Citrus Sinensis ID: 014317


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------
MTKRTRHKEEISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLYTD
ccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEccccHHHHHHccccccEEEEEEcccccEEEEEEccccEEEEEEEEcccccEEEEEcccEEEEEEEEEEEEEEEcccccEEEEEEEccccccccccccccccccccccEEEEEcccEEEEEcccccccEEEEEEEEEEccccccHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccEEEEEEEEccHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHccccccEEEEEcccccc
cccccccccccccccHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccHEEEcccccccccccHcHEEEEEEEEEEccHHHHHHHHcccHHHEEEEEEcccccEEEEEEEccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEcccccEEEEEEcccccccHHHHHHHHHHccccEEEEEcccccEHcccccccccHHHHEEEEEEccccccHHHHHHHHHccccccEEEEEccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHcHHHEEEEEEccccccHHHHHHHHHHHcccccccEEEEEEEEccc
mtkrtrhkeEISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNslefdaseslwnvgfgnleQERSKYINWVNNVLELHRGSTINEFKVRFDlcdfhqsditnWVYTVLGKRVQYikldlwpgryghyytfpkefynsiesgrglsgikflrCLHFKTVNVNGKDIELFIQncplldrlcvdhsktLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYfvgpiiscfpqlktleldscNEVYMQfslfelpklidlrlrvttpnreslLGLTCIMKACPFLQKLILQLNDHGrrlgkkrqqfpkyshqHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLYTD
mtkrtrhkeeisedlinrlpddILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLfelpklidlRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEkliiepsryvRKKVLRNCVKmleakvphsvklivgslytd
MTKRTRHKEEISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLYTD
**************LINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLY**
*****************RLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKV***************VKLIVGSLY**
***********SEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLYTD
*************DLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLYTD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKRTRHKEEISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVYMQFSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKVLRNCVKMLEAKVPHSVKLIVGSLYTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query427 2.2.26 [Sep-21-2011]
Q0WR05457 F-box/LRR-repeat protein no no 0.522 0.487 0.290 1e-17
Q9FFW2410 FBD-associated F-box prot no no 0.885 0.921 0.253 5e-17
Q9FWZ1451 F-box/LRR-repeat protein no no 0.899 0.851 0.243 6e-17
Q9SV82409 FBD-associated F-box prot no no 0.829 0.865 0.265 7e-17
Q9FGQ3444 F-box/FBD/LRR-repeat prot no no 0.882 0.849 0.242 2e-16
Q6DBN6435 F-box/FBD/LRR-repeat prot no no 0.850 0.834 0.239 2e-15
Q9LXR4454 Putative F-box/LRR-repeat no no 0.393 0.370 0.345 1e-14
Q9ZV94452 Putative F-box/FBD/LRR-re no no 0.810 0.765 0.214 3e-14
Q9ZV93458 F-box/FBD/LRR-repeat prot no no 0.913 0.851 0.237 4e-14
Q9C8Y6442 FBD-associated F-box prot no no 0.880 0.850 0.254 4e-14
>sp|Q0WR05|FBL39_ARATH F-box/LRR-repeat protein At2g42730 OS=Arabidopsis thaliana GN=At2g42730 PE=2 SV=1 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 124/244 (50%), Gaps = 21/244 (8%)

Query: 12  SEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGN 71
           ++D+I+RLPD++L  I+S ++ KEA  TSVLS RW+N++   ++L+ D  +S+       
Sbjct: 3   AKDVISRLPDEVLGRILSLISTKEAVSTSVLSKRWKNMFVLVSNLDIDDRQSVPKTKQNR 62

Query: 72  LEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSD---ITNWVYTVLGKRVQYIK 128
           +E  R+ Y+ +V+ +L+  RGS+I +  ++  +     +D   I +W+  VL   V  + 
Sbjct: 63  IEIHRN-YMAFVDKLLDTQRGSSIKKLTLKSHVGVRGGTDSSRIQSWICNVLDHGV--MD 119

Query: 129 LDLWPGRYGHYYTFPKEFYNS-----IESGRGLS-------GIKFLRCLHFKTVN-VNGK 175
           LD++    G     P   + S     +  GRG +        +  LR L   +VN V G 
Sbjct: 120 LDVFITLKGKSPPVPAMIFKSKTLVKLRVGRGFTIKLSQDVSLPLLRTLCLDSVNFVGGH 179

