 Putative beta-galactosidase; structural genomics, 99.93
3cmg_A667 Putative beta-galactosidase; structural genomics, 99.93
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 99.92
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 99.92
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.92
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.91
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.9
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.9
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.9
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.9
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.89
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.89
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 99.89
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 99.89
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 99.89
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.88
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 99.88
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.88
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 99.88
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.87
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 99.87
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.87
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.87
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.86
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.86
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 99.86
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 99.86
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.85
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 99.85
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 99.85
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 99.84
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 99.84
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.84
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 99.84
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 99.83
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.83
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 99.83
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 99.83
3gm8_A 801 Glycoside hydrolase family 2, candidate beta-GLYC; 99.83
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.82
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 99.82
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.82
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 99.82
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 99.82
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 99.82
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 99.82
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 99.81
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.81
3d3a_A 612 Beta-galactosidase; protein structure initiative I 99.81
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 99.81
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 99.8
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.8
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 99.79
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 99.78
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.76
2je8_A 848 Beta-mannosidase; glycoside hydrolase, hydrolase; 99.73
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 99.71
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.68
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.67
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 99.67
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 99.65
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 99.65
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.64
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.61
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.59
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 99.58
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 99.57
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 99.56
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 99.55
3kzs_A463 Glycosyl hydrolase family 5; structural genomics, 99.55
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 99.55
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 99.53
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 99.52
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.51
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 99.5
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 99.49
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 99.49
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 99.46
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 99.42
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 99.4
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 99.3
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 99.29
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.18
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 99.1
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 99.03
2c7f_A 513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 98.72
1qw9_A 502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 98.68
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 98.67
2y2w_A 574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 98.62
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 98.49
3clw_A507 Conserved exported protein; structural genomics, u 98.47
3vny_A 488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 98.46
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 98.43
3ug3_A 504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 98.38
2vrq_A 496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 98.32
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 98.31
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 98.27
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 98.11
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 98.05
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 98.01
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 98.0
4aw7_A 591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 97.92
3ik2_A 517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 97.91
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 97.76
2yih_A 524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 97.73
3ii1_A 535 Cellulase; CELM2, glucanase-xyanase, glucanase, xy 97.4
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 97.29
3kl0_A401 Glucuronoxylanase XYNC; alpha beta barrel, (beta/a 97.16
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 97.15
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 97.09
2e4t_A 519 Endoglucanase, xyloglucanase; TIM barrel, TIM-like 96.97
1fa2_A 498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 96.34
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 96.1
1wdp_A 495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 96.03
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 95.99
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 95.98
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 95.96
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 95.96
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 95.81
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 95.49
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 95.45
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 95.22
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 95.2
3tp4_A475 Computational design of enzyme; structural genomic 95.1
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 94.79
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 94.78
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 94.78
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 94.35
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 94.16
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 93.87
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 93.45
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 93.24
1jak_A512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 93.23
1yht_A367 DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact 92.97
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 92.35
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 91.95
2wvv_A450 Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly 91.93
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 91.88
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 91.74
2vx5_A396 Cellvibrio japonicus mannanase cjman26C; hydrolase 91.39
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 91.28
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 91.2
4fnq_A729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 90.87
2v5c_A594 O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrol 90.74
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 89.88
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 89.87
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 89.68
3gza_A443 Putative alpha-L-fucosidase; NP_812709.1, structur 89.55
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 89.51
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 89.29
2v5d_A 737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 89.27
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 88.95
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 88.79
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 88.79
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 88.55
1odz_A386 Mannanase A; hydrolase, family 26, glycoside-hydro 88.5
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 88.38
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 88.37
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 88.2
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 87.98
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 87.96
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 87.85
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 87.81
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 87.46
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 87.44
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 87.34
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 87.33
2zxd_A455 Alpha-L-fucosidase, putative; TIM barrel, hydrolas 87.18
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 87.07
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 87.0
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 86.96
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 86.88
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 86.69
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 86.27
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 86.12
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 85.64
3gh5_A525 HEX1, beta-hexosaminidase; beta-N-acetylhexosamini 85.54
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 85.36
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 84.97
2cho_A 716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 84.8
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 84.8
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 84.46
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 84.43
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 84.31
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 84.21
4ad1_A380 Glycosyl hydrolase family 71; glycoside hydrolase 84.08
4acy_A382 Endo-alpha-mannosidase; hydrolase, endomannosidase 84.0
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 83.81
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 83.8
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 83.73
2p0o_A372 Hypothetical protein DUF871; structural genomics, 83.39
2epl_X 627 N-acetyl-beta-D-glucosaminidase; glycoside hydrola 83.24
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 83.0
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 82.71
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 82.62
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 82.35
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 82.02
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 81.62
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 81.48
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 80.94
1gqi_A 708 Alpha-glucuronidase; (alpha-beta)8 barrel, glycosi 80.89
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 80.87
1now_A507 Beta-hexosaminidase beta chain; (beta/alpha)8-barr 80.47
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 80.26
2yl5_A442 Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Str 80.14
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-65  Score=513.37  Aligned_cols=343  Identities=35%  Similarity=0.638  Sum_probs=287.0

Q ss_pred             EeCCeEEECCeEEEEEeeeccccccccCCCCCHHHHHHHHHHHHHcCCCEEEEccccCCC------CCccccCCCCCC--
Q 014151           44 RNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGG------YNSLQISPGQFD--  115 (430)
Q Consensus        44 ~~g~~f~~~G~~~~~~G~N~~~~~~~~~~~~~~~~~~~~~~~~~~~G~n~vR~~~~~~g~------~~~~~~~pg~~d--  115 (430)
                      ++|++|++|||||+|.|+|.||+...     +.+.++++|+.|+++|+|+||+|+|+++.      |+.+|+.||.|+  
T Consensus        15 ~~g~~F~ldGkp~~f~G~N~y~~~~~-----~~~~i~~~l~~~a~~G~N~VRv~~f~d~~~~~~~~~~~lqp~~G~yd~~   89 (383)
T 3pzg_A           15 VPRGSHMLNGKEFRFIGSNNYYMHYK-----SNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVP   89 (383)
T ss_dssp             ------------CCEEEEECSCTTTS-----CHHHHHHHHHHHHHHTCCEEEEECCCBSHHHHHHHTEESBSBTTBCSSC
T ss_pred             ccCCEEEECCEEEEEEEEEecccccC-----CHHHHHHHHHHHHHcCCCEEEEeccccccccccccccccccCCCccccc
Confidence            68999999999999999999998864     47899999999999999999999998754      667899999999  


Q ss_pred             ------hHHHHHHHHHHHHHHHcCCEEEEeccCCcccCCCcchhhhhhhhhCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q 014151          116 ------ERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVL  189 (430)
Q Consensus       116 ------e~~l~~lD~~l~~A~~~Gi~vil~l~~~w~~~gg~~~y~~W~~~~G~~~~~~~~~f~~d~~~~~~~~~~~~~lv  189 (430)
                            ++.|+.||++|++|+++||+|||+|++.|..+||.+.|+.|..   .   ..+..||+||++++.++++++.|+
T Consensus        90 ~~~~~~~~~~~~LD~~i~~A~k~GI~viL~l~~~w~~~GG~~~y~~~~g---~---~~~~~f~~dp~~~~~~~~~~~~l~  163 (383)
T 3pzg_A           90 EGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFG---G---THHDDFYRDERIKEEYKKYVSFLI  163 (383)
T ss_dssp             TTCSSCEEHHHHHHHHHHHHHHHTCEEEEECCBSSSTTSHHHHHHHHTT---C---CSTTHHHHCHHHHHHHHHHHHHHH
T ss_pred             ccccchHHHHHHHHHHHHHHHHCCCEEEEEccccccccCCccchhhhcC---C---CccccccCCHHHHHHHHHHHHHHH
Confidence                  9999999999999999999999999999998999988988863   1   335679999999999999999999


Q ss_pred             hccCCcccccccCCCceeEEeecCCCCCCCCCChHHHHHHHHHHHHHHHhcCCCCEEEEccCCccCCCCCCCcccCccch
Q 014151          190 TRKNTITGVEYRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMW  269 (430)
Q Consensus       190 ~R~n~~tg~~yk~~p~I~~wel~NEp~~~~~~~~~~~~~w~~~~~~~Ir~~dp~~lV~~G~~g~~~~~~~~~~~~np~~w  269 (430)
                      +|+|||||++|+++|+|++|+|+|||.+....+.+.+.+|+++|+++||++||+|||++|++|+++.+.+.........|
T Consensus       164 ~r~N~~tG~~y~~~p~I~~w~l~NEp~~~~~~~~~~~~~w~~~~~~~IR~~Dp~~lVt~G~~g~~~~~~~~~~~~~~~~~  243 (383)
T 3pzg_A          164 NHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEW  243 (383)
T ss_dssp             TCBCTTTCCBGGGCTTEEEEESCBTCCCTTCTTSHHHHHHHHHHHHHHHHHCSSSEEECCCCCCCBCCTTCCCGGGTTGG
T ss_pred             hhhccccCcccCCCCcEEEEEecCCCCcccCccHHHHHHHHHHHHHHHHhhCCCceEEEcccccccccccccccCCCCcc
Confidence            99999999999999999999999999987654567899999999999999999999999999998865542211112357


Q ss_pred             hh--ccCcchhhccCCCCcceEEeeecCCCCCCCcchhhhHHHHHHHHHHHHHhhhhcCCCcEEEEecCCCCCCCCCChh
Q 014151          270 AS--ALGSDFIRNSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPS  347 (430)
Q Consensus       270 ~~--~~g~df~~~~~~~~iD~~s~H~Y~~~w~~~~~~~~~~~~~~~~l~~~~~~a~~~~gkPv~v~EfG~~~~~~~~~~~  347 (430)
                      .+  ..|.||.+.++++.|||+++|.||++|..  +.+..++|..+||++|++.+++ .+|||+|+|||.....    .+
T Consensus       244 ~~~~~~g~df~~~~~~~~iD~~t~H~Yp~~w~~--~~~~~~~~~~~wi~~h~~~a~~-~gKPvv~eEfG~~~~~----~~  316 (383)
T 3pzg_A          244 AYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGV--SPENYAQWGAKWIEDHIKIAKE-IGKPVVLEEYGIPKSA----PV  316 (383)
T ss_dssp             GTBTTTSCCHHHHHTCTTCCSEEEEECHHHHTC--CGGGHHHHHHHHHHHHHHHHHH-HTCCEEEEEECCCTTS----SS
T ss_pred             ccccccCCChHhhcCCCCCCEEEEEecccccCc--ChHHHHHHHHHHHHHHHHHHHh-cCCCEEEEecCCCCCC----hh
Confidence            64  47899999999999999999999999974  3445678999999999999986 9999999999998753    46


Q ss_pred             HHHHHHHHHHHHHHHHHhcCCCcccceeeeeccCCC---------ccCCCCceEEcCCCccHHHHHHHHHHH
Q 014151          348 LRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGM---------EEYNDDFGIVPWERTSTYKLLTEQSCG  410 (430)
Q Consensus       348 ~r~~~~~~~~~~~~~~~~~~~~~~G~~~W~~~~~~~---------~~~~dg~~i~~~~~~~~~~~~~~~~~~  410 (430)
                      .|+++++.+++.++++     +.+|+++|+|.+.+.         ...+|||+|+.+ ++++..||++|+++
T Consensus       317 ~r~~~~~~~~~~~~~~-----~~~g~~~Wq~~~~~~g~~~~~~~~~~~~dg~~i~~~-~~~~~~~~~~~~~~  382 (383)
T 3pzg_A          317 NRTAIYRLWNDLVYDL-----GGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVND-DSPEAELIREYAKL  382 (383)
T ss_dssp             CHHHHHHHHHHHHHHT-----TCCEEEESCBCCBCBTTBCCTTSBCCCSSSCCBCSS-SSHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHh-----CCcceEEEEecCcCCCCcCCCCCcccCCCCeEEEeC-CccHHHHHHHHHhh
Confidence            7999999999988764     468999999998633         224599999997 57899999999986
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>3ii1_A Cellulase; CELM2, glucanase-xyanase, glucanase, xylanase, bifunctional enzyme, hydrolase; HET: BGC; 2.25A {Uncultured bacterium} PDB: 3fw6_A Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>3kl0_A Glucuronoxylanase XYNC; alpha beta barrel, (beta/alpha)8 barrel (beta/alpha)8 + beta motif family, hydrolase; HET: TAR HIS; 1.64A {Bacillus subtilis} PDB: 3gtn_A* 3kl3_A* 3kl5_A* Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>2e4t_A Endoglucanase, xyloglucanase; TIM barrel, TIM-like barrel, composite domain of glycosyl HY families 5, 30, 39 and 51, hydrolase; 0.96A {Clostridium thermocellum} PDB: 2e0p_A 2eo7_A* 2ej1_A* 2eex_A* 2eqd_A* Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3tp4_A Computational design of enzyme; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.98A {Synthetic construct} PDB: 2x2y_A 2bvy_A 2bvt_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure
>1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>2vx5_A Cellvibrio japonicus mannanase cjman26C; hydrolase; HET: BMA; 1.47A {Cellvibrio japonicus} PDB: 2vx4_A* 2vx6_A* 2vx7_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* 2xpk_A* 2yds_A* 2ydr_A* 2ydq_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>1odz_A Mannanase A; hydrolase, family 26, glycoside-hydrolase, glycosynthase, manno-oligosaccharide; HET: MAN BMA; 1.4A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1r7o_A* 2whm_A* 1j9y_A 1gvy_A* 1gw1_A* Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>4ad1_A Glycosyl hydrolase family 71; glycoside hydrolase GH99, CAZY, enzyme-carbohydra interaction, mannose glycosidase inhibition; 1.90A {Bacteroides xylanisolvens} PDB: 4ad2_A* 4ad3_A* 4ad4_A* 4ad5_A* Back     alignment and structure
>4acy_A Endo-alpha-mannosidase; hydrolase, endomannosidase, glycoside hydrolase, CAZY, enzyme-carbohydrate interaction, mannose; HET: MSE; 1.69A {Bacteroides thetaiotaomicron} PDB: 4acz_A 4ad0_A* 4acz_B Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>2epl_X N-acetyl-beta-D-glucosaminidase; glycoside hydrolase, family 20, GCNA, hydro; 1.40A {Streptococcus gordonii} PDB: 2epk_X 2epm_X 2epn_A* 2epo_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1gqi_A Alpha-glucuronidase; (alpha-beta)8 barrel, glycoside hydrolase; 1.48A {Pseudomonas cellulosa} SCOP: c.1.8.10 d.92.2.2 PDB: 1gqj_A* 1gqk_A* 1gql_A* 1h41_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>2yl5_A Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Streptococcus pneumoniae} PDB: 2yla_A* 2yl9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 430
d1rh9a1370 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper 1e-83
d1uuqa_410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 1e-56
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 5e-54
d2c0ha1350 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue 2e-33
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 7e-18
d1kwga2393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 7e-12
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 6e-09
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 1e-08
d1tg7a5354 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-ter 2e-08
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 4e-08
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 1e-07
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 3e-06
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 3e-06
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 6e-06
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 9e-06
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 2e-04
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 3e-04
d1bhga3304 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 { 0.002
d2vzsa5339 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolato 0.003
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 0.004
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Beta-mannanase
species: Tomato (Lycopersicon esculentum) [TaxId: 4081]

 Score =  258 bits (660), Expect = 1e-83
 Identities = 160/376 (42%), Positives = 233/376 (61%), Gaps = 7/376 (1%)

Query: 40  GFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAF 99
            FV  +GTHF L+GK+LY+NG+N+YWLM  A    +R +V    Q  +K  + V RTWAF
Sbjct: 2   NFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVARTWAF 61

Query: 100 NDGGYNSLQISPGQFDERVFKALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWE 159
           + GG   LQ +PG ++E++F+ LD VI EA+K G+ L++SLVNN  A+GGK QYV WA +
Sbjct: 62  SHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEWAVQ 121

Query: 160 EGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVEYRNDPTIFAWELINEPRCMS 219
            G  + +S+D FF +P +  ++K+ VK VLTR NTIT V Y++DPTI +WELINEPRC S
Sbjct: 122 RGQKL-TSDDDFFTNPMVKGFYKNNVKVVLTRVNTITKVAYKDDPTILSWELINEPRCPS 180

Query: 220 DPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIR 279
           D SG T Q+W+ EM+ ++KSID  HL+ +GLEGFYG              +   G++FI 
Sbjct: 181 DLSGKTFQNWVLEMAGYLKSIDSNHLLEIGLEGFYGNDMR-----QYNPNSYIFGTNFIS 235

Query: 280 NSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSN 339
           N+    IDF ++H+YP+ W   L  E   K+ ++W+  HI+D  K L KP+   E+G S 
Sbjct: 236 NNQVQGIDFTTIHMYPNQWLPGLTQEAQDKWASQWIQVHIDDS-KMLKKPLLIAEFGKST 294

Query: 340 LIKGFEPSLRDKLYKTILDIVYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTS 399
              G+  + RD  ++ I   ++  AK      G L WQ+  +GM  ++D + +V  E  S
Sbjct: 295 KTPGYTVAKRDNYFEKIYGTIFNCAKSGGPCGGGLFWQVLGQGMSSFDDGYQVVLQESPS 354

Query: 400 TYKLLTEQSCGLGRIS 415
           T +++  QS  L ++S
Sbjct: 355 TSRVILLQSLRLSKLS 370
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 350 Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Length = 354 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 304 Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Length = 339 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 100.0
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 100.0
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 100.0
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 100.0
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 100.0
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.97
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.97
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.97
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.97
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 99.96
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 99.95
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.95
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.95
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 99.91
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.91
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 99.9
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 99.9
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.89
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.87
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 99.87
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 99.87
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.86
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.86
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.86
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.86
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.84
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.84
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 99.83
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.83
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.82
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 99.82
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.81
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 99.81
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 99.78
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 99.78
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 99.78
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.74
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.74
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.68
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 99.55
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 99.55
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 99.53
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 99.51
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 99.49
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 99.43
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 99.41
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 99.29
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 99.2
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 99.1
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 99.06
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 98.69
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 98.51
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 98.4
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 98.34
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 98.33
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 98.21
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 98.1
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 98.05
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 97.97
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 96.05
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 96.01
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 95.97
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 95.94
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 95.89
d1fa2a_498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 95.34
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 95.34
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 95.27
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 95.22
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 95.11
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 95.11
d1wdpa1490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 95.1
d1b1ya_ 500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 95.07
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 95.04
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 94.82
d1yhta1344 Dispersin B, DspB {Actinobacillus actinomycetemcom 93.87
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 93.82
d1hl9a2350 Putative alpha-L-fucosidase, catalytic domain {The 93.73
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 93.37
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 93.26
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 93.16
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 93.09
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 93.04
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 92.93
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 92.63
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 92.54
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 92.47
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 92.33
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 91.99
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 91.79
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 91.72
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 91.71
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 91.68
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 91.66
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 90.5
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 90.43
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 90.02
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 89.43
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 89.02
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 88.93
d1cnva_283 Seed storage protein {Jack bean (Canavalia ensifor 85.08
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 84.23
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 82.53
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 82.32
d1qbaa3443 Bacterial chitobiase (beta-N-acetylhexosaminidase) 81.61
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 81.39
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 80.97
d1nowa1353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 80.72
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Beta-mannanase
species: Tomato (Lycopersicon esculentum) [TaxId: 4081]

Probab=100.00  E-value=7e-56  Score=437.64  Aligned_cols=369  Identities=44%  Similarity=0.842  Sum_probs=311.0

Q ss_pred             CcEEEeCCeEEECCeEEEEEeeeccccccccCCCCCHHHHHHHHHHHHHcCCCEEEEccccCCCCCccccCCCCCChHHH
Q 014151           40 GFVTRNGTHFMLDGKALYVNGWNSYWLMDHAVHDYSRARVGAMLQAGAKMGLTVCRTWAFNDGGYNSLQISPGQFDERVF  119 (430)
Q Consensus        40 gfv~~~g~~f~~~G~~~~~~G~N~~~~~~~~~~~~~~~~~~~~~~~~~~~G~n~vR~~~~~~g~~~~~~~~pg~~de~~l  119 (430)
                      .||+|+|++|++||+|+++.|+|.||.........+.+.++++|+.||++|+|+||+|++++..|...++.||.+++..+
T Consensus         2 ~~v~~~g~~f~~nG~~~~~~G~N~~~~~~~~~~~~~~~~~~~~l~~~k~~G~N~vR~~~~~~~~~~~~~~~~g~~~~~~l   81 (370)
T d1rh9a1           2 NFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVARTWAFSHGGSRPLQSAPGVYNEQMF   81 (370)
T ss_dssp             CCCEEETTEEEETTEEECEEEEECTTHHHHHHSTTTTHHHHHHHHHHHHTTCCEEEEESSCSSSSSCSEEETTEECHHHH
T ss_pred             CcEEEECCEEEECCEEEEEEEEecccCcccccCCCCHHHHHHHHHHHHHCCCeEEEECCccCccCcccCCCCCcccHHHH
Confidence            59999999999999999999999988765544455778899999999999999999999887778888999999999999


Q ss_pred             HHHHHHHHHHHHcCCEEEEeccCCcccCCCcchhhhhhhhhCCCCCCCCCCCCCCHHHHHHHHHHHHHHHhccCCccccc
Q 014151          120 KALDHVIVEARKNGVRLLLSLVNNLQAYGGKTQYVNWAWEEGIGISSSNDSFFFDPSIHKYFKHYVKTVLTRKNTITGVE  199 (430)
Q Consensus       120 ~~lD~~l~~A~~~Gi~vil~l~~~w~~~gg~~~y~~W~~~~G~~~~~~~~~f~~d~~~~~~~~~~~~~lv~R~n~~tg~~  199 (430)
                      +.||++|++|+++||+||++||++|..+.|.+.+..|....|... .....||+||..++.++++++.+++|.|+++..+
T Consensus        82 ~~ld~~l~~a~~~Gi~vi~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~v~r~~~~~~~~  160 (370)
T d1rh9a1          82 QGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEWAVQRGQKL-TSDDDFFTNPMVKGFYKNNVKVVLTRVNTITKVA  160 (370)
T ss_dssp             HHHHHHHHHHHHTTCEEEEECCBSSSSSSBHHHHHHHHHHTTCCC-CCGGGGGTCHHHHHHHHHHHHHHHHCBCTTTCSB
T ss_pred             HHHHHHHHHHHHcCCEEEEecccccccccCCcccccccccCCCcC-CccccccCCHHHHHHHHHHHHHHHHhhhhhhHhh
Confidence            999999999999999999999999888888888889987655432 4456789999999999999999999999999999


Q ss_pred             ccCCCceeEEeecCCCCCCCCCChHHHHHHHHHHHHHHHhcCCCCEEEEccCCccCCCCCCCcccCccchhhccCcchhh
Q 014151          200 YRNDPTIFAWELINEPRCMSDPSGDTLQDWIDEMSAFVKSIDKKHLVTVGLEGFYGPKSPKRLTVNPEMWASALGSDFIR  279 (430)
Q Consensus       200 yk~~p~I~~wel~NEp~~~~~~~~~~~~~w~~~~~~~Ir~~dp~~lV~~G~~g~~~~~~~~~~~~np~~w~~~~g~df~~  279 (430)
                      |+++|+|++|+++|||........+.+++|++++++.||++||+++|+++.+++.+....   ..++  .....+.+...
T Consensus       161 ~~~~~~v~~~~l~NEp~~~~~~~~~~~~~~~~~~~~~ir~~dp~~~v~~~~~~~~~~~~~---~~~~--~~~~~~~~~~~  235 (370)
T d1rh9a1         161 YKDDPTILSWELINEPRCPSDLSGKTFQNWVLEMAGYLKSIDSNHLLEIGLEGFYGNDMR---QYNP--NSYIFGTNFIS  235 (370)
T ss_dssp             GGGCTTEEEEESCBSCCCTTCTTSHHHHHHHHHHHHHHHHHCCSSEEECCCCCCCCGGGG---GGSG--GGCCCSCCHHH
T ss_pred             hcCCceeeeeccccccccCCccchHHHHHHHHHHHHHHHhhCCCCeEEEecccccccccc---ccCC--Ccccccccccc
Confidence            999999999999999987665566889999999999999999999999987654322110   0011  11123344445


Q ss_pred             ccCCCCcceEEeeecCCCCCCCcchhhhHHHHHHHHHHHHHhhhhcCCCcEEEEecCCCCCCCCCChhHHHHHHHHHHHH
Q 014151          280 NSNNDNIDFASVHIYPDHWFHDLEFEDDLKFVTKWMLSHIEDGDKELNKPVFFTEYGLSNLIKGFEPSLRDKLYKTILDI  359 (430)
Q Consensus       280 ~~~~~~iD~~s~H~Y~~~w~~~~~~~~~~~~~~~~l~~~~~~a~~~~gkPv~v~EfG~~~~~~~~~~~~r~~~~~~~~~~  359 (430)
                      ....+.+||+++|.||+.|.+.........+...++..+.+.+++ .+||++|+|||......+.+...|..+++.+++.
T Consensus       236 ~~~~~~~D~~~~h~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~kPv~i~EfG~~~~~~~~~~~~~~~~~~~~~~~  314 (370)
T d1rh9a1         236 NNQVQGIDFTTIHMYPNQWLPGLTQEAQDKWASQWIQVHIDDSKM-LKKPLLIAEFGKSTKTPGYTVAKRDNYFEKIYGT  314 (370)
T ss_dssp             HHTSTTCCCEEEECCHHHHSTTSCHHHHHHHHHHHHHHHHHHHHH-HTSCEEEEECCCCTTSTTCCHHHHHHHHHHHHHH
T ss_pred             cccCCcceEEEeccccCccccCCcchhhhhHHHHHHHHHHHHHHh-CCCeEEEeeccCcCCCCCCCHHHHHHHHHHHHHH
Confidence            556788999999999987765544444445566677777777775 8999999999998877666788899999999999


Q ss_pred             HHHHHhcCCCcccceeeeeccCCCccCCCCceEEcCCCccHHHHHHHHHHHHhhcc
Q 014151          360 VYKSAKRKRSGAGALIWQLFVEGMEEYNDDFGIVPWERTSTYKLLTEQSCGLGRIS  415 (430)
Q Consensus       360 ~~~~~~~~~~~~G~~~W~~~~~~~~~~~dg~~i~~~~~~~~~~~~~~~~~~~~~~~  415 (430)
                      ++++.+.+..++|+++|+|.+++.++|.|||+|++.++++|.++|+.++++|+.|+
T Consensus       315 ~~~~~~~~~~~~G~~~W~~~~~~~~~~~dg~g~~~~d~~~t~~~~~~~~~~~~~~~  370 (370)
T d1rh9a1         315 IFNCAKSGGPCGGGLFWQVLGQGMSSFDDGYQVVLQESPSTSRVILLQSLRLSKLS  370 (370)
T ss_dssp             HHHHHHTTCSEEEEEESCBCCTTCGGGCCSCCBCGGGCHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHhCCCeEEEEEeeecCCCCcCCCCCceEecCCCccHHHHHHHHHHHHhhcC
Confidence            88888877778999999999998889999999999988999999999999999885
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure