Citrus Sinensis ID: 014212
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 429 | ||||||
| 350536163 | 485 | serine/threonine-protein phosphatase 5 [ | 0.993 | 0.878 | 0.861 | 0.0 | |
| 343488864 | 485 | serine/threonine protein phosphatase 5 [ | 0.993 | 0.878 | 0.864 | 0.0 | |
| 355329952 | 485 | serine/threonine-protein phosphatase 5 [ | 0.993 | 0.878 | 0.859 | 0.0 | |
| 224128732 | 488 | predicted protein [Populus trichocarpa] | 0.993 | 0.872 | 0.856 | 0.0 | |
| 255558752 | 476 | protein phosphatase-5, putative [Ricinus | 0.962 | 0.867 | 0.857 | 0.0 | |
| 18406066 | 484 | serine/threonine-protein phosphatase 5 [ | 0.986 | 0.873 | 0.834 | 0.0 | |
| 449444753 | 485 | PREDICTED: serine/threonine-protein phos | 0.993 | 0.878 | 0.823 | 0.0 | |
| 357127077 | 483 | PREDICTED: serine/threonine-protein phos | 0.983 | 0.873 | 0.787 | 0.0 | |
| 326523823 | 483 | predicted protein [Hordeum vulgare subsp | 0.983 | 0.873 | 0.783 | 0.0 | |
| 413944781 | 471 | putative serine/threonine protein phosph | 0.981 | 0.893 | 0.784 | 0.0 |
| >gi|350536163|ref|NP_001234232.1| serine/threonine-protein phosphatase 5 [Solanum lycopersicum] gi|24954813|gb|AAN64317.1| type 5 serine/threonine phosphatase 55 kDa isoform [Solanum lycopersicum] gi|28141084|gb|AAO26214.1| type 5 protein serine/threonine phosphatase 55 kDa isoform [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
Score = 797 bits (2058), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 381/442 (86%), Positives = 408/442 (92%), Gaps = 16/442 (3%)
Query: 1 MPNMETENSSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTK 60
MP ME ENS+ SRAEELK LANEAF+ KYSQAIDLY+QAIELN +NAVYYANRAFAHTK
Sbjct: 1 MPGMEAENSNASRAEELKQLANEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTK 60
Query: 61 LEEYGSAIQDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQ 120
LEEYGSAIQD ++AIEIDPRY KGYYRRGAAYLAMGKFK+ALKDFQQVKKL PNDPDA +
Sbjct: 61 LEEYGSAIQDGTRAIEIDPRYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLCPNDPDATK 120
Query: 121 KVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKK 180
K+KECEKAV KLKFEEAI+VPES+R SVADSIDY+S+EVEPQY+GARIEGDV+TLDFVKK
Sbjct: 121 KLKECEKAVMKLKFEEAISVPESQRRSVADSIDYRSVEVEPQYAGARIEGDVVTLDFVKK 180
Query: 181 MMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNI 240
M+DDFKNQK LHKRYA+QIVLQTREMLRALPSLVDI +P+GKHFTVCGDVHGQFYDLLNI
Sbjct: 181 MLDDFKNQKNLHKRYAYQIVLQTREMLRALPSLVDIVVPEGKHFTVCGDVHGQFYDLLNI 240
Query: 241 FELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIY 300
FELNGLPSE+NPYLFNGDFVDRGSFS+EVILTLFAFKCMCPSAI+L+RGNHESKSMNKIY
Sbjct: 241 FELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMCPSAIHLARGNHESKSMNKIY 300
Query: 301 GFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFC 360
GFEGEVRSKLSE FVELFAEVFCCLPLAHV+N+KVFVVHGGLFSVDGVKLSDI+ IDRFC
Sbjct: 301 GFEGEVRSKLSEIFVELFAEVFCCLPLAHVINEKVFVVHGGLFSVDGVKLSDIRAIDRFC 360
Query: 361 EPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF----------------VVRSHEVKDEG 404
EPPEEGLMCELLWSDPQP PGRGPSKRGVGLSF VVRSHEVKDEG
Sbjct: 361 EPPEEGLMCELLWSDPQPQPGRGPSKRGVGLSFGGDVTKRFLQENNLDLVVRSHEVKDEG 420
Query: 405 YEIEHDGKLITVFSAPNYCDQV 426
YEIEHDGKLITVFSAPNYCDQ+
Sbjct: 421 YEIEHDGKLITVFSAPNYCDQM 442
|
Source: Solanum lycopersicum Species: Solanum lycopersicum Genus: Solanum Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|343488864|gb|AEM45799.1| serine/threonine protein phosphatase 5 [Solanum torvum] | Back alignment and taxonomy information |
|---|
| >gi|355329952|dbj|BAL14275.1| serine/threonine-protein phosphatase 5 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|224128732|ref|XP_002320408.1| predicted protein [Populus trichocarpa] gi|222861181|gb|EEE98723.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255558752|ref|XP_002520400.1| protein phosphatase-5, putative [Ricinus communis] gi|223540447|gb|EEF42016.1| protein phosphatase-5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18406066|ref|NP_565985.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] gi|16930441|gb|AAL31906.1|AF419574_1 At2g42810/F7D19.19 [Arabidopsis thaliana] gi|20197966|gb|AAD21727.2| putative phosphoprotein phosphatase [Arabidopsis thaliana] gi|33589766|gb|AAQ22649.1| At2g42810/F7D19.19 [Arabidopsis thaliana] gi|330255077|gb|AEC10171.1| serine/threonine-protein phosphatase 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449444753|ref|XP_004140138.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Cucumis sativus] gi|449481084|ref|XP_004156077.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357127077|ref|XP_003565212.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|326523823|dbj|BAJ93082.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|413944781|gb|AFW77430.1| putative serine/threonine protein phosphatase superfamily protein [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 429 | ||||||
| TAIR|locus:2052345 | 538 | PP5.2 "protein phosphatase 5.2 | 0.627 | 0.5 | 0.845 | 5.4e-195 | |
| UNIPROTKB|H0YDU8 | 485 | PPP5C "Serine/threonine-protei | 0.974 | 0.861 | 0.551 | 2.6e-127 | |
| UNIPROTKB|P53041 | 499 | PPP5C "Serine/threonine-protei | 0.974 | 0.837 | 0.551 | 2.6e-127 | |
| UNIPROTKB|F1RM25 | 499 | PPP5C "Serine/threonine-protei | 0.974 | 0.837 | 0.554 | 2.6e-127 | |
| RGD|68415 | 499 | Ppp5c "protein phosphatase 5, | 0.969 | 0.833 | 0.556 | 2.6e-127 | |
| UNIPROTKB|F1N719 | 499 | PPP5C "Serine/threonine-protei | 0.974 | 0.837 | 0.549 | 3.3e-127 | |
| MGI|MGI:102666 | 499 | Ppp5c "protein phosphatase 5, | 0.974 | 0.837 | 0.554 | 3.3e-127 | |
| FB|FBgn0005777 | 520 | PpD3 "Protein phosphatase D3" | 0.958 | 0.790 | 0.540 | 2.1e-125 | |
| WB|WBGene00012665 | 496 | pph-5 [Caenorhabditis elegans | 0.958 | 0.828 | 0.544 | 2.6e-125 | |
| ZFIN|ZDB-GENE-050327-75 | 481 | zgc:110801 "zgc:110801" [Danio | 0.981 | 0.875 | 0.539 | 1.3e-123 |
| TAIR|locus:2052345 PP5.2 "protein phosphatase 5.2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1270 (452.1 bits), Expect = 5.4e-195, Sum P(2) = 5.4e-195
Identities = 241/285 (84%), Positives = 258/285 (90%)
Query: 158 EVEPQYSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDID 217
+VEPQYSGARIEG+ +TLDFVK MM+DFKNQK LHKRYA+QIVLQTR++L ALPSLVDI
Sbjct: 211 KVEPQYSGARIEGEEVTLDFVKTMMEDFKNQKTLHKRYAYQIVLQTRQILLALPSLVDIS 270
Query: 218 IPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFK 277
+P GKH TVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVE+ILTLFAFK
Sbjct: 271 VPHGKHITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEIILTLFAFK 330
Query: 278 CMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFV 337
CMCPS+IYL+RGNHESKSMNKIYGFEGEVRSKLSE FV+LFAEVFC LPLAHV+N KVFV
Sbjct: 331 CMCPSSIYLARGNHESKSMNKIYGFEGEVRSKLSEKFVDLFAEVFCYLPLAHVINGKVFV 390
Query: 338 VHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF---- 393
VHGGLFSVDGVKLSDI+ IDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF
Sbjct: 391 VHGGLFSVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGGDV 450
Query: 394 ------------VVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQV 426
+VRSHEVKDEGYE+EHDGKLITVFSAPNYCDQ+
Sbjct: 451 TKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKLITVFSAPNYCDQM 495
|
|
| UNIPROTKB|H0YDU8 PPP5C "Serine/threonine-protein phosphatase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P53041 PPP5C "Serine/threonine-protein phosphatase 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RM25 PPP5C "Serine/threonine-protein phosphatase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|68415 Ppp5c "protein phosphatase 5, catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N719 PPP5C "Serine/threonine-protein phosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:102666 Ppp5c "protein phosphatase 5, catalytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005777 PpD3 "Protein phosphatase D3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00012665 pph-5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050327-75 zgc:110801 "zgc:110801" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_XIV2951 | hypothetical protein (488 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 429 | |||
| cd07417 | 316 | cd07417, MPP_PP5_C, PP5, C-terminal metallophospha | 0.0 | |
| smart00156 | 271 | smart00156, PP2Ac, Protein phosphatase 2A homologu | 1e-100 | |
| cd07420 | 321 | cd07420, MPP_RdgC, Drosophila melanogaster RdgC an | 1e-81 | |
| cd07416 | 305 | cd07416, MPP_PP2B, PP2B, metallophosphatase domain | 1e-77 | |
| cd07415 | 285 | cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos | 6e-77 | |
| cd07414 | 293 | cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li | 2e-68 | |
| cd00144 | 225 | cd00144, MPP_PPP_family, phosphoprotein phosphatas | 2e-62 | |
| PTZ00244 | 294 | PTZ00244, PTZ00244, serine/threonine-protein phosp | 7e-57 | |
| cd07418 | 377 | cd07418, MPP_PP7, PP7, metallophosphatase domain | 1e-54 | |
| PTZ00480 | 320 | PTZ00480, PTZ00480, serine/threonine-protein phosp | 4e-54 | |
| PTZ00239 | 303 | PTZ00239, PTZ00239, serine/threonine protein phosp | 5e-52 | |
| cd07419 | 311 | cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho | 1e-47 | |
| pfam08321 | 95 | pfam08321, PPP5, PPP5 TPR repeat region | 4e-42 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 4e-29 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 3e-24 | |
| pfam00149 | 185 | pfam00149, Metallophos, Calcineurin-like phosphoes | 2e-20 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 4e-18 | |
| COG0639 | 155 | COG0639, ApaH, Diadenosine tetraphosphatase and re | 1e-17 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 1e-17 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 1e-14 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 2e-10 | |
| TIGR02552 | 135 | TIGR02552, LcrH_SycD, type III secretion low calci | 5e-10 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 3e-08 | |
| TIGR03302 | 235 | TIGR03302, OM_YfiO, outer membrane assembly lipopr | 4e-08 | |
| COG5010 | 257 | COG5010, TadD, Flp pilus assembly protein TadD, co | 4e-08 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 7e-08 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 2e-07 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 2e-07 | |
| TIGR03939 | 800 | TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g | 5e-07 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 1e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 1e-06 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 2e-06 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 2e-06 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 4e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 5e-06 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 5e-06 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 5e-06 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 1e-05 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 2e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 2e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 2e-05 | |
| cd07423 | 234 | cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela | 2e-05 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 2e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 3e-05 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 4e-05 | |
| pfam13371 | 73 | pfam13371, TPR_9, Tetratricopeptide repeat | 4e-05 | |
| COG4783 | 484 | COG4783, COG4783, Putative Zn-dependent protease, | 4e-05 | |
| cd07424 | 207 | cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos | 6e-05 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 7e-05 | |
| cd00838 | 131 | cd00838, MPP_superfamily, metallophosphatase super | 8e-05 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 1e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 1e-04 | |
| cd07425 | 208 | cd07425, MPP_Shelphs, Shewanella-like phosphatases | 1e-04 | |
| pfam13431 | 34 | pfam13431, TPR_17, Tetratricopeptide repeat | 1e-04 | |
| TIGR02795 | 117 | TIGR02795, tol_pal_ybgF, tol-pal system protein Yb | 1e-04 | |
| PRK13625 | 245 | PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphospha | 2e-04 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 3e-04 | |
| pfam00515 | 34 | pfam00515, TPR_1, Tetratricopeptide repeat | 4e-04 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 4e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 5e-04 | |
| PRK11788 | 389 | PRK11788, PRK11788, tetratricopeptide repeat prote | 7e-04 | |
| COG4785 | 297 | COG4785, NlpI, Lipoprotein NlpI, contains TPR repe | 8e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 9e-04 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 9e-04 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 9e-04 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 0.001 | |
| PRK15359 | 144 | PRK15359, PRK15359, type III secretion system chap | 0.001 | |
| PRK11189 | 296 | PRK11189, PRK11189, lipoprotein NlpI; Provisional | 0.001 | |
| pfam07719 | 34 | pfam07719, TPR_2, Tetratricopeptide repeat | 0.002 | |
| pfam13181 | 34 | pfam13181, TPR_8, Tetratricopeptide repeat | 0.003 | |
| COG1729 | 262 | COG1729, COG1729, Uncharacterized protein conserve | 0.003 | |
| COG4235 | 287 | COG4235, COG4235, Cytochrome c biogenesis factor [ | 0.003 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 0.004 | |
| TIGR04075 | 851 | TIGR04075, bacter_Pnkp, polynucleotide kinase-phos | 0.004 |
| >gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
Score = 541 bits (1395), Expect = 0.0
Identities = 189/279 (67%), Positives = 226/279 (81%), Gaps = 16/279 (5%)
Query: 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGK 222
Y G R+E + +TL+FVK+M++ FK+QK LHK+YA+QI+LQ +E+L+ LPSLV+I IP+G+
Sbjct: 1 YDGPRLEDEKVTLEFVKEMIEWFKDQKKLHKKYAYQILLQVKELLKKLPSLVEITIPEGE 60
Query: 223 HFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPS 282
TVCGD HGQFYDLLNIFELNGLPSE NPYLFNGDFVDRGSFSVEVILTLFAFK + P+
Sbjct: 61 KITVCGDTHGQFYDLLNIFELNGLPSETNPYLFNGDFVDRGSFSVEVILTLFAFKLLYPN 120
Query: 283 AIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGL 342
+L+RGNHE+ +MNK+YGFEGEV++K +E +LF+EVF LPLAH++N KV VVHGGL
Sbjct: 121 HFHLNRGNHETDNMNKMYGFEGEVKAKYNEQMFDLFSEVFNWLPLAHLINGKVLVVHGGL 180
Query: 343 FSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF--------- 393
FS DGV L DI+ IDRF +PP+ GLMCELLWSDPQP PGR PSKRGVG F
Sbjct: 181 FSDDGVTLDDIRKIDRFRQPPDSGLMCELLWSDPQPQPGRSPSKRGVGCQFGPDVTKRFL 240
Query: 394 -------VVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQ 425
++RSHEVKDEGYE+EHDGK ITVFSAPNYCDQ
Sbjct: 241 EENNLEYIIRSHEVKDEGYEVEHDGKCITVFSAPNYCDQ 279
|
Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP gene family of protein phosphatases that is highly conserved among eukaryotes and widely expressed in mammalian tissues. PP5 has a C-terminal phosphatase domain and an extended N-terminal TPR (tetratricopeptide repeat) domain containing three TPR motifs. The PPP (phosphoprotein phosphatase) family, to which PP5 belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 316 |
| >gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|149395 pfam08321, PPP5, PPP5 TPR repeat region | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234164 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205550 pfam13371, TPR_9, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|188247 TIGR02795, tol_pal_ybgF, tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >gnl|CDD|184187 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|236983 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|185257 PRK15359, PRK15359, type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|224643 COG1729, COG1729, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 429 | |||
| KOG0372 | 303 | consensus Serine/threonine specific protein phosph | 100.0 | |
| KOG0373 | 306 | consensus Serine/threonine specific protein phosph | 100.0 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 100.0 | |
| cd07417 | 316 | MPP_PP5_C PP5, C-terminal metallophosphatase domai | 100.0 | |
| cd07420 | 321 | MPP_RdgC Drosophila melanogaster RdgC and related | 100.0 | |
| cd07415 | 285 | MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein | 100.0 | |
| PTZ00480 | 320 | serine/threonine-protein phosphatase; Provisional | 100.0 | |
| KOG0374 | 331 | consensus Serine/threonine specific protein phosph | 100.0 | |
| PTZ00239 | 303 | serine/threonine protein phosphatase 2A; Provision | 100.0 | |
| KOG0375 | 517 | consensus Serine-threonine phosphatase 2B, catalyt | 100.0 | |
| PTZ00244 | 294 | serine/threonine-protein phosphatase PP1; Provisio | 100.0 | |
| cd07414 | 293 | MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme | 100.0 | |
| cd07416 | 305 | MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca | 100.0 | |
| cd07418 | 377 | MPP_PP7 PP7, metallophosphatase domain. PP7 is a p | 100.0 | |
| KOG0371 | 319 | consensus Serine/threonine protein phosphatase 2A, | 100.0 | |
| smart00156 | 271 | PP2Ac Protein phosphatase 2A homologues, catalytic | 100.0 | |
| cd07419 | 311 | MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a | 100.0 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 100.0 | |
| cd00144 | 225 | MPP_PPP_family phosphoprotein phosphatases of the | 99.98 | |
| PRK13625 | 245 | bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision | 99.93 | |
| cd07413 | 222 | MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat | 99.9 | |
| cd07425 | 208 | MPP_Shelphs Shewanella-like phosphatases, metallop | 99.9 | |
| cd07423 | 234 | MPP_PrpE Bacillus subtilis PrpE and related protei | 99.9 | |
| cd07422 | 257 | MPP_ApaH Escherichia coli ApaH and related protein | 99.9 | |
| PRK11439 | 218 | pphA serine/threonine protein phosphatase 1; Provi | 99.9 | |
| TIGR00668 | 279 | apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric | 99.89 | |
| PHA02239 | 235 | putative protein phosphatase | 99.88 | |
| cd07424 | 207 | MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do | 99.88 | |
| cd07421 | 304 | MPP_Rhilphs Rhilph phosphatases, metallophosphatas | 99.88 | |
| PRK00166 | 275 | apaH diadenosine tetraphosphatase; Reviewed | 99.87 | |
| PRK09968 | 218 | serine/threonine-specific protein phosphatase 2; P | 99.85 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.77 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.75 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.71 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.7 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.62 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.6 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.58 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.58 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.57 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.56 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.54 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.51 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.5 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.5 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.49 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.48 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.48 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.47 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.46 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.46 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.45 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.45 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.44 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.43 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.42 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.41 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.41 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.4 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.39 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.39 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.38 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.37 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.36 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.36 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.36 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.35 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.34 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.34 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.32 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.32 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.3 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.29 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.29 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.29 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.28 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 99.28 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.27 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.27 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.26 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.26 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.25 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.24 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.23 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.23 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.21 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.21 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.2 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.19 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.19 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.19 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.18 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.17 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.17 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.16 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.15 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 99.14 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.14 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.13 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.12 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 99.12 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.12 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 99.11 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.1 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.1 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 99.09 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.08 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.07 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.07 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.07 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.06 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.05 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 99.03 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 99.02 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 99.01 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 99.0 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.96 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.96 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.96 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.95 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.92 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.91 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.91 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.91 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.91 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.91 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.89 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.89 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 98.88 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.88 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.88 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.87 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.87 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.87 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.85 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.85 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.85 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.84 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.84 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.84 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.84 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.83 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.83 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.81 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.81 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.81 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 98.8 | |
| PF00149 | 200 | Metallophos: Calcineurin-like phosphoesterase; Int | 98.8 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.8 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.79 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.79 | |
| PRK09453 | 182 | phosphodiesterase; Provisional | 98.78 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.78 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.77 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.77 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.76 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.76 | |
| COG0639 | 155 | ApaH Diadenosine tetraphosphatase and related seri | 98.76 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.74 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.74 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.73 | |
| cd00841 | 155 | MPP_YfcE Escherichia coli YfcE and related protein | 98.72 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.72 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.7 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.67 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.66 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.65 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.65 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.64 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.63 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.62 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.62 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.62 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.61 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.6 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.58 | |
| PF08321 | 95 | PPP5: PPP5 TPR repeat region; InterPro: IPR013235 | 98.57 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.57 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.56 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.56 | |
| cd07397 | 238 | MPP_DevT Myxococcus xanthus DevT and related prote | 98.52 | |
| TIGR00040 | 158 | yfcE phosphoesterase, MJ0936 family. Members of th | 98.51 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.5 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.48 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.46 | |
| PF12850 | 156 | Metallophos_2: Calcineurin-like phosphoesterase su | 98.39 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.38 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.38 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.37 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.35 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.34 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.32 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.31 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.31 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.3 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 98.28 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.24 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.22 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.2 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.2 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.2 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.2 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.18 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.17 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.17 | |
| cd07388 | 224 | MPP_Tt1561 Thermus thermophilus Tt1561 and related | 98.16 | |
| cd07379 | 135 | MPP_239FB Homo sapiens 239FB and related proteins, | 98.14 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.11 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.04 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 98.03 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.03 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.02 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.01 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.99 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.99 | |
| cd00838 | 131 | MPP_superfamily metallophosphatase superfamily, me | 97.98 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.96 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.95 | |
| cd07394 | 178 | MPP_Vps29 Homo sapiens Vps29 and related proteins, | 97.93 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.93 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.93 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.92 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.91 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.89 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.84 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.84 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.83 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.83 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.8 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.8 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.8 | |
| PRK05340 | 241 | UDP-2,3-diacylglucosamine hydrolase; Provisional | 97.79 | |
| cd07404 | 166 | MPP_MS158 Microscilla MS158 and related proteins, | 97.78 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.75 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.73 | |
| cd07392 | 188 | MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel | 97.73 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.71 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.71 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.67 | |
| PRK11340 | 271 | phosphodiesterase YaeI; Provisional | 97.66 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.66 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.61 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.6 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.59 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.58 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.58 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.57 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.55 | |
| cd07385 | 223 | MPP_YkuE_C Bacillus subtilis YkuE and related prot | 97.54 | |
| cd07390 | 168 | MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro | 97.51 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.49 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.49 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.46 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.45 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.44 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 97.43 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.38 | |
| cd07403 | 129 | MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel | 97.37 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.35 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.35 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.34 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.34 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.31 | |
| TIGR03729 | 239 | acc_ester putative phosphoesterase. Members of thi | 97.3 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.3 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 97.26 | |
| cd07391 | 172 | MPP_PF1019 Pyrococcus furiosus PF1019 and related | 97.26 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.23 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 97.21 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.2 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.15 | |
| cd07396 | 267 | MPP_Nbla03831 Homo sapiens Nbla03831 and related p | 97.11 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 97.11 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 97.11 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.09 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.08 | |
| TIGR00619 | 253 | sbcd exonuclease SbcD. This family is based on the | 97.07 | |
| TIGR01854 | 231 | lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. | 97.04 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 97.02 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.02 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 97.01 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 97.01 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.0 | |
| cd07402 | 240 | MPP_GpdQ Enterobacter aerogenes GpdQ and related p | 96.95 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.95 | |
| cd07400 | 144 | MPP_YydB Bacillus subtilis YydB and related protei | 96.93 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.91 | |
| COG0622 | 172 | Predicted phosphoesterase [General function predic | 96.9 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.89 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.88 | |
| PRK11148 | 275 | cyclic 3',5'-adenosine monophosphate phosphodieste | 96.87 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.87 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.87 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.86 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.85 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 96.84 | |
| PHA02546 | 340 | 47 endonuclease subunit; Provisional | 96.82 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.81 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 96.8 | |
| cd00844 | 262 | MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t | 96.8 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.77 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.77 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.76 | |
| cd08166 | 195 | MPP_Cdc1_like_1 uncharacterized subgroup related t | 96.76 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 96.75 | |
| cd07398 | 217 | MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat | 96.72 | |
| cd07383 | 199 | MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase | 96.72 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.71 | |
| cd00840 | 223 | MPP_Mre11_N Mre11 nuclease, N-terminal metallophos | 96.69 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 96.68 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.67 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.66 | |
| cd07393 | 232 | MPP_DR1119 Deinococcus radiodurans DR1119 and rela | 96.64 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.62 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.6 | |
| PRK04036 | 504 | DNA polymerase II small subunit; Validated | 96.56 | |
| cd07399 | 214 | MPP_YvnB Bacillus subtilis YvnB and related protei | 96.54 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 96.46 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.45 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.43 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.41 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.36 | |
| COG4186 | 186 | Predicted phosphoesterase or phosphohydrolase [Gen | 96.36 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.34 | |
| TIGR00024 | 225 | SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 | 96.32 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 96.27 | |
| cd07384 | 171 | MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re | 96.26 | |
| TIGR00583 | 405 | mre11 DNA repair protein (mre11). All proteins in | 96.25 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 96.23 | |
| cd08165 | 156 | MPP_MPPE1 human MPPE1 and related proteins, metall | 96.18 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.15 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 96.14 | |
| cd08163 | 257 | MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related | 96.12 | |
| PRK10966 | 407 | exonuclease subunit SbcD; Provisional | 96.12 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 96.11 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 96.1 | |
| cd07395 | 262 | MPP_CSTP1 Homo sapiens CSTP1 and related proteins, | 95.98 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 95.95 | |
| cd08164 | 193 | MPP_Ted1 Saccharomyces cerevisiae Ted1 and related | 95.94 | |
| COG1409 | 301 | Icc Predicted phosphohydrolases [General function | 95.93 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 95.92 | |
| cd07380 | 150 | MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re | 95.91 | |
| COG2908 | 237 | Uncharacterized protein conserved in bacteria [Fun | 95.87 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 95.86 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 95.85 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 95.65 | |
| cd07401 | 256 | MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal | 95.63 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 95.62 | |
| cd00839 | 294 | MPP_PAPs purple acid phosphatases of the metalloph | 95.59 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 95.48 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 95.42 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 95.35 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 95.33 | |
| COG1408 | 284 | Predicted phosphohydrolases [General function pred | 95.32 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 95.3 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 95.24 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 95.21 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 95.17 | |
| cd07386 | 243 | MPP_DNA_pol_II_small_archeal_C archeal DNA polymer | 95.08 | |
| cd00845 | 252 | MPP_UshA_N_like Escherichia coli UshA-like family, | 95.03 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 95.0 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 94.97 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 94.94 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 94.92 | |
| KOG3662 | 410 | consensus Cell division control protein/predicted | 94.88 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 94.76 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 94.72 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 94.7 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 94.67 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 94.66 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 94.58 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 94.39 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 94.12 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 94.11 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 94.04 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 93.92 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 93.92 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 93.89 | |
| COG0420 | 390 | SbcD DNA repair exonuclease [DNA replication, reco | 93.82 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 93.71 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 93.6 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 93.57 | |
| COG2129 | 226 | Predicted phosphoesterases, related to the Icc pro | 93.55 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 93.52 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 93.5 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 93.32 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 93.3 | |
| COG1407 | 235 | Predicted ICC-like phosphoesterases [General funct | 93.19 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 93.16 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 93.14 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 93.12 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 93.08 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 93.06 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 92.93 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 92.93 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 92.8 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 92.78 | |
| PF14582 | 255 | Metallophos_3: Metallophosphoesterase, calcineurin | 92.69 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 92.59 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 92.47 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 92.46 | |
| cd07410 | 277 | MPP_CpdB_N Escherichia coli CpdB and related prote | 92.39 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 92.35 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 92.19 | |
| cd07378 | 277 | MPP_ACP5 Homo sapiens acid phosphatase 5 and relat | 92.05 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 91.82 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 91.81 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 91.74 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 91.64 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 91.58 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 91.57 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 91.53 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 91.45 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 91.42 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 91.4 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 91.38 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 91.14 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 90.87 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 90.78 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 90.69 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 90.54 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 90.47 | |
| COG1311 | 481 | HYS2 Archaeal DNA polymerase II, small subunit/DNA | 89.99 | |
| PLN02533 | 427 | probable purple acid phosphatase | 89.74 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 89.74 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 89.57 | |
| KOG0918 | 476 | consensus Selenium-binding protein [Inorganic ion | 89.48 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 89.41 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 89.34 | |
| cd07412 | 288 | MPP_YhcR_N Bacillus subtilis YhcR endonuclease and | 89.22 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 89.15 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 88.99 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 88.97 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 88.82 | |
| cd07408 | 257 | MPP_SA0022_N Staphylococcus aureus SA0022 and rela | 88.6 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 88.34 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 88.32 | |
| cd07411 | 264 | MPP_SoxB_N Thermus thermophilus SoxB and related p | 88.23 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 87.84 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 87.82 | |
| KOG3807 | 556 | consensus Predicted membrane protein ST7 (tumor su | 86.97 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 86.44 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 86.29 | |
| PF09670 | 379 | Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 | 86.25 | |
| PF06874 | 640 | FBPase_2: Firmicute fructose-1,6-bisphosphatase; I | 85.87 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 85.8 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 85.79 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 85.69 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 85.68 | |
| COG1768 | 230 | Predicted phosphohydrolase [General function predi | 85.3 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 84.98 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 84.5 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 84.12 | |
| cd00842 | 296 | MPP_ASMase acid sphingomyelinase and related prote | 83.38 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 83.16 | |
| COG4941 | 415 | Predicted RNA polymerase sigma factor containing a | 83.15 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 83.14 | |
| cd07406 | 257 | MPP_CG11883_N Drosophila melanogaster CG11883 and | 82.82 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 82.79 | |
| cd07409 | 281 | MPP_CD73_N CD73 ecto-5'-nucleotidase and related p | 82.74 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 82.33 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 82.09 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 81.89 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 81.09 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 80.71 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 80.61 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 80.58 |
| >KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-77 Score=507.49 Aligned_cols=246 Identities=42% Similarity=0.762 Sum_probs=238.2
Q ss_pred HHHHHHHhhcccCCcHHHHHHHHHHHHHHHhhCCCeeeecCCCCCceEEEccCCCCHHHHHHHHHHcCCCCCCCCeEEcc
Q 014212 178 VKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNG 257 (429)
Q Consensus 178 l~~li~~l~~~~~l~~~~~~~ll~~a~~~l~~~p~~~~~~~~~~~~~~v~GDihG~~~~l~~~l~~~~~~~~~~~~~~lG 257 (429)
+++.++.+.+...+.+.++..+|.++++++.++++++.+..| +.|+||+||++.|++.+|+..|-+|.+ +|+|||
T Consensus 3 ldr~ie~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tP----vtvcGDIHGQf~Dllelf~igG~~~~t-~YLFLG 77 (303)
T KOG0372|consen 3 LDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRIDTP----VTVCGDIHGQFYDLLELFRIGGDVPET-NYLFLG 77 (303)
T ss_pred HHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCC----cEEeecccchHHHHHHHHHhCCCCCCC-ceEeec
Confidence 677888999999999999999999999999999999999988 999999999999999999998877766 599999
Q ss_pred ccccCCCCcHHHHHHHHHhhhhCCCeEEEecCCcccccchhhccchhhhhcccc-hHHHHHHHHHhccCcccceecCeEE
Q 014212 258 DFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLS-ETFVELFAEVFCCLPLAHVLNQKVF 336 (429)
Q Consensus 258 D~vdrG~~s~e~~~~l~~lk~~~p~~~~~lrGNhe~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~lp~~~~~~~~~~ 336 (429)
||||||..|+|++.+|+.||++||++|++||||||++.++..|||++||.+||+ ..+|+.+++.|+.||++|+|+++||
T Consensus 78 DyVDRG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kif 157 (303)
T KOG0372|consen 78 DYVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIF 157 (303)
T ss_pred chhccccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEE
Confidence 999999999999999999999999999999999999999999999999999995 6899999999999999999999999
Q ss_pred EEecCccCCCCCCccccccccCCCCCCCCCcccccccCCCCCCCCCCCCCCCCcEEE----------------EEeeccc
Q 014212 337 VVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF----------------VVRSHEV 400 (429)
Q Consensus 337 ~vH~gi~~~~~~~~~~i~~~~r~~~~~~~~~~~~~lw~dp~~~~~~~~~~~~~~~~~----------------iir~h~~ 400 (429)
|||||+ ||.++++++|+.++|.++.|+++.++|+|||||.+..||..|+||+|..| |+|+||.
T Consensus 158 CVHGGl-SP~i~~lDqIr~lDR~~Eiph~g~m~DllWSDPee~~g~~~SPRGaGylFG~dvv~~F~~~N~~~~I~RaHQL 236 (303)
T KOG0372|consen 158 CVHGGL-SPSIQTLDQIRVLDRKQEVPHDGAMCDLLWSDPEEGPGWGLSPRGAGYLFGEDVVESFLEANGLSLICRAHQL 236 (303)
T ss_pred EEcCCC-CcchhhHHHHHHhhccccCCCCCcchheeccCcccCCCcccCCCCccccccHHHHHHHHHhCChHHHHHHHHH
Confidence 999999 99999999999999999999999999999999999999999999999999 9999999
Q ss_pred cccCceeecCCeEEEEcCCCCCCCcCCCC
Q 014212 401 KDEGYEIEHDGKLITVFSAPNYCDQVTKL 429 (429)
Q Consensus 401 ~~~g~~~~~~~~~~t~fs~~~y~~~~~n~ 429 (429)
+++||++.|+++|+|||||||||++++|+
T Consensus 237 v~eGyk~~F~~~v~TVWSAPNYCYrCGN~ 265 (303)
T KOG0372|consen 237 VMEGYKWHFDEKVVTVWSAPNYCYRCGNV 265 (303)
T ss_pred HHhhHHHhcCCceEEEecCCchhhhcCCh
Confidence 99999999999999999999999999994
|
|
| >KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >PTZ00480 serine/threonine-protein phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00239 serine/threonine protein phosphatase 2A; Provisional | Back alignment and domain information |
|---|
| >KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00244 serine/threonine-protein phosphatase PP1; Provisional | Back alignment and domain information |
|---|
| >cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07416 MPP_PP2B PP2B, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07418 MPP_PP7 PP7, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain | Back alignment and domain information |
|---|
| >cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional | Back alignment and domain information |
|---|
| >cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11439 pphA serine/threonine protein phosphatase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) | Back alignment and domain information |
|---|
| >PHA02239 putative protein phosphatase | Back alignment and domain information |
|---|
| >cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK00166 apaH diadenosine tetraphosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK09968 serine/threonine-specific protein phosphatase 2; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09453 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00040 yfcE phosphoesterase, MJ0936 family | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK11340 phosphodiesterase YaeI; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03729 acc_ester putative phosphoesterase | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00619 sbcd exonuclease SbcD | Back alignment and domain information |
|---|
| >TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0622 Predicted phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PHA02546 47 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PRK04036 DNA polymerase II small subunit; Validated | Back alignment and domain information |
|---|
| >cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR00583 mre11 DNA repair protein (mre11) | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK10966 exonuclease subunit SbcD; Provisional | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >COG1409 Icc Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG2908 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >COG1408 Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >COG1407 Predicted ICC-like phosphoesterases [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG0918 consensus Selenium-binding protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) | Back alignment and domain information |
|---|
| >PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >COG1768 Predicted phosphohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 429 | ||||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 1e-142 | ||
| 1s95_A | 333 | Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 | 4e-95 | ||
| 3h60_A | 315 | Catalytic Domain Of Human SerineTHREONINE PHOSPHATA | 1e-93 | ||
| 3icf_A | 335 | Structure Of Protein SerineTHREONINE PHOSPHATASE FR | 2e-62 | ||
| 2o8a_A | 329 | Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng | 8e-50 | ||
| 1jk7_A | 323 | Crystal Structure Of The Tumor-Promoter Okadaic Aci | 9e-50 | ||
| 4g9j_A | 331 | Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P | 1e-49 | ||
| 1fjm_A | 330 | Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor | 1e-49 | ||
| 3n5u_B | 300 | Crystal Structure Of An Rb C-Terminal Peptide Bound | 1e-49 | ||
| 3egg_A | 329 | Crystal Structure Of A Complex Between Protein Phos | 1e-49 | ||
| 3v4y_A | 306 | Crystal Structure Of The First Nuclear Pp1 Holoenzy | 1e-49 | ||
| 3e7a_A | 299 | Crystal Structure Of Protein Phosphatase-1 Bound To | 2e-49 | ||
| 1u32_A | 293 | Crystal Structure Of A Protein Phosphatase-1: Calci | 6e-49 | ||
| 1s70_A | 330 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 3e-48 | ||
| 1aui_A | 521 | Human Calcineurin Heterodimer Length = 521 | 2e-47 | ||
| 1tco_A | 375 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 1e-46 | ||
| 1mf8_A | 373 | Crystal Structure Of Human Calcineurin Complexed Wi | 1e-46 | ||
| 2p6b_A | 383 | Crystal Structure Of Human Calcineurin In Complex W | 1e-46 | ||
| 3ll8_A | 357 | Crystal Structure Of Calcineurin In Complex With Ak | 1e-46 | ||
| 2jog_A | 327 | Structure Of The Calcineurin-Nfat Complex Length = | 1e-46 | ||
| 1m63_A | 372 | Crystal Structure Of Calcineurin-Cyclophilin-Cyclos | 1e-46 | ||
| 3p71_C | 304 | Crystal Structure Of The Complex Of Lcmt-1 And Pp2a | 1e-43 | ||
| 2ie3_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 1e-43 | ||
| 2nyl_C | 293 | Crystal Structure Of Protein Phosphatase 2a (Pp2a) | 1e-43 | ||
| 2ie4_C | 309 | Structure Of The Protein Phosphatase 2a Core Enzyme | 1e-43 | ||
| 3c5w_C | 310 | Complex Between Pp2a-Specific Methylesterase Pme-1 | 2e-43 | ||
| 3fga_C | 309 | Structural Basis Of Pp2a And Sgo Interaction Length | 4e-43 | ||
| 2iae_C | 309 | Crystal Structure Of A Protein Phosphatase 2a (Pp2a | 5e-43 | ||
| 1a17_A | 166 | Tetratricopeptide Repeats Of Protein Phosphatase 5 | 5e-41 | ||
| 2bug_A | 140 | Solution Structure Of The Tpr Domain From Protein P | 6e-33 | ||
| 2vyi_A | 131 | Crystal Structure Of The Tpr Domain Of Human Sgt Le | 7e-17 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 3e-16 | ||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 2e-13 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 8e-13 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 1e-12 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 4e-12 | ||
| 1elw_A | 118 | Crystal Structure Of The Tpr1 Domain Of Hop In Comp | 1e-11 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 3e-11 | ||
| 3sz7_A | 164 | Crystal Structure Of The Sgt2 Tpr Domain From Asper | 3e-11 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 4e-11 | ||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 1e-10 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 2e-10 | ||
| 1p5q_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Lengt | 4e-10 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 7e-10 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 2e-08 | ||
| 2gw1_A | 514 | Crystal Structure Of The Yeast Tom70 Length = 514 | 2e-08 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 2e-08 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 5e-05 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 2e-08 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 5e-05 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 5e-08 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 9e-08 | ||
| 3uq3_A | 258 | Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = | 2e-07 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 2e-06 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 3e-06 | ||
| 2avp_A | 70 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 6e-05 | ||
| 2avp_A | 70 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 9e-05 | ||
| 3pe3_A | 723 | Structure Of Human O-Glcnac Transferase And Its Com | 7e-05 | ||
| 2fbn_A | 198 | Plasmodium Falciparum Putative Fk506-Binding Protei | 8e-05 | ||
| 4gcn_A | 127 | N-Terminal Domain Of Stress-Induced Protein-1 (Sti- | 1e-04 | ||
| 1elr_A | 131 | Crystal Structure Of The Tpr2a Domain Of Hop In Com | 2e-04 | ||
| 3esk_A | 129 | Structure Of Hop Tpr2a Domain In Complex With The N | 2e-04 | ||
| 2l6j_A | 111 | Tah1 Complexed By Meevd Length = 111 | 4e-04 |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
|
| >pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 | Back alignment and structure |
| >pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 | Back alignment and structure |
| >pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 | Back alignment and structure |
| >pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 | Back alignment and structure |
| >pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 | Back alignment and structure |
| >pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 | Back alignment and structure |
| >pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 | Back alignment and structure |
| >pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 | Back alignment and structure |
| >pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 | Back alignment and structure |
| >pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 | Back alignment and structure |
| >pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 | Back alignment and structure |
| >pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 | Back alignment and structure |
| >pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 | Back alignment and structure |
| >pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 | Back alignment and structure |
| >pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 | Back alignment and structure |
| >pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 | Back alignment and structure |
| >pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 | Back alignment and structure |
| >pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 | Back alignment and structure |
| >pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 | Back alignment and structure |
| >pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 | Back alignment and structure |
| >pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 | Back alignment and structure |
| >pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 | Back alignment and structure |
| >pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 | Back alignment and structure |
| >pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 | Back alignment and structure |
| >pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 | Back alignment and structure |
| >pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 | Back alignment and structure |
| >pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 | Back alignment and structure |
| >pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 | Back alignment and structure |
| >pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 | Back alignment and structure |
| >pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 | Back alignment and structure |
| >pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 | Back alignment and structure |
| >pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 | Back alignment and structure |
| >pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 | Back alignment and structure |
| >pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 | Back alignment and structure |
| >pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 429 | |||
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 0.0 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 1e-159 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 1e-150 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 1e-96 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 2e-93 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 7e-92 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 8e-92 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 3e-91 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 1e-70 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 4e-57 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 7e-56 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 2e-55 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 2e-55 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 5e-17 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 3e-55 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 4e-55 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 4e-53 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 5e-53 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 8e-52 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 2e-47 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 8e-45 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 2e-41 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 6e-39 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 1e-38 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-38 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-33 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 8e-30 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-19 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-18 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-16 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-37 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-32 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-29 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-19 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-19 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-18 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-08 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-36 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 8e-31 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-25 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 1e-23 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-17 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-15 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 1e-35 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 8e-35 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-28 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-26 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-26 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-25 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-21 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-21 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-13 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 8e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-04 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-30 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-25 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-22 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 9e-21 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-20 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-19 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 1e-29 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 3e-16 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 7e-27 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-27 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-24 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-23 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-23 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-22 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-22 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 7e-15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-26 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-23 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 7e-21 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 5e-15 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-07 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 7e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 2e-25 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 3e-13 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-25 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 4e-25 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-23 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-22 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-15 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 6e-11 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 3e-25 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 1e-15 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 6e-25 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-24 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-23 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-23 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-21 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-17 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-12 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 8e-24 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 1e-23 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 1e-19 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 5e-13 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 6e-08 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-23 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 1e-20 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-17 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 9e-17 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-23 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-22 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-20 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-19 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-18 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-18 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-18 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-17 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-15 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-13 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 8e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-22 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 9e-20 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-19 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-18 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 8e-18 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-16 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-11 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-07 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-22 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 5e-21 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 4e-17 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 2e-22 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-21 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 8e-12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-22 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-20 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 5e-19 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 9e-14 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-10 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 4e-22 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 2e-17 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 1e-21 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 2e-21 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 4e-20 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 6e-14 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-21 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-18 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-17 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-20 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-19 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-19 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-16 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 9e-16 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 9e-16 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-20 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-18 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 5e-17 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-16 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-13 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 5e-10 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 2e-20 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 7e-14 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 8e-14 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 3e-20 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 5e-19 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 6e-19 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 7e-17 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-16 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-14 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 5e-18 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 1e-15 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 3e-15 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 6e-13 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 5e-18 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 1e-14 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 3e-09 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 2e-08 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 6e-18 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-17 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-12 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-08 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 7e-04 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-17 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-17 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 8e-16 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-15 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-14 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 6e-17 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 8e-10 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 9e-17 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 6e-12 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-16 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-15 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 5e-14 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 5e-12 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 9e-16 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 5e-08 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 7e-07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-15 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-14 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-13 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-10 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 6e-09 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-06 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 2e-15 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 4e-15 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 2e-12 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 5e-04 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 1e-14 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 3e-11 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 1e-05 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 2e-14 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 4e-13 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 1e-12 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 1e-08 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 3e-06 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 5e-13 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 9e-13 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 9e-13 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 2e-11 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 7e-12 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 2e-10 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 1e-07 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 1e-10 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-09 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-06 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 4e-05 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 1e-04 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 2e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 6e-09 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 3e-06 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 3e-05 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 2e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 4e-04 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 3e-08 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 6e-08 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 3e-05 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 7e-08 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 2e-07 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 4e-06 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-04 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 1e-04 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 1e-07 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-07 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 3e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 3e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 5e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-04 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 3e-07 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 4e-07 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 4e-06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 1e-05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 1e-04 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 9e-04 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 6e-07 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 3e-04 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 7e-07 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 3e-06 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 2e-05 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 8e-05 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 5e-05 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 2e-04 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 6e-05 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 5e-04 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 8e-05 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 9e-05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 1e-04 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 8e-04 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 3e-04 |
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
Score = 659 bits (1701), Expect = 0.0
Identities = 240/433 (55%), Positives = 314/433 (72%), Gaps = 17/433 (3%)
Query: 9 SSVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAI 68
++ RAEELK AN+ F+AK Y AI YSQAIELN NA+YY NR+ A+ + E YG A+
Sbjct: 1 GALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYAL 60
Query: 69 QDASKAIEIDPRYPKGYYRRGAAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKA 128
DA++AIE+D +Y KGYYRR A+ +A+GKF+ AL+D++ V K+ P+D DA K +EC K
Sbjct: 61 GDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI 120
Query: 129 VKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIEGDVITLDFVKKMMDDFKNQ 188
VK+ FE AIA E +R SV DS+D +S+ +E +YSG ++E +T+ F+K++M +K+Q
Sbjct: 121 VKQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQ 179
Query: 189 KCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPS 248
K LH++ A+QI++Q +E+L L +LV+ + + + TVCGD HGQFYDLLNIFELNGLPS
Sbjct: 180 KKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPS 239
Query: 249 EENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRS 308
E NPY+FNGDFVDRGSFSVEVILTLF FK + P +L RGNHE+ +MN+IYGFEGEV++
Sbjct: 240 ETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKA 299
Query: 309 KLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLM 368
K + ELF+EVF LPLA +N KV ++HGGLFS DGV L DI+ I+R +PP+ G M
Sbjct: 300 KYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPM 359
Query: 369 CELLWSDPQPLPGRGPSKRGVGLSF----------------VVRSHEVKDEGYEIEHDGK 412
C+LLWSDPQP GR SKRGV F ++RSHEVK EGYE+ H G+
Sbjct: 360 CDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGR 419
Query: 413 LITVFSAPNYCDQ 425
+TVFSAPNYCDQ
Sbjct: 420 CVTVFSAPNYCDQ 432
|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 | Back alignment and structure |
|---|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Length = 129 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Length = 261 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Length = 225 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 429 | |||
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 100.0 | |
| 3h63_A | 315 | Serine/threonine-protein phosphatase 5; metalloenz | 100.0 | |
| 3icf_A | 335 | PPT, serine/threonine-protein phosphatase T; IRO m | 100.0 | |
| 3e7a_A | 299 | PP-1A, serine/threonine-protein phosphatase PP1-al | 100.0 | |
| 3ll8_A | 357 | Serine/threonine-protein phosphatase 2B catalytic | 100.0 | |
| 1aui_A | 521 | Calcineurin, serine/threonine phosphatase 2B; hydr | 100.0 | |
| 2ie4_C | 309 | PP2A-alpha;, serine/threonine-protein phosphatase | 100.0 | |
| 1fjm_A | 330 | Protein serine/threonine phosphatase-1 (alpha ISO | 100.0 | |
| 2z72_A | 342 | Protein-tyrosine-phosphatase; cold-active enzyme, | 100.0 | |
| 2dfj_A | 280 | Diadenosinetetraphosphatase; helices and strands m | 99.97 | |
| 2qjc_A | 262 | Diadenosine tetraphosphatase, putative; putative d | 99.89 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.87 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 99.83 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.8 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.78 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.78 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.76 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.76 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.76 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.76 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.75 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.75 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.75 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.74 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.74 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.74 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.73 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.72 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.72 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.72 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.72 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.71 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.7 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.7 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.69 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.69 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.68 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.68 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.67 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.67 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.66 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.66 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.66 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.66 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.65 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.65 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.64 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.64 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.63 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.62 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.61 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.61 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.6 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.6 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.6 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.6 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.6 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.6 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.59 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.59 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.59 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.59 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.58 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.58 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.58 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.57 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.57 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.57 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.57 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.57 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.57 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.56 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.56 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.55 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.55 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.55 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.55 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.55 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.55 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.54 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.54 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.54 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.54 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.54 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.54 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.54 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.53 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.53 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.52 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.52 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.52 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.52 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.52 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.51 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.51 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.51 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.5 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.49 | |
| 3rqz_A | 246 | Metallophosphoesterase; PSI-biology, midwest cente | 99.48 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.48 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.47 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.46 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.45 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.44 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.44 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.43 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.43 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.43 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.42 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.41 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.41 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.41 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.41 | |
| 1nnw_A | 252 | Hypothetical protein; structural genomics, PSI, pr | 99.4 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.4 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.4 | |
| 3qfm_A | 270 | SAPH, putative uncharacterized protein; sandwich f | 99.4 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.4 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.39 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.39 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.39 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.39 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.38 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.37 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.37 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.37 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.36 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.36 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.35 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.35 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.35 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.34 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.33 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.33 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.33 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.32 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.31 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.31 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.31 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.28 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.28 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.27 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.27 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.27 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.26 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.26 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.26 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.26 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.26 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.26 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.26 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.24 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.23 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.23 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.22 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.22 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.22 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.22 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.21 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.2 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.2 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.2 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.19 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.19 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.19 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.19 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.19 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.18 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.18 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.17 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.17 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.16 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.15 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.15 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.15 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.13 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.13 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.12 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.12 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.12 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.11 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.11 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.11 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.1 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.1 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.1 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.08 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.06 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.05 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.05 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.04 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.03 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.02 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.0 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.99 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.98 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.97 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.97 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.96 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.93 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.85 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.84 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.83 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.8 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.8 | |
| 1su1_A | 208 | Hypothetical protein YFCE; structural genomics, ph | 98.79 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.78 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.77 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.75 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.73 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.73 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.72 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.69 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.67 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.67 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.66 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.63 | |
| 2kkn_A | 178 | Uncharacterized protein; protein phosphatase 2A ho | 98.55 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.53 | |
| 1s3l_A | 190 | Hypothetical protein MJ0936; phosphodiesterase, nu | 98.52 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.48 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.46 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.46 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.45 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.4 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.38 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.38 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.32 | |
| 2a22_A | 215 | Vacuolar protein sorting 29; alpha-beta-BETA-alpha | 98.31 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.28 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.28 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.28 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.26 | |
| 1uf3_A | 228 | Hypothetical protein TT1561; metallo-dependent pho | 98.25 | |
| 1z2w_A | 192 | Vacuolar protein sorting 29; VPS29, retromer, phos | 98.22 | |
| 3ck2_A | 176 | Conserved uncharacterized protein (predicted phosp | 98.13 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.08 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.02 | |
| 2yvt_A | 260 | Hypothetical protein AQ_1956; structural genomics, | 98.01 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 98.01 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.94 | |
| 1xm7_A | 195 | Hypothetical protein AQ_1665; structural genomics, | 97.9 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.85 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.81 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 97.78 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.77 | |
| 3rl5_A | 296 | Metallophosphoesterase mpped2; alpha-beta fold, me | 97.5 | |
| 3d03_A | 274 | Phosphohydrolase; glycerophosphodiesterase, metall | 97.5 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.46 | |
| 3ib7_A | 330 | ICC protein; metallophosphoesterase, alpha-beta fo | 97.44 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 97.28 | |
| 2nxf_A | 322 | Putative dimetal phosphatase; dinuclear metal cent | 97.26 | |
| 3av0_A | 386 | DNA double-strand break repair protein MRE11; DNA | 97.23 | |
| 2q8u_A | 336 | Exonuclease, putative; structural genomics, joint | 97.19 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.12 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.1 | |
| 1ii7_A | 333 | MRE11 nuclease; RAD50, DNA double-strand break rep | 97.08 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.75 | |
| 2xmo_A | 443 | LMO2642 protein; phosphodiesterase, hydrolase; 1.7 | 96.75 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 96.54 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 96.47 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 96.4 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 96.35 | |
| 3tho_B | 379 | Exonuclease, putative; adenosine triphosphate, bac | 96.29 | |
| 4fbk_A | 472 | DNA repair and telomere maintenance protein NBS1, | 96.21 | |
| 3t1i_A | 431 | Double-strand break repair protein MRE11A; DNA rep | 96.21 | |
| 4fbw_A | 417 | DNA repair protein RAD32; DNA double-strand break | 96.17 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 96.11 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 96.07 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 95.98 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.83 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 95.68 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 95.44 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 95.36 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 95.1 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 94.82 | |
| 1ute_A | 313 | Protein (II purple acid phosphatase); tartrate res | 94.5 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 94.0 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 93.76 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 93.57 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 93.45 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 93.25 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 92.75 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 91.88 | |
| 3tgh_A | 342 | Glideosome-associated protein 50; phosphatase fold | 91.85 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 91.7 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 91.39 | |
| 3qfk_A | 527 | Uncharacterized protein; structural genomics, cent | 91.31 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 90.91 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 89.58 | |
| 2z1a_A | 552 | 5'-nucleotidase; metal-binding, nucleotide-binding | 88.99 | |
| 1hp1_A | 516 | 5'-nucleotidase; metallophosphatase, dinuclear, me | 88.93 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 88.37 | |
| 4h2g_A | 546 | 5'-nucleotidase; dimer, hydrolase, phosphatase, ex | 88.34 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 88.0 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 84.82 | |
| 3ztv_A | 579 | NAD nucleotidase, NADN; hydrolase, NAD pyrophospha | 84.04 | |
| 1t71_A | 281 | Phosphatase, conserved HYPO; crystal, X-RAY crysta | 81.72 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 80.79 |
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-81 Score=626.76 Aligned_cols=419 Identities=57% Similarity=0.983 Sum_probs=389.7
Q ss_pred cHhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhhCHHHHHHHHHHHHHhCCCChHHHHHHH
Q 014212 10 SVSRAEELKALANEAFRAKKYSQAIDLYSQAIELNSQNAVYYANRAFAHTKLEEYGSAIQDASKAIEIDPRYPKGYYRRG 89 (429)
Q Consensus 10 ~p~~~~~~~~~a~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la 89 (429)
.++.+.++..+|..++.+|++++|++.|+++++++|+++.++.++|.++.++|++++|+..+++|++++|+++.+++++|
T Consensus 2 ~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~Al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg 81 (477)
T 1wao_1 2 ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRA 81 (477)
T ss_dssp CHHHHTTSSSSSSSTTTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHH
T ss_pred hHhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence 46778889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHhHHHHHhhcCCccccccccccccccccccCCCCCCCccc
Q 014212 90 AAYLAMGKFKEALKDFQQVKKLSPNDPDAAQKVKECEKAVKKLKFEEAIAVPESERHSVADSIDYQSIEVEPQYSGARIE 169 (429)
Q Consensus 90 ~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~~~a~~~~~~~~~~~a~~~~~~~l~~~~~~~~~~~~ 169 (429)
.+|..+|++++|++.|+++++++|+++.++..++.+.......++++|+..+++.. ........++++++|.+.++.+.
T Consensus 82 ~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l~~~~~~~~~g~~~~A~~~~~~~~-~~~~~~~~~al~~~~~~~~~~~~ 160 (477)
T 1wao_1 82 ASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKR-SVVDSLDIESMTIEDEYSGPKLE 160 (477)
T ss_dssp HHHHHHTCHHHHHHHHHHHHHHSTTCTTHHHHHHHHHHHHHHHHHCCC------CC-STTTCCTTSSCCCCTTCCSCCCG
T ss_pred HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHhccccccc-hhHhhhhhhhccccccccccccc
Confidence 99999999999999999999999999999999999955555555899998887433 23345556889999999999888
Q ss_pred CCCCCHHHHHHHHHHhhcccCCcHHHHHHHHHHHHHHHhhCCCeeeecCCCCCceEEEccCCCCHHHHHHHHHHcCCCCC
Q 014212 170 GDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFELNGLPSE 249 (429)
Q Consensus 170 ~~~l~~~~l~~li~~l~~~~~l~~~~~~~ll~~a~~~l~~~p~~~~~~~~~~~~~~v~GDihG~~~~l~~~l~~~~~~~~ 249 (429)
...++...++.+++.++....+++.++..++..+.+++..+|+++++..|.+.++.|+||+||++.+|.++|+..+.++.
T Consensus 161 ~~~itl~~l~~lie~l~~~~~l~e~~v~~L~~~a~eil~~e~~~~~~~~~~~~~~~vigDiHG~~~~l~~~l~~~~~~~~ 240 (477)
T 1wao_1 161 DGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSE 240 (477)
T ss_dssp GGSCCHHHHHHHHHHHHTCCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCSSCEEEEECBCTTCHHHHHHHHHHHCCCBT
T ss_pred cccccHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHccCCCeEEeecCCCcceEEEeCCCCCHHHHHHHHHHcCCCCC
Confidence 86789999999999999999999999999999999999999999999988888999999999999999999999998877
Q ss_pred CCCeEEccccccCCCCcHHHHHHHHHhhhhCCCeEEEecCCcccccchhhccchhhhhcccchHHHHHHHHHhccCcccc
Q 014212 250 ENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAH 329 (429)
Q Consensus 250 ~~~~~~lGD~vdrG~~s~e~~~~l~~lk~~~p~~~~~lrGNhe~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~~ 329 (429)
.+.+||+|||||||++|+||+.+|+++|+.+|.+|++||||||.+.++..|||.+++.++|+..+++.+.++|++||+++
T Consensus 241 ~~~~v~lGD~vdrG~~s~e~~~~l~~l~~~~~~~~~~lrGNHE~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~lp~~~ 320 (477)
T 1wao_1 241 TNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQ 320 (477)
T ss_dssp TBCEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCTTHHHHHHHHHTTSCSEE
T ss_pred cCeEEEeccccCCCcchHHHHHHHHHHHhhCCCceEeecCCccHHHHhhhcChHHHHHHHhhHHHHHHHHHHhccCCcEE
Confidence 76799999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eecCeEEEEecCccCCCCCCccccccccCCCCCCCCCcccccccCCCCCCCCCCCCCCCCcEEE----------------
Q 014212 330 VLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF---------------- 393 (429)
Q Consensus 330 ~~~~~~~~vH~gi~~~~~~~~~~i~~~~r~~~~~~~~~~~~~lw~dp~~~~~~~~~~~~~~~~~---------------- 393 (429)
++++++||||||+|||...++++|+.+.|+.++++.+.++|+|||||....++.+++||.|+.|
T Consensus 321 ~~~~~~~~vHgg~~~~~~~~l~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~ 400 (477)
T 1wao_1 321 CINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDY 400 (477)
T ss_dssp EETTTEEECSSCCCSSSCCCHHHHHTCCCSSCCCSSSHHHHHHHCEECSSSSCEECTTSSSEEECHHHHHHHHHHTTCCE
T ss_pred EEcCcEEEECCCCCccccCCHHHHHhccCCCCCchhhhhhhhccCCCCccCCcCcCCCCCceeECHHHHHHHHHHcCCeE
Confidence 9999999999999888889999999999999999999999999999998889999999999988
Q ss_pred EEeeccccccCceeecCCeEEEEcCCCCCCCcCCCC
Q 014212 394 VVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQVTKL 429 (429)
Q Consensus 394 iir~h~~~~~g~~~~~~~~~~t~fs~~~y~~~~~n~ 429 (429)
||||||++++||+++++|+|||||||||||+.++|+
T Consensus 401 iir~H~~~~~g~~~~~~~~~~tvfsa~~y~~~~~n~ 436 (477)
T 1wao_1 401 IIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNK 436 (477)
T ss_dssp EEECCSCCTEEEEEEGGGTEEEEBCCTTTTSSSCCE
T ss_pred EEECCCCCcCCeEEecCCeEEEEeCCcccccCCCcc
Confidence 999999999999999999999999999999999984
|
| >3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A | Back alignment and structure |
|---|
| >3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* | Back alignment and structure |
|---|
| >3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A | Back alignment and structure |
|---|
| >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* | Back alignment and structure |
|---|
| >1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A | Back alignment and structure |
|---|
| >2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A | Back alignment and structure |
|---|
| >3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* | Back alignment and structure |
|---|
| >3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 | Back alignment and structure |
|---|
| >3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* | Back alignment and structure |
|---|
| >2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C | Back alignment and structure |
|---|
| >4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* | Back alignment and structure |
|---|
| >3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 | Back alignment and structure |
|---|
| >1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* | Back alignment and structure |
|---|
| >1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 429 | ||||
| d1s95a_ | 324 | d.159.1.3 (A:) Serine/threonine protein phosphatas | 1e-107 | |
| d1auia_ | 473 | d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc | 2e-85 | |
| d3c5wc1 | 288 | d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt | 3e-80 | |
| d1jk7a_ | 294 | d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human | 3e-76 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 3e-29 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 1e-22 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 4e-08 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 5e-20 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 5e-04 | |
| d1g5ba_ | 219 | d.159.1.3 (A:) lambda ser/thr protein phosphatase | 1e-16 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-16 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-15 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-14 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 6e-14 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-13 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-10 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-08 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.001 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.002 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.004 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 8e-16 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 9e-16 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 2e-15 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 3e-14 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 3e-14 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 5e-13 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 5e-06 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 1e-12 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 8e-11 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 4e-07 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 1e-06 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 6e-06 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 9e-05 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 3e-09 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 4e-05 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 5e-09 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 4e-06 | |
| d1nnwa_ | 251 | d.159.1.5 (A:) Hypothetical protein PF1291 {Archae | 2e-08 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 9e-08 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 6e-06 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 3e-05 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 1e-04 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 4e-04 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 2e-07 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 2e-07 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 1e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 2e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 2e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 3e-07 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 4e-06 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 1e-05 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 1e-06 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 1e-04 | |
| d1tjca_ | 95 | a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni | 3e-06 | |
| d1nzna_ | 122 | a.118.8.1 (A:) Mitochondria fission protein Fis1 { | 2e-04 | |
| d1su1a_ | 184 | d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia | 0.001 | |
| d1ouva_ | 265 | a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He | 0.002 |
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Serine/threonine protein phosphatase 5, PP5 species: Human (Homo sapiens) [TaxId: 9606]
Score = 318 bits (815), Expect = e-107
Identities = 160/279 (57%), Positives = 205/279 (73%), Gaps = 16/279 (5%)
Query: 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGK 222
YSG ++E +T+ F+K++M +K+QK LH++ A+QI++Q +E+L L +LV+ + + +
Sbjct: 1 YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETE 60
Query: 223 HFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPS 282
TVCGD HGQFYDLLNIFELNGLPSE NPY+FNGDFVDRGSFSVEVILTLF FK + P
Sbjct: 61 KITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPD 120
Query: 283 AIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVFCCLPLAHVLNQKVFVVHGGL 342
+L RGNHE+ +MN+IYGFEGEV++K + ELF+EVF LPLA +N KV ++HGGL
Sbjct: 121 HFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGL 180
Query: 343 FSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVG------------ 390
FS DGV L DI+ I+R +PP+ G MC+LLWSDPQP GR SKRGV
Sbjct: 181 FSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL 240
Query: 391 ----LSFVVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQ 425
L +++RSHEVK EGYE+ H G+ +TVFSAPNYCDQ
Sbjct: 241 EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQ 279
|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 | Back information, alignment and structure |
|---|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 429 | |||
| d1s95a_ | 324 | Serine/threonine protein phosphatase 5, PP5 {Human | 100.0 | |
| d1jk7a_ | 294 | Protein phosphatase-1 (PP-1) {Human (Homo sapiens) | 100.0 | |
| d3c5wc1 | 288 | Protein phosphatase 2A catalytic subunit alpha iso | 100.0 | |
| d1auia_ | 473 | Protein phosphatase-2B (PP-2B, calcineurin A subun | 100.0 | |
| d1g5ba_ | 219 | lambda ser/thr protein phosphatase {Bacteriophage | 99.88 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.83 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.72 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.71 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.71 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.7 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.7 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.66 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.66 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.66 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.65 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.62 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.62 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.61 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.61 | |
| d1nnwa_ | 251 | Hypothetical protein PF1291 {Archaeon Pyrococcus f | 99.59 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.58 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.56 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.56 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.52 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.47 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.43 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.43 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.4 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.39 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.34 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.33 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.25 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.25 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.17 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.15 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.15 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.1 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.09 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.09 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 99.04 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.04 | |
| d1uf3a_ | 228 | Hypothetical protein TT1561 {Thermus thermophilus | 98.99 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.97 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.88 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.83 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.82 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.81 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.64 | |
| d1su1a_ | 184 | Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 | 98.64 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.5 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.43 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.43 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.38 | |
| d1s3la_ | 165 | Putative phosphodiesterase MJ0936 {Methanococcus j | 98.35 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.3 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.12 | |
| d3ck2a1 | 173 | Uncharacterized protein SP1879 {Streptococcus pneu | 98.04 | |
| d2a22a1 | 193 | Vacuolar protein sorting 29, VPS29 {Cryptosporidiu | 97.99 | |
| d1z2wa1 | 182 | Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus | 97.96 | |
| d2yvta1 | 257 | Uncharacterized protein Aq_1956 {Aquifex aeolicus | 97.9 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.72 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.66 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.62 | |
| d1xm7a_ | 188 | Hypothetical protein aq_1666 {Aquifex aeolicus [Ta | 97.22 | |
| d3d03a1 | 271 | Glycerophosphodiesterase GpdQ {Enterobacter aeroge | 96.96 | |
| d1ii7a_ | 333 | Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.76 | |
| d2hy1a1 | 256 | Rv0805 cyclic nucleotide phosphodiesterase {Mycoba | 96.45 | |
| d2nxfa1 | 320 | Uncharacterized C17orf48 homolog zgc:64213 {Zebraf | 95.45 | |
| d2qfra2 | 312 | Plant purple acid phosphatase, catalytic domain {K | 94.52 | |
| d1utea_ | 302 | Mammalian purple acid phosphatase {Pig (Sus scrofa | 91.99 |
| >d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Protein serine/threonine phosphatase domain: Serine/threonine protein phosphatase 5, PP5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=9.8e-74 Score=527.58 Aligned_cols=267 Identities=60% Similarity=1.065 Sum_probs=255.3
Q ss_pred CCCCcccCCCCCHHHHHHHHHHhhcccCCcHHHHHHHHHHHHHHHhhCCCeeeecCCCCCceEEEccCCCCHHHHHHHHH
Q 014212 163 YSGARIEGDVITLDFVKKMMDDFKNQKCLHKRYAFQIVLQTREMLRALPSLVDIDIPDGKHFTVCGDVHGQFYDLLNIFE 242 (429)
Q Consensus 163 ~~~~~~~~~~l~~~~l~~li~~l~~~~~l~~~~~~~ll~~a~~~l~~~p~~~~~~~~~~~~~~v~GDihG~~~~l~~~l~ 242 (429)
|.++++....++.+.++.+++.++....++.+++.+++.+++++|+++|+++++......++.||||+||++.||.++|+
T Consensus 1 ~~gp~~~~~~~t~~~~~~li~~~~~~~~l~~~~~~~ll~~~~~il~~e~~l~~i~~~~~~pv~VvGDiHGq~~DL~~if~ 80 (324)
T d1s95a_ 1 YSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFE 80 (324)
T ss_dssp CCSSCCBTTBCCHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCTTCEEEEECCCTTCHHHHHHHHH
T ss_pred CCCCcCCCCCcCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHhCCCeEEeecCCCCCEEEEEECCCCHHHHHHHHH
Confidence 45777776669999999999999999999999999999999999999999999987666789999999999999999999
Q ss_pred HcCCCCCCCCeEEccccccCCCCcHHHHHHHHHhhhhCCCeEEEecCCcccccchhhccchhhhhcccchHHHHHHHHHh
Q 014212 243 LNGLPSEENPYLFNGDFVDRGSFSVEVILTLFAFKCMCPSAIYLSRGNHESKSMNKIYGFEGEVRSKLSETFVELFAEVF 322 (429)
Q Consensus 243 ~~~~~~~~~~~~~lGD~vdrG~~s~e~~~~l~~lk~~~p~~~~~lrGNhe~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 322 (429)
..|+|+.+.+|+|||||||||++|+||+.+|++||+.+|++|++||||||++.++..|||.+|+..+|+.++|+.++++|
T Consensus 81 ~~g~p~~~~~ylFLGDYVDRG~~slEvi~lL~~lKi~yP~~v~LLRGNHE~~~~n~~ygF~~e~~~k~~~~l~~~~~~~F 160 (324)
T d1s95a_ 81 LNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVF 160 (324)
T ss_dssp HHCCCBTTBCEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCHHHHHHHHHHH
T ss_pred HCCCCCCCCeEEEecccccCcCcceeehHHHHHHHHhCCCcEEeccCCccccccccccccchHhhhhcCHHHHHHHHHHH
Confidence 99999887779999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCcccceecCeEEEEecCccCCCCCCccccccccCCCCCCCCCcccccccCCCCCCCCCCCCCCCCcEEE---------
Q 014212 323 CCLPLAHVLNQKVFVVHGGLFSVDGVKLSDIKTIDRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSF--------- 393 (429)
Q Consensus 323 ~~lp~~~~~~~~~~~vH~gi~~~~~~~~~~i~~~~r~~~~~~~~~~~~~lw~dp~~~~~~~~~~~~~~~~~--------- 393 (429)
++||+||+|++++||||||||++...++++|++++|+.+++++++++|+|||||....++.++.||.|+.|
T Consensus 161 ~~LPlaa~I~~~ilcvHGGi~~~~~~~l~~i~~i~r~~~~~~~~~~~dlLWSDP~~~~~~~~~~Rg~g~~FG~~~~~~Fl 240 (324)
T d1s95a_ 161 EWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFL 240 (324)
T ss_dssp TTSCSEEEETTTEEECSSCCCSSSCCCHHHHHTCCCSSSCCSSSHHHHHHHCEECSSSSEEECTTSSSEEECHHHHHHHH
T ss_pred hhcchhhhccCcEEEecCCcCccccCCHHHHHhccCCCCCcchhhhhhhhccCccccCCcCcCCCCCcCCcCHHHHHHHH
Confidence 99999999999999999999667789999999999999999999999999999998888999999999999
Q ss_pred -------EEeeccccccCceeecCCeEEEEcCCCCCCCcCCCC
Q 014212 394 -------VVRSHEVKDEGYEIEHDGKLITVFSAPNYCDQVTKL 429 (429)
Q Consensus 394 -------iir~h~~~~~g~~~~~~~~~~t~fs~~~y~~~~~n~ 429 (429)
||||||++++||++.++++||||||||||||.++|+
T Consensus 241 ~~n~l~lIIR~He~v~~G~~~~~~~kviTvFSa~nY~~~~~N~ 283 (324)
T d1s95a_ 241 EENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNK 283 (324)
T ss_dssp HHHTCCEEEECCSCCTTSEEEEGGGTEEEECCCSSGGGTSCCC
T ss_pred HHcCCcEEEEcCccccCceEEecCCcEEEEeCCCccCCCCCcc
Confidence 999999999999999999999999999999999985
|
| >d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} | Back information, alignment and structure |
|---|
| >d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|