Query: 176 D-IELFIQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSF 234
           + +   I  CP+L+ L V+  +  V      SS  LK L I+       I + AP+L+ +
Sbjct: 180 NVVGTLISRCPVLEELVVEERRC-VDWTCSVSSPSLKRLHIRFDRKFTSISLDAPNLIYY 238

Query: 235 RYYG 238
           ++ G
Sbjct: 239 KHSG 242





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FFW2|FBD17_ARATH FBD-associated F-box protein At5g38590 OS=Arabidopsis thaliana GN=At5g38590 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWZ1|FBL13_ARATH F-box/LRR-repeat protein 13 OS=Arabidopsis thaliana GN=FBL13 PE=2 SV=1 Back     alignment and function description
>sp|Q9SV82|FBD40_ARATH FBD-associated F-box protein At4g10400 OS=Arabidopsis thaliana GN=At4g10400 PE=2 SV=2 Back     alignment and function description
>sp|Q9FGQ3|FDL37_ARATH F-box/FBD/LRR-repeat protein At5g53840 OS=Arabidopsis thaliana GN=At5g53840 PE=2 SV=1 Back     alignment and function description
>sp|Q6DBN6|FDL6_ARATH F-box/FBD/LRR-repeat protein At1g51370 OS=Arabidopsis thaliana GN=At1g51370 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXR4|FBL56_ARATH Putative F-box/LRR-repeat protein At3g58880 OS=Arabidopsis thaliana GN=At3g58880 PE=4 SV=1 Back     alignment and function description
>sp|Q9ZV94|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760 OS=Arabidopsis thaliana GN=At1g78760 PE=4 SV=1 Back     alignment and function description
>sp|Q9ZV93|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750 OS=Arabidopsis thaliana GN=At1g78750 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8Y6|FBD5_ARATH FBD-associated F-box protein At1g66310 OS=Arabidopsis thaliana GN=At1g66310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query427
449440973475 PREDICTED: putative FBD-associated F-box 0.878 0.789 0.357 2e-56
255544812464 ubiquitin-protein ligase, putative [Rici 0.871 0.801 0.370 6e-56
255540581457 ubiquitin-protein ligase, putative [Rici 0.918 0.857 0.363 6e-55
302142991402 unnamed protein product [Vitis vinifera] 0.768 0.815 0.356 5e-45
357477131447 F-box family-6 [Medicago truncatula] gi| 0.875 0.836 0.337 1e-44
147865783 1789 hypothetical protein VITISV_020815 [Viti 0.880 0.210 0.303 9e-38
297736820487 unnamed protein product [Vitis vinifera] 0.875 0.767 0.304 1e-37
357155585449 PREDICTED: LOW QUALITY PROTEIN: putative 0.871 0.828 0.277 5e-34
356544606444 PREDICTED: putative F-box protein At3g58 0.946 0.909 0.292 1e-32
357119372497 PREDICTED: uncharacterized protein LOC10 0.880 0.756 0.252 1e-29
>gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 142/397 (35%), Positives = 222/397 (55%), Gaps = 22/397 (5%)

Query: 12  SEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFG- 70
           S D I+ LP DILV I+S L LKEAARTS LS++WR LW+F   L FDA + L ++ F  
Sbjct: 43  SVDSISHLPQDILVFILSLLPLKEAARTSTLSHKWRCLWSFIPCLNFDAHKKLLDLQFTD 102

Query: 71  -NLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKL 129
            NL+ ER +++ WVN V++ ++GS +   ++RF+L    Q D+  WV   +  +++  +L
Sbjct: 103 ENLKSERRQFVKWVNRVIDSYKGSNLETLRIRFNLDSSFQCDVDRWVQFAMQWKLKMFEL 162

Query: 130 DLW---------PGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNVNGKDIELF 180
           +L          P  +      PKE +         S    L+ L    VNV G+ +E F
Sbjct: 163 NLSDSYDSGIYSPCSFPQLSDGPKENFPRF----MFSNSSSLKTLKLIAVNVGGEALECF 218

Query: 181 IQNCPLLDRLCVDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEEIEISAPSLLSFRYYGQA 240
           + N PLL+ L V++S  L+ LRV+G+S++L+ LE+  C  +E +E+SAP+L SF+Y G  
Sbjct: 219 LTNSPLLEILVVEYSHCLLSLRVVGASLKLRQLEVCMCNYLESLEVSAPNLESFKYVGPW 278

Query: 241 IKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEV-YMQFSLFE-- 297
           + + ++N P+L++          +      + S   QL+ L LD   EV +M+   F   
Sbjct: 279 LSMPLKNTPKLLETYFGSEFGVEIIDHFFLLSSYSSQLQKLILDL--EVDFMENQGFRKW 336

Query: 298 --LPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKRQQFPKYSH 355
             L  L +L+L V      SL+G T ++KA P L K  L+L+       +  ++  K+ H
Sbjct: 337 PILANLKELKLIVIAEGHSSLIGFTSLIKASPSLLKFTLKLDYLDMFEQRPLRKVKKFPH 396

Query: 356 QHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLIIE 392
           Q++KVVEL GF+G+  D+EL QY  +NA  LE++I +
Sbjct: 397 QYIKVVELAGFVGKPIDLELVQYFHKNAVALEEIIFD 433




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] Back     alignment and taxonomy information
>gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357155585|ref|XP_003577168.1| PREDICTED: LOW QUALITY PROTEIN: putative F-box/LRR-repeat protein At5g54820-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] Back     alignment and taxonomy information
>gi|357119372|ref|XP_003561416.1| PREDICTED: uncharacterized protein LOC100838353 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query427
TAIR|locus:2157922444 AT5G53840 "AT5G53840" [Arabido 0.918 0.882 0.248 2.2e-19
TAIR|locus:2122754409 AT4G10400 "AT4G10400" [Arabido 0.824 0.860 0.276 5.3e-18
TAIR|locus:2008276435 AT1G51370 "AT1G51370" [Arabido 0.889 0.873 0.242 9e-18
TAIR|locus:2026761451 AT1G69630 [Arabidopsis thalian 0.564 0.534 0.274 1.2e-17
TAIR|locus:2159803410 AT5G38590 "AT5G38590" [Arabido 0.894 0.931 0.259 3.5e-17
TAIR|locus:2085013 532 AT3G42770 "AT3G42770" [Arabido 0.306 0.246 0.326 1.9e-15
TAIR|locus:2099019457 AT3G58860 "AT3G58860" [Arabido 0.730 0.682 0.245 4.8e-15
TAIR|locus:2052351 737 AT2G42730 [Arabidopsis thalian 0.529 0.306 0.287 4.9e-15
TAIR|locus:2162499443 AT5G22670 "AT5G22670" [Arabido 0.545 0.525 0.279 1e-14
TAIR|locus:2162454437 AT5G22700 "AT5G22700" [Arabido 0.543 0.530 0.258 1.1e-14
TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 254 (94.5 bits), Expect = 2.2e-19, P = 2.2e-19
 Identities = 111/446 (24%), Positives = 213/446 (47%)

Query:    13 EDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNVGFGNL 72
             E+ +++LPD ++  I+SHL+ K+A RTS+LS RWRNLW     L+FD+ E          
Sbjct:    17 EERLSQLPDHLICVILSHLSTKDAVRTSILSTRWRNLWQLVPVLDFDSREL--------- 67

Query:    73 EQERSKYINWVNNVLELHRGSTINEFKVR-FDLCDFHQSDITNWVYTVLGKRVQYIKLDL 131
              +  S+++++  +   LH+ S I + +V  +DL   +   +T+W+  V   R+Q+I + +
Sbjct:    68 -RSFSEFVSFAGSFFYLHKDSYIQKLRVCIYDLAGNYY--LTSWIDLVTRHRIQHIDISV 124

Query:   132 WPGRYGHYYTFPKEFYNS-----IESGR-GLSGIKF-----LRCLHFKTVN-VNGKDIEL 179
             +      +   P   Y       ++  R  +  ++F     L+ L    VN  N   ++ 
Sbjct:   125 FT--CSGFGVIPLSLYTCDTLVHLKLSRVTMVNVEFVSLPCLKILDLDFVNFTNETTLDK 182

Query:   180 FIQNCPLLDRLC-VDHSKTLVRLRVIGSSIQLKYLEIQSCYLMEE-IEISAPSL--LSFR 235
              I   P+L+ L  V  S+  V++  + S   LK +EI   +     + I  P L  LS +
Sbjct:   183 IISCSPVLEELTIVKSSEDNVKIIQVRSQT-LKRVEIHRRFDRHNGLVIDTPLLQFLSIK 241

Query:   236 YYG-QAIK-INIENVPQL-VDVSIRGSHTFRVTYFVGPIISCFPQLKTLEL--DSCNEV- 289
              +  ++I+ IN+    ++ +DV++   +            +   ++++L +   +  ++ 
Sbjct:   242 AHSIKSIEFINLGFTTKVDIDVNLLDPNDLSNRSMTRDFFTTISRVRSLVIRHGTIKDIF 301

Query:   290 -YMQFS-LFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRRLGKKR 347
              YM+   L +   L +L    +  N E LL L   +K+CP L+ L L+L D+ +   KK 
Sbjct:   302 HYMELEPLQQFCYLSELSAVCSISNLEMLLNL---LKSCPKLESLSLKLVDYEKN--KKE 356

Query:   348 QQF-----PKYSHQHLKVVELHG-FLGRQFDVELAQYLFQNATMLEKLIIEPSRYVRKKV 401
             +       P      LK V+L    LG   ++++A+Y  +N+T+LEKL ++     + + 
Sbjct:   357 EVMSSTVPPPCLVSSLKFVKLESQLLGCGTELKVARYFLENSTILEKLTLKIDYMYKDEA 416

Query:   402 LRNCVKMLEAKVPH---SVKLIVGSL 424
               N ++     VP    + ++++ SL
Sbjct:   417 NVNHIRQTLHAVPRCSSTCEVVIHSL 442




GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
TAIR|locus:2122754 AT4G10400 "AT4G10400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008276 AT1G51370 "AT1G51370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159803 AT5G38590 "AT5G38590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085013 AT3G42770 "AT3G42770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052351 AT2G42730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162454 AT5G22700 "AT5G22700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query427
pfam0838751 pfam08387, FBD, FBD 1e-06
pfam0064648 pfam00646, F-box, F-box domain 1e-05
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 0.004
pfam1293747 pfam12937, F-box-like, F-box-like 0.004
smart0057972 smart00579, FBD, domain in FBox and BRCT domain co 0.004
>gnl|CDD|203925 pfam08387, FBD, FBD Back     alignment and domain information
 Score = 44.8 bits (107), Expect = 1e-06
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 351 PKYSHQHLKVVELHGFLGRQFDVELAQYLFQNATMLEKLII 391
           P+     L+ VE  G+ G + ++ELA+Y+ +NA +L+K+ I
Sbjct: 9   PECLLSSLETVEWRGYRGEEEELELAKYILENARVLKKMTI 49


This region is found in F-box (pfam00646) and other domain containing plant proteins; it is repeated in two family members. Its precise function is unknown, but it is thought to be associated with nuclear processes. In fact, several family members are annotated as being similar to transcription factors. Length = 51

>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 427
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.68
KOG4341483 consensus F-box protein containing LRR [General fu 99.67
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 98.85
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.76
smart0057972 FBD domain in FBox and BRCT domain containing plan 98.68
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.46
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.4
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.35
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG4341483 consensus F-box protein containing LRR [General fu 98.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.27
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.24
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.11
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.05
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.95
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.93
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.22
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 97.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.07
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.79
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.72
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.51
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.31
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.29
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.12
PRK15386 426 type III secretion protein GogB; Provisional 95.63
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.15
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.1
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 95.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.88
KOG0617264 consensus Ras suppressor protein (contains leucine 94.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 94.31
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 93.95
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.67
KOG2997366 consensus F-box protein FBX9 [General function pre 93.28
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 93.05
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 92.79
KOG0617264 consensus Ras suppressor protein (contains leucine 92.74
KOG2982418 consensus Uncharacterized conserved protein [Funct 91.25
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 90.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.4
PRK15386 426 type III secretion protein GogB; Provisional 90.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.88
KOG0472 565 consensus Leucine-rich repeat protein [Function un 89.71
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 89.33
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.87
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.75
PF13013109 F-box-like_2: F-box-like domain 88.04
KOG2123 388 consensus Uncharacterized conserved protein [Funct 87.82
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 87.69
KOG4237498 consensus Extracellular matrix protein slit, conta 86.73
KOG0472565 consensus Leucine-rich repeat protein [Function un 86.19
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 85.97
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 83.09
KOG2123 388 consensus Uncharacterized conserved protein [Funct 82.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 82.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 80.89
PLN03150623 hypothetical protein; Provisional 80.47
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 80.32
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.68  E-value=5e-18  Score=149.36  Aligned_cols=275  Identities=20%  Similarity=0.260  Sum_probs=155.3

Q ss_pred             CCCCChHHHHHHHhcCChHHHHHHhhhhhhhhhhcccCc---eeeEecCccccccCCCCchhhHHHHHHHHHHHHHhccC
Q 014317           16 INRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTN---SLEFDASESLWNVGFGNLEQERSKYINWVNNVLELHRG   92 (427)
Q Consensus        16 is~LPd~iL~~Ils~L~~~d~~r~s~vskrW~~lw~~~~---~L~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~   92 (427)
                      |+.|||||+..||+.|+.+|..+.+.|||||.++-+.-.   .+++..+.+.           .    ....+.+.  +|
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~-----------p----~~l~~l~~--rg  160 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIH-----------P----DVLGRLLS--RG  160 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccC-----------h----hHHHHHHh--CC
Confidence            899999999999999999999999999999998633211   1333333222           2    22223322  24


Q ss_pred             CCeeEEEEEEecCCCCCccHHHHHHHHhcCCceEEEEEecCCCCCccccccccccccccCCCCCCCCCCCcEEEEeeEEe
Q 014317           93 STINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGIKFLRCLHFKTVNV  172 (427)
Q Consensus        93 ~~l~~l~l~~~~~~~~~~~~~~wl~~~~~~~v~~L~l~~~~~~~~~~~~lp~~~~~~l~lp~~~~~~~~L~~L~L~~~~~  172 (427)
                        |..+++.-...+ + ..+... ....+..+++++++.......   .+- .+         ...|..||.|.|.+.++
T Consensus       161 --V~v~Rlar~~~~-~-prlae~-~~~frsRlq~lDLS~s~it~s---tl~-~i---------Ls~C~kLk~lSlEg~~L  222 (419)
T KOG2120|consen  161 --VIVFRLARSFMD-Q-PRLAEH-FSPFRSRLQHLDLSNSVITVS---TLH-GI---------LSQCSKLKNLSLEGLRL  222 (419)
T ss_pred             --eEEEEcchhhhc-C-chhhhh-hhhhhhhhHHhhcchhheeHH---HHH-HH---------HHHHHhhhhcccccccc
Confidence              555554311111 1 111111 122345678888876521110   000 01         24678899999998888


Q ss_pred             ChhhHHHHHhcCCccceeeeccCCCceeEE---EecCccccceEEEEecCCccEEE-----EECCceeEEEEeeeeeee-
Q 014317          173 NGKDIELFIQNCPLLDRLCVDHSKTLVRLR---VIGSSIQLKYLEIQSCYLMEEIE-----ISAPSLLSFRYYGQAIKI-  243 (427)
Q Consensus       173 ~~~~l~~ll~~cp~Le~L~l~~c~~~~~l~---i~~~~~~L~~L~l~~c~~l~~~~-----i~~p~L~~L~~~~~~~~~-  243 (427)
                      .|.-... ++.-..|++|+|.+|.|+..-.   +-.+|++|..|.+++|....+.+     -..|+|..|.++|+.-.+ 
T Consensus       223 dD~I~~~-iAkN~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~  301 (419)
T KOG2120|consen  223 DDPIVNT-IAKNSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQ  301 (419)
T ss_pred             CcHHHHH-HhccccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhh
Confidence            7763333 5566889999999998876422   22367889999999887544321     124788888887763221 


Q ss_pred             ------eccCCcccceeeeeeccccccchhhccccccCCCceEEEEeccceee--cccccCCCCceeEEEEEEEccCCCC
Q 014317          244 ------NIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCNEVY--MQFSLFELPKLIDLRLRVTTPNRES  315 (427)
Q Consensus       244 ------~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~--~~~~~~~~~~L~~L~l~~~~~~~~~  315 (427)
                            ....+|+|.+++++.+-.  +.......+..++.|+.|.++.|..+.  ..-.+...|.|++|++...  .  .
T Consensus       302 ~sh~~tL~~rcp~l~~LDLSD~v~--l~~~~~~~~~kf~~L~~lSlsRCY~i~p~~~~~l~s~psl~yLdv~g~--v--s  375 (419)
T KOG2120|consen  302 KSHLSTLVRRCPNLVHLDLSDSVM--LKNDCFQEFFKFNYLQHLSLSRCYDIIPETLLELNSKPSLVYLDVFGC--V--S  375 (419)
T ss_pred             hhHHHHHHHhCCceeeeccccccc--cCchHHHHHHhcchheeeehhhhcCCChHHeeeeccCcceEEEEeccc--c--C
Confidence                  123466666666654432  112222333466666666666665554  2222345566666665221  1  1


Q ss_pred             hHHHHHHHHhCCCccEE
Q 014317          316 LLGLTCIMKACPFLQKL  332 (427)
Q Consensus       316 ~~~l~~ll~~~p~L~~L  332 (427)
                      ...+.-+.+.||+|+.-
T Consensus       376 dt~mel~~e~~~~lkin  392 (419)
T KOG2120|consen  376 DTTMELLKEMLSHLKIN  392 (419)
T ss_pred             chHHHHHHHhCcccccc
Confidence            12234455566665543



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query427
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 2e-05
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 54.5 bits (131), Expect = 2e-08
 Identities = 63/365 (17%), Positives = 112/365 (30%), Gaps = 69/365 (18%)

Query: 8   KEEISEDLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSLEFDASESLWNV 67
           +E       + LPD++L+ I S L L E  + S +  RW  L          + ESLW  
Sbjct: 1   RENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRL---------ASDESLW-- 49

Query: 68  GFGNLEQERSKYINWVNNVLELHRGSTINEFKVRFDLCDFHQSDITNWVYTVLGKRVQYI 127
                  +         +     R  +      R            +          +  
Sbjct: 50  -------QTLDLTGKNLHPDVTGRLLSQGVIAFRCPRS------FMDQPLAEHFSPFRVQ 96

Query: 128 KLDLWPGRYGHYYTFPKEFYNSIESGRGLSGI----KFLRCLHFKTVNVNGKDIELFIQN 183
            +DL                NS+     L GI      L+ L  + + ++   +   +  
Sbjct: 97  HMDLS---------------NSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT-LAK 140

Query: 184 CPLLDRLCVDHSK--TLVRLRVIGSSI-QLKYLEIQSCYLMEEIEISA------PSLLSF 234
              L RL +      +   L+ + SS  +L  L +  C+   E  +         ++   
Sbjct: 141 NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQL 200

Query: 235 RYYG-------QAIKINIENVPQLVDVSIRGSHTFRVTYFVGPIISCFPQLKTLELDSCN 287
              G         +   +   P LV + +  S    +             L+ L L  C 
Sbjct: 201 NLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSV--MLKNDCFQEFFQLNYLQHLSLSRCY 258

Query: 288 EVYMQ--FSLFELPKLIDLRLRVTTPNRESLLGLTCIMKACPFLQKLILQLNDHGRR-LG 344
           ++  +    L E+P L  L++    P+      L  + +A P LQ          R  +G
Sbjct: 259 DIIPETLLELGEIPTLKTLQVFGIVPDG----TLQLLKEALPHLQINCSHFTTIARPTIG 314

Query: 345 KKRQQ 349
            K+ Q
Sbjct: 315 NKKNQ 319


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query427
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.14
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.98
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.91
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.75
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.7
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.68
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.67
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.65
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.64
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.62
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.61
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.58
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.58
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.56
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.54
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.53
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.52
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.51
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.51
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.5
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.5
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.5
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.5
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.48
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.47
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.46
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.45
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.45
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.44
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.44
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.41
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.41
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.4
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.4
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.4
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.37
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.34
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.32
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.3
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.3
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.29
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.28
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.24
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.23
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.07
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.03
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.02
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.01
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.0
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.98
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.97
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.97
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.94
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.9
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.87
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.82
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.8
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.61
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.6
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.55
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.54
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.53
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.5
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.47
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.37
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.35
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.27
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.2
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.18
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.18
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.01
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 96.94
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.63
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.36
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.29
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 95.99
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 95.95
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 95.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 95.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.39
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 95.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 94.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 94.65
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 92.69
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 92.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 90.93
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 90.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 90.07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 86.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 81.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 80.19
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=99.85  E-value=3.3e-21  Score=196.83  Aligned_cols=153  Identities=11%  Similarity=0.201  Sum_probs=95.3

Q ss_pred             CCCcCCCCChHHHHHHHhcCC-hHHHHHHhhhhhhhhhhccc-CceeeEecCccccccCCCCchhhHHHHHHHHHHHHHh
Q 014317           12 SEDLINRLPDDILVNIISHLT-LKEAARTSVLSNRWRNLWTF-TNSLEFDASESLWNVGFGNLEQERSKYINWVNNVLEL   89 (427)
Q Consensus        12 ~~D~is~LPd~iL~~Ils~L~-~~d~~r~s~vskrW~~lw~~-~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~   89 (427)
                      ..|+|+.|||||+.+||+||| ++|++++++|||||+++... ...+.+......          ...       ..+.+
T Consensus         2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~----------~~~-------~~~~~   64 (594)
T 2p1m_B            2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAV----------SPA-------TVIRR   64 (594)
T ss_dssp             --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSS----------CHH-------HHHHH
T ss_pred             cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeecccccc----------CHH-------HHHhh
Confidence            358999999999999999999 99999999999999988221 112333322110          010       22222


Q ss_pred             ccCCCeeEEEEEEecC--------CCCCccHHHHHHHHhc--CCceEEEEEecCCCCCccccccccccccccCCCCCCCC
Q 014317           90 HRGSTINEFKVRFDLC--------DFHQSDITNWVYTVLG--KRVQYIKLDLWPGRYGHYYTFPKEFYNSIESGRGLSGI  159 (427)
Q Consensus        90 ~~~~~l~~l~l~~~~~--------~~~~~~~~~wl~~~~~--~~v~~L~l~~~~~~~~~~~~lp~~~~~~l~lp~~~~~~  159 (427)
                        -+.++++.+.....        ......+..|+.....  +++++|++..+...    ...+..+         ...+
T Consensus        65 --~~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~----~~~~~~l---------~~~~  129 (594)
T 2p1m_B           65 --FPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVT----DDCLELI---------AKSF  129 (594)
T ss_dssp             --CTTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCC----HHHHHHH---------HHHC
T ss_pred             --CCCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEc----HHHHHHH---------HHhC
Confidence              23489998876321        1112456778887653  58999999865321    0111111         1257


Q ss_pred             CCCcEEEEeeE-EeChhhHHHHHhcCCccceeeeccCC
Q 014317          160 KFLRCLHFKTV-NVNGKDIELFIQNCPLLDRLCVDHSK  196 (427)
Q Consensus       160 ~~L~~L~L~~~-~~~~~~l~~ll~~cp~Le~L~l~~c~  196 (427)
                      ++|++|+|.+| .+++..+..++..||+|++|++.+|.
T Consensus       130 ~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~  167 (594)
T 2p1m_B          130 KNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD  167 (594)
T ss_dssp             TTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE
T ss_pred             CCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc
Confidence            89999999988 57777788888889999999998775



>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 427
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 1e-06
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 2e-05
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 9e-05
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Cdc4 F-box and linker domains
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 44.6 bits (105), Expect = 1e-06
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 14 DLINRLPDDILVNIISHLTLKEAARTSVLSNRWRNLWTFTNSL 56
          DLI  LP +I + I ++L  ++   +  +S  W  +   + SL
Sbjct: 4  DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSL 46


>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query427
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.13
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.11
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.72
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.69
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.29
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.27
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.18
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.17
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.11
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.11
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.0
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.61
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.53
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.46
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.28
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.07
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.0
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 95.86
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.73
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 95.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.18
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.15
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 92.41
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 88.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 88.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 84.41
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.13  E-value=1.1e-12  Score=118.65  Aligned_cols=64  Identities=9%  Similarity=0.185  Sum_probs=42.2

Q ss_pred             CCCCCcEEEEeeEEeChhhHHHHHhcCCccceeeeccCCCce-eEEEecCccccceEEEEecCCc
Q 014317          158 GIKFLRCLHFKTVNVNGKDIELFIQNCPLLDRLCVDHSKTLV-RLRVIGSSIQLKYLEIQSCYLM  221 (427)
Q Consensus       158 ~~~~L~~L~L~~~~~~~~~l~~ll~~cp~Le~L~l~~c~~~~-~l~i~~~~~~L~~L~l~~c~~l  221 (427)
                      ...+|++|+|+++.+.++.+..+++.||+|++|.+.+|...+ .+..-+.+++|++|.+++|..+
T Consensus        44 ~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~i  108 (284)
T d2astb2          44 SPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGF  108 (284)
T ss_dssp             CCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSC
T ss_pred             cCCCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccc
Confidence            345788888888777777777788888888888888774221 1111123467777777776554



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure