Citrus Sinensis ID: 014317
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 427 | ||||||
| 449440973 | 475 | PREDICTED: putative FBD-associated F-box | 0.878 | 0.789 | 0.357 | 2e-56 | |
| 255544812 | 464 | ubiquitin-protein ligase, putative [Rici | 0.871 | 0.801 | 0.370 | 6e-56 | |
| 255540581 | 457 | ubiquitin-protein ligase, putative [Rici | 0.918 | 0.857 | 0.363 | 6e-55 | |
| 302142991 | 402 | unnamed protein product [Vitis vinifera] | 0.768 | 0.815 | 0.356 | 5e-45 | |
| 357477131 | 447 | F-box family-6 [Medicago truncatula] gi| | 0.875 | 0.836 | 0.337 | 1e-44 | |
| 147865783 | 1789 | hypothetical protein VITISV_020815 [Viti | 0.880 | 0.210 | 0.303 | 9e-38 | |
| 297736820 | 487 | unnamed protein product [Vitis vinifera] | 0.875 | 0.767 | 0.304 | 1e-37 | |
| 357155585 | 449 | PREDICTED: LOW QUALITY PROTEIN: putative | 0.871 | 0.828 | 0.277 | 5e-34 | |
| 356544606 | 444 | PREDICTED: putative F-box protein At3g58 | 0.946 | 0.909 | 0.292 | 1e-32 | |
| 357119372 | 497 | PREDICTED: uncharacterized protein LOC10 | 0.880 | 0.756 | 0.252 | 1e-29 |
| >gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 226 bits (576), Expect = 2e-56, Method: Compositional matrix adjust.
Identities = 142/397 (35%), Positives = 222/397 (55%), Gaps = 22/397 (5%)
Query: 12 SEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFG- 70
S D I+ LP DILV I+S L LKEAARTS LS++WR LW+F L FDA + L ++ F
Sbjct: 43 SVDSISHLPQDILVFILSLLPLKEAARTSTLSHKWRCLWSFIPCLNFDAHKKLLDLQFTD 102
Query: 71 -NLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKL 129
NL+ ER +++ WVN V++ ++GS + ++RF+L Q D+ WV + +++ +L
Sbjct: 103 ENLKSERRQFVKWVNRVIDSYKGSNLETLRIRFNLDSSFQCDVDRWVQFAMQWKLKMFEL 162
Query: 130 DLW---------PGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELF 180
+L P + PKE + S L+ L VNV G+ +E F
Sbjct: 163 NLSDSYDSGIYSPCSFPQLSDGPKENFPRF----MFSNSSSLKTLKLIAVNVGGEALECF 218
Query: 181 IQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQA 240
+ N PLL+ L V++S L+ LRV+G+S++L+ LE+ C +E +E+SAP+L SF+Y G
Sbjct: 219 LTNSPLLEILVVEYSHCLLSLRVVGASLKLRQLEVCMCNYLESLEVSAPNLESFKYVGPW 278
Query: 241 IKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEV-YMQFSLFE-- 297
+ + ++N P+L++ + + S QL+ L LD EV +M+ F
Sbjct: 279 LSMPLKNTPKLLETYFGSEFGVEIIDHFFLLSSYSSQLQKLILDL--EVDFMENQGFRKW 336
Query: 298 --LPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSH 355
L L +L+L V SL+G T ++KA P L K L+L+ + ++ K+ H
Sbjct: 337 PILANLKELKLIVIAEGHSSLIGFTSLIKASPSLLKFTLKLDYLDMFEQRPLRKVKKFPH 396
Query: 356 QHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIE 392
Q++KVVEL GF+G+ D+EL QY +NA LE++I +
Sbjct: 397 QYIKVVELAGFVGKPIDLELVQYFHKNAVALEEIIFD 433
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357155585|ref|XP_003577168.1| PREDICTED: LOW QUALITY PROTEIN: putative F-box/LRR-repeat protein At5g54820-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357119372|ref|XP_003561416.1| PREDICTED: uncharacterized protein LOC100838353 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 427 | ||||||
| TAIR|locus:2157922 | 444 | AT5G53840 "AT5G53840" [Arabido | 0.918 | 0.882 | 0.248 | 2.2e-19 | |
| TAIR|locus:2122754 | 409 | AT4G10400 "AT4G10400" [Arabido | 0.824 | 0.860 | 0.276 | 5.3e-18 | |
| TAIR|locus:2008276 | 435 | AT1G51370 "AT1G51370" [Arabido | 0.889 | 0.873 | 0.242 | 9e-18 | |
| TAIR|locus:2026761 | 451 | AT1G69630 [Arabidopsis thalian | 0.564 | 0.534 | 0.274 | 1.2e-17 | |
| TAIR|locus:2159803 | 410 | AT5G38590 "AT5G38590" [Arabido | 0.894 | 0.931 | 0.259 | 3.5e-17 | |
| TAIR|locus:2085013 | 532 | AT3G42770 "AT3G42770" [Arabido | 0.306 | 0.246 | 0.326 | 1.9e-15 | |
| TAIR|locus:2099019 | 457 | AT3G58860 "AT3G58860" [Arabido | 0.730 | 0.682 | 0.245 | 4.8e-15 | |
| TAIR|locus:2052351 | 737 | AT2G42730 [Arabidopsis thalian | 0.529 | 0.306 | 0.287 | 4.9e-15 | |
| TAIR|locus:2162499 | 443 | AT5G22670 "AT5G22670" [Arabido | 0.545 | 0.525 | 0.279 | 1e-14 | |
| TAIR|locus:2162454 | 437 | AT5G22700 "AT5G22700" [Arabido | 0.543 | 0.530 | 0.258 | 1.1e-14 |
| TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 254 (94.5 bits), Expect = 2.2e-19, P = 2.2e-19
Identities = 111/446 (24%), Positives = 213/446 (47%)
Query: 13 EDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNL 72
E+ +++LPD ++ I+SHL+ K+A RTS+LS RWRNLW L+FD+ E
Sbjct: 17 EERLSQLPDHLICVILSHLSTKDAVRTSILSTRWRNLWQLVPVLDFDSREL--------- 67
Query: 73 EQERSKYINWVNNVLELHRGSTINEFKVR-FDLCDFHQSDITNWVYTVLGKRVQYIKLDL 131
+ S+++++ + LH+ S I + +V +DL + +T+W+ V R+Q+I + +
Sbjct: 68 -RSFSEFVSFAGSFFYLHKDSYIQKLRVCIYDLAGNYY--LTSWIDLVTRHRIQHIDISV 124
Query: 132 WPGRYGHYYTFPKEFYNS-----IESGR-GLSGIKF-----LRCLHFKTVN-VNGKDIEL 179
+ + P Y ++ R + ++F L+ L VN N ++
Sbjct: 125 FT--CSGFGVIPLSLYTCDTLVHLKLSRVTMVNVEFVSLPCLKILDLDFVNFTNETTLDK 182
Query: 180 FIQNCPLLDRLC-VDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEE-IEISAPSL--LSFR 235
I P+L+ L V S+ V++ + S LK +EI + + I P L LS +
Sbjct: 183 IISCSPVLEELTIVKSSEDNVKIIQVRSQT-LKRVEIHRRFDRHNGLVIDTPLLQFLSIK 241
Query: 236 YYG-QAIK-INIENVPQL-VDVSIRGSHTFRVTYFVGPIISCFPQLKTLEL--DSCNEV- 289
+ ++I+ IN+ ++ +DV++ + + ++++L + + ++
Sbjct: 242 AHSIKSIEFINLGFTTKVDIDVNLLDPNDLSNRSMTRDFFTTISRVRSLVIRHGTIKDIF 301
Query: 290 -YMQFS-LFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKR 347
YM+ L + L +L + N E LL L +K+CP L+ L L+L D+ + KK
Sbjct: 302 HYMELEPLQQFCYLSELSAVCSISNLEMLLNL---LKSCPKLESLSLKLVDYEKN--KKE 356
Query: 348 QQF-----PKYSHQHLKVVELHG-FLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKV 401
+ P LK V+L LG ++++A+Y +N+T+LEKL ++ + +
Sbjct: 357 EVMSSTVPPPCLVSSLKFVKLESQLLGCGTELKVARYFLENSTILEKLTLKIDYMYKDEA 416
Query: 402 LRNCVKMLEAKVPH---SVKLIVGSL 424
N ++ VP + ++++ SL
Sbjct: 417 NVNHIRQTLHAVPRCSSTCEVVIHSL 442
|
|
| TAIR|locus:2122754 AT4G10400 "AT4G10400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008276 AT1G51370 "AT1G51370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159803 AT5G38590 "AT5G38590" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085013 AT3G42770 "AT3G42770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052351 AT2G42730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162454 AT5G22700 "AT5G22700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 427 | |||
| pfam08387 | 51 | pfam08387, FBD, FBD | 1e-06 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 1e-05 | |
| smart00256 | 41 | smart00256, FBOX, A Receptor for Ubiquitination Ta | 0.004 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 0.004 | |
| smart00579 | 72 | smart00579, FBD, domain in FBox and BRCT domain co | 0.004 |
| >gnl|CDD|203925 pfam08387, FBD, FBD | Back alignment and domain information |
|---|
Score = 44.8 bits (107), Expect = 1e-06
Identities = 15/41 (36%), Positives = 27/41 (65%)
Query: 351 PKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLII 391
P+ L+ VE G+ G + ++ELA+Y+ +NA +L+K+ I
Sbjct: 9 PECLLSSLETVEWRGYRGEEEELELAKYILENARVLKKMTI 49
|
This region is found in F-box (pfam00646) and other domain containing plant proteins; it is repeated in two family members. Its precise function is unknown, but it is thought to be associated with nuclear processes. In fact, several family members are annotated as being similar to transcription factors. Length = 51 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
| >gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 427 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.68 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.67 | |
| PF08387 | 51 | FBD: FBD; InterPro: IPR013596 This region is found | 98.85 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.76 | |
| smart00579 | 72 | FBD domain in FBox and BRCT domain containing plan | 98.68 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.54 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.46 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.4 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.35 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.33 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.3 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.28 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.27 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.24 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.11 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.08 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.05 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.95 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.93 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.8 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.32 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.22 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.08 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.07 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.94 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.83 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.81 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.79 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.72 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.72 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.71 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.71 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.51 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.31 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.29 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.12 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.63 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.15 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.1 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.03 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.88 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.42 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.31 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 93.95 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 93.67 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 93.28 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 93.05 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 93.03 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 92.79 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 92.74 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 91.25 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 90.41 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 90.4 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 90.11 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 89.88 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 89.71 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 89.33 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 88.87 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 88.75 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 88.04 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 87.82 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 87.69 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 86.73 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 86.19 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 85.97 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 83.09 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 82.96 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 82.26 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 80.89 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 80.47 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 80.32 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.68 E-value=5e-18 Score=149.36 Aligned_cols=275 Identities=20% Similarity=0.260 Sum_probs=155.3
Q ss_pred CCCCChHHHHHHHhcCChHHHHHHhhhhhhhhhhcccCc---eeeEecCccccccCCCCchhhHHHHHHHHHHHHHhccC
Q 014317 16 INRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTN---SLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRG 92 (427)
Q Consensus 16 is~LPd~iL~~Ils~L~~~d~~r~s~vskrW~~lw~~~~---~L~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~ 92 (427)
|+.|||||+..||+.|+.+|..+.+.|||||.++-+.-. .+++..+.+. . ....+.+. +|
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~-----------p----~~l~~l~~--rg 160 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIH-----------P----DVLGRLLS--RG 160 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccC-----------h----hHHHHHHh--CC
Confidence 899999999999999999999999999999998633211 1333333222 2 22223322 24
Q ss_pred CCeeEEEEEEecCCCCCccHHHHHHHHhcCCceEEEEEecCCCCCccccccccccccccCCCCCCCCCCCcEEEEeeEEe
Q 014317 93 STINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNV 172 (427)
Q Consensus 93 ~~l~~l~l~~~~~~~~~~~~~~wl~~~~~~~v~~L~l~~~~~~~~~~~~lp~~~~~~l~lp~~~~~~~~L~~L~L~~~~~ 172 (427)
|..+++.-...+ + ..+... ....+..+++++++....... .+- .+ ...|..||.|.|.+.++
T Consensus 161 --V~v~Rlar~~~~-~-prlae~-~~~frsRlq~lDLS~s~it~s---tl~-~i---------Ls~C~kLk~lSlEg~~L 222 (419)
T KOG2120|consen 161 --VIVFRLARSFMD-Q-PRLAEH-FSPFRSRLQHLDLSNSVITVS---TLH-GI---------LSQCSKLKNLSLEGLRL 222 (419)
T ss_pred --eEEEEcchhhhc-C-chhhhh-hhhhhhhhHHhhcchhheeHH---HHH-HH---------HHHHHhhhhcccccccc
Confidence 555554311111 1 111111 122345678888876521110 000 01 24678899999998888
Q ss_pred ChhhHHHHHhcCCccceeeeccCCCceeEE---EecCccccceEEEEecCCccEEE-----EECCceeEEEEeeeeeee-
Q 014317 173 NGKDIELFIQNCPLLDRLCVDHSKTLVRLR---VIGSSIQLKYLEIQSCYLMEEIE-----ISAPSLLSFRYYGQAIKI- 243 (427)
Q Consensus 173 ~~~~l~~ll~~cp~Le~L~l~~c~~~~~l~---i~~~~~~L~~L~l~~c~~l~~~~-----i~~p~L~~L~~~~~~~~~- 243 (427)
.|.-... ++.-..|++|+|.+|.|+..-. +-.+|++|..|.+++|....+.+ -..|+|..|.++|+.-.+
T Consensus 223 dD~I~~~-iAkN~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~ 301 (419)
T KOG2120|consen 223 DDPIVNT-IAKNSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQ 301 (419)
T ss_pred CcHHHHH-HhccccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhh
Confidence 7763333 5566889999999998876422 22367889999999887544321 124788888887763221
Q ss_pred ------eccCCcccceeeeeeccccccchhhccccccCCCceEEEEeccceee--cccccCCCCceeEEEEEEEccCCCC
Q 014317 244 ------NIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVY--MQFSLFELPKLIDLRLRVTTPNRES 315 (427)
Q Consensus 244 ------~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~--~~~~~~~~~~L~~L~l~~~~~~~~~ 315 (427)
....+|+|.+++++.+-. +.......+..++.|+.|.++.|..+. ..-.+...|.|++|++... . .
T Consensus 302 ~sh~~tL~~rcp~l~~LDLSD~v~--l~~~~~~~~~kf~~L~~lSlsRCY~i~p~~~~~l~s~psl~yLdv~g~--v--s 375 (419)
T KOG2120|consen 302 KSHLSTLVRRCPNLVHLDLSDSVM--LKNDCFQEFFKFNYLQHLSLSRCYDIIPETLLELNSKPSLVYLDVFGC--V--S 375 (419)
T ss_pred hhHHHHHHHhCCceeeeccccccc--cCchHHHHHHhcchheeeehhhhcCCChHHeeeeccCcceEEEEeccc--c--C
Confidence 123466666666654432 112222333466666666666665554 2222345566666665221 1 1
Q ss_pred hHHHHHHHHhCCCccEE
Q 014317 316 LLGLTCIMKACPFLQKL 332 (427)
Q Consensus 316 ~~~l~~ll~~~p~L~~L 332 (427)
...+.-+.+.||+|+.-
T Consensus 376 dt~mel~~e~~~~lkin 392 (419)
T KOG2120|consen 376 DTTMELLKEMLSHLKIN 392 (419)
T ss_pred chHHHHHHHhCcccccc
Confidence 12234455566665543
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >smart00579 FBD domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 427 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 2e-05 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 54.5 bits (131), Expect = 2e-08
Identities = 63/365 (17%), Positives = 112/365 (30%), Gaps = 69/365 (18%)
Query: 8 KEEISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNV 67
+E + LPD++L+ I S L L E + S + RW L + ESLW
Sbjct: 1 RENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRL---------ASDESLW-- 49
Query: 68 GFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYI 127
+ + R + R + +
Sbjct: 50 -------QTLDLTGKNLHPDVTGRLLSQGVIAFRCPRS------FMDQPLAEHFSPFRVQ 96
Query: 128 KLDLWPGRYGHYYTFPKEFYNSIESGRGLSGI----KFLRCLHFKTVNVNGKDIELFIQN 183
+DL NS+ L GI L+ L + + ++ + +
Sbjct: 97 HMDLS---------------NSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT-LAK 140
Query: 184 CPLLDRLCVDHSK--TLVRLRVIGSSI-QLKYLEIQSCYLMEEIEISA------PSLLSF 234
L RL + + L+ + SS +L L + C+ E + ++
Sbjct: 141 NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQL 200
Query: 235 RYYG-------QAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCN 287
G + + P LV + + S + L+ L L C
Sbjct: 201 NLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSV--MLKNDCFQEFFQLNYLQHLSLSRCY 258
Query: 288 EVYMQ--FSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRR-LG 344
++ + L E+P L L++ P+ L + +A P LQ R +G
Sbjct: 259 DIIPETLLELGEIPTLKTLQVFGIVPDG----TLQLLKEALPHLQINCSHFTTIARPTIG 314
Query: 345 KKRQQ 349
K+ Q
Sbjct: 315 NKKNQ 319
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 427 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.85 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.85 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.76 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.98 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.91 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.87 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.81 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.81 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.79 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.75 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.7 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.68 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.67 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.65 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.64 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.63 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.63 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.62 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.61 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.6 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.58 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.58 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.56 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.55 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.54 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.53 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.52 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.52 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.51 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.51 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.5 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.5 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.5 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.5 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.48 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.47 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.47 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.47 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.46 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.46 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.45 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.45 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.45 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.44 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.44 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.42 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.41 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.41 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.41 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.4 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.4 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.4 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.37 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.35 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.34 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.33 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.32 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.3 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.3 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.29 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.28 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.28 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.27 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.26 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.25 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.24 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.24 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.24 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.24 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.24 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.23 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.21 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.19 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.18 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.17 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.15 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.14 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.14 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.12 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.09 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.07 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.03 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.02 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.01 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.0 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 97.98 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.97 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.97 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.96 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.94 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.91 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.9 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.87 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.83 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.82 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.8 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.77 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.74 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.71 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.69 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.64 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.61 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.6 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.56 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.55 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.54 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.53 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.52 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.5 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.47 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.45 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.37 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.35 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.31 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.27 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.2 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.18 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.18 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.01 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.94 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.88 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.82 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.75 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.63 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.62 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.36 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.29 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.27 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.09 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.09 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.99 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 95.95 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.76 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.66 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 95.63 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.62 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 95.48 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 95.39 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 95.28 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.07 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 94.68 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.65 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 92.69 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 92.67 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 90.93 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 90.54 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 90.07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 86.11 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 81.89 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 80.19 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.85 E-value=3.3e-21 Score=196.83 Aligned_cols=153 Identities=11% Similarity=0.201 Sum_probs=95.3
Q ss_pred CCCcCCCCChHHHHHHHhcCC-hHHHHHHhhhhhhhhhhccc-CceeeEecCccccccCCCCchhhHHHHHHHHHHHHHh
Q 014317 12 SEDLINRLPDDILVNIISHLT-LKEAARTSVLSNRWRNLWTF-TNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLEL 89 (427)
Q Consensus 12 ~~D~is~LPd~iL~~Ils~L~-~~d~~r~s~vskrW~~lw~~-~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~ 89 (427)
..|+|+.|||||+.+||+||| ++|++++++|||||+++... ...+.+...... ... ..+.+
T Consensus 2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~----------~~~-------~~~~~ 64 (594)
T 2p1m_B 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAV----------SPA-------TVIRR 64 (594)
T ss_dssp --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSS----------CHH-------HHHHH
T ss_pred cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeecccccc----------CHH-------HHHhh
Confidence 358999999999999999999 99999999999999988221 112333322110 010 22222
Q ss_pred ccCCCeeEEEEEEecC--------CCCCccHHHHHHHHhc--CCceEEEEEecCCCCCccccccccccccccCCCCCCCC
Q 014317 90 HRGSTINEFKVRFDLC--------DFHQSDITNWVYTVLG--KRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGI 159 (427)
Q Consensus 90 ~~~~~l~~l~l~~~~~--------~~~~~~~~~wl~~~~~--~~v~~L~l~~~~~~~~~~~~lp~~~~~~l~lp~~~~~~ 159 (427)
-+.++++.+..... ......+..|+..... +++++|++..+... ...+..+ ...+
T Consensus 65 --~~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~----~~~~~~l---------~~~~ 129 (594)
T 2p1m_B 65 --FPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVT----DDCLELI---------AKSF 129 (594)
T ss_dssp --CTTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCC----HHHHHHH---------HHHC
T ss_pred --CCCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEc----HHHHHHH---------HHhC
Confidence 23489998876321 1112456778887653 58999999865321 0111111 1257
Q ss_pred CCCcEEEEeeE-EeChhhHHHHHhcCCccceeeeccCC
Q 014317 160 KFLRCLHFKTV-NVNGKDIELFIQNCPLLDRLCVDHSK 196 (427)
Q Consensus 160 ~~L~~L~L~~~-~~~~~~l~~ll~~cp~Le~L~l~~c~ 196 (427)
++|++|+|.+| .+++..+..++..||+|++|++.+|.
T Consensus 130 ~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~ 167 (594)
T 2p1m_B 130 KNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD 167 (594)
T ss_dssp TTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE
T ss_pred CCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc
Confidence 89999999988 57777788888889999999998775
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 427 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 1e-06 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 2e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 9e-05 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 44.6 bits (105), Expect = 1e-06
Identities = 12/43 (27%), Positives = 22/43 (51%)
Query: 14 DLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSL 56
DLI LP +I + I ++L ++ + +S W + + SL
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSL 46
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 427 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.13 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.11 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.06 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.72 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.69 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.29 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.27 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.18 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.17 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.14 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.11 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.11 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.0 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.97 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.86 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.71 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.69 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.68 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.67 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.67 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.61 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.53 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.46 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.37 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.28 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.07 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.02 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.69 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.65 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.42 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.06 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.0 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.86 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.73 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.69 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.64 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 95.62 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.49 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.35 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.18 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.15 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 92.41 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 88.77 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 88.74 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 84.41 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.13 E-value=1.1e-12 Score=118.65 Aligned_cols=64 Identities=9% Similarity=0.185 Sum_probs=42.2
Q ss_pred CCCCCcEEEEeeEEeChhhHHHHHhcCCccceeeeccCCCce-eEEEecCccccceEEEEecCCc
Q 014317 158 GIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLV-RLRVIGSSIQLKYLEIQSCYLM 221 (427)
Q Consensus 158 ~~~~L~~L~L~~~~~~~~~l~~ll~~cp~Le~L~l~~c~~~~-~l~i~~~~~~L~~L~l~~c~~l 221 (427)
...+|++|+|+++.+.++.+..+++.||+|++|.+.+|...+ .+..-+.+++|++|.+++|..+
T Consensus 44 ~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~i 108 (284)
T d2astb2 44 SPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGF 108 (284)
T ss_dssp CCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSC
T ss_pred cCCCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccc
Confidence 345788888888777777777788888888888888774221 1111123467777777776554
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|