Citrus Sinensis ID: 014350

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------

MWIYIFFLFSDEFTVSRVLCSILEKGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLVSELG

cEEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHc

cEEEEEEccccccEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHEHHccccccccHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccHHHHHHHHHHHHHHccEEEEEEccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcc

MWIYIFFLFSDEFTVSRVLCSILEkglvetdpegalaGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKScqredgtddqkkgSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKsaiphpriMGIIRecggkmhmaERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMesevnpfdgqeakpykndpeILAMTNLIAAYQRNEIIEFEKILKSNrktimddpfIRNYIEDLLKNVRTQVLLKLIkpytriripfiskelnvpekDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLVSELG

MWIYIFFlfsdeftvSRVLCSILEKGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEaknerlwfktNLKLCKIWFDMGEYGRMSKILKELHKSCqredgtddqkkgsqLLEVYAIEIQMYTETKNNKKLKQLYQKALaiksaiphpriMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKsnrktimdDPFIRNYIEDLLKNVRTQVLLKlikpytriripfiskelnvpekDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLVSELG

MWIYIFFLFSDEFTVSRVLCSILEKGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETknnkklkqlyqkalaikSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLVSELG

*WIYIFFLFSDEFTVSRVLCSILEKGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKEL******************LLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVN************DPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLV****

MWIYIFFLFSDEFTVSRVLCSILE**********AL**FA***************ALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQR****DDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVN*************PEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLVSE**

MWIYIFFLFSDEFTVSRVLCSILEKGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHK************KGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSAYLTFLLLKKNAYLTCSYLVSELG

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		426	2.2.26 [Sep-21-2011]
Q8W207		439	COP9 signalosome complex	yes	no	0.882	0.856	0.904	0.0
Q54HL6		449	COP9 signalosome complex	yes	no	0.915	0.868	0.656	1e-152
Q6IR75		441	COP9 signalosome complex	N/A	no	0.870	0.841	0.678	1e-152
P61203		443	COP9 signalosome complex	yes	no	0.870	0.837	0.672	1e-151
P61202		443	COP9 signalosome complex	yes	no	0.870	0.837	0.672	1e-151
P61201		443	COP9 signalosome complex	yes	no	0.870	0.837	0.672	1e-151
Q6IQT4		443	COP9 signalosome complex	yes	no	0.870	0.837	0.670	1e-151
Q94899		444	COP9 signalosome complex	yes	no	0.870	0.835	0.641	1e-141
O01422		495	COP9 signalosome complex	yes	no	0.847	0.729	0.562	1e-123
Q5B3U7		506	COP9 signalosome complex	yes	no	0.845	0.711	0.542	1e-121

>sp\|Q8W207\|CSN2_ARATH COP9 signalosome complex subunit 2 OS=Arabidopsis thaliana GN=CSN2 PE=1 SV=1	Back alignment and function desciption

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/376 (90%), Positives = 361/376 (96%)

Query: 25  KGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYI 84
           KG+VET+PE AL+GFAEVV MEPEKA+WGFKALKQTVK+YYRLGKYKEMM+AY EMLTYI
Sbjct: 34  KGMVETEPEEALSGFAEVVQMEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYI 93

Query: 85  KSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCK 144
           KSAVTRNYSEKCINNIMDFVSGSASQN  LL+EFYQTTLKALEEAKNERLWFKTNLKLC 
Sbjct: 94  KSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCN 153

Query: 145 IWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQL 204
           IWFD+GEY RM+KILKELHKSCQ+EDGTDDQKKGSQLLEVYAIEIQ+YTETK+NKKLKQL
Sbjct: 154 IWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQL 213

Query: 205 YQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCL 264
           Y KALAIKSAIPHPRIMGIIRECGGKMHMAERQW +AATDFFEAFKNYDEAGNQRRIQCL
Sbjct: 214 YHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCL 273

Query: 265 KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTI 324
           KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFE+ILKSNR+TI
Sbjct: 274 KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFERILKSNRRTI 333

Query: 325 MDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNR 384
           MDDPFIRNY+EDLLK VRTQVLLKLIKPYT+I IPFISKELNVPE DV +LLVSLILD+R
Sbjct: 334 MDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDVTELLVSLILDSR 393

Query: 385 IDGHIDQVNRLLERGD 400
           IDGHID++NR L RGD
Sbjct: 394 IDGHIDEMNRYLLRGD 409

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q54HL6\|CSN2_DICDI COP9 signalosome complex subunit 2 OS=Dictyostelium discoideum GN=csn2 PE=1 SV=1	Back alignment and function description

>sp\|Q6IR75\|CSN2_XENLA COP9 signalosome complex subunit 2 (Fragment) OS=Xenopus laevis GN=csn2 PE=2 SV=1	Back alignment and function description

>sp\|P61203\|CSN2_RAT COP9 signalosome complex subunit 2 OS=Rattus norvegicus GN=Cops2 PE=2 SV=1	Back alignment and function description

>sp\|P61202\|CSN2_MOUSE COP9 signalosome complex subunit 2 OS=Mus musculus GN=Cops2 PE=1 SV=1	Back alignment and function description

>sp\|P61201\|CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens GN=COPS2 PE=1 SV=1	Back alignment and function description

>sp\|Q6IQT4\|CSN2_DANRE COP9 signalosome complex subunit 2 OS=Danio rerio GN=cops2 PE=2 SV=1	Back alignment and function description

>sp\|Q94899\|CSN2_DROME COP9 signalosome complex subunit 2 OS=Drosophila melanogaster GN=alien PE=1 SV=2	Back alignment and function description

>sp\|O01422\|CSN2_CAEEL COP9 signalosome complex subunit 2 OS=Caenorhabditis elegans GN=csn-2 PE=1 SV=2	Back alignment and function description

>sp\|Q5B3U7\|CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=csnB PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		426
224106658		439	predicted protein [Populus trichocarpa]	0.887	0.861	0.981	0.0
255583651		439	cop9 signalosome complex subunit, putati	0.887	0.861	0.981	0.0
224120594		439	predicted protein [Populus trichocarpa]	0.887	0.861	0.978	0.0
225440232		439	PREDICTED: COP9 signalosome complex subu	0.887	0.861	0.960	0.0
297741725		440	unnamed protein product [Vitis vinifera]	0.887	0.859	0.960	0.0
56783671		433	putative COP9 signalosome complex subuni	0.887	0.872	0.944	0.0
115435976		439	Os01g0279200 [Oryza sativa Japonica Grou	0.887	0.861	0.944	0.0
242057017		439	hypothetical protein SORBIDRAFT_03g01126	0.887	0.861	0.941	0.0
223943737		438	unknown [Zea mays] gi\|414877058\|tpg\|DAA5	0.887	0.863	0.936	0.0
356503363		439	PREDICTED: COP9 signalosome complex subu	0.887	0.861	0.941	0.0

>gi\|224106658\|ref\|XP_002314240.1\| predicted protein [Populus trichocarpa] gi\|118481037\|gb\|ABK92472.1\| unknown [Populus trichocarpa] gi\|222850648\|gb\|EEE88195.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/378 (98%), Positives = 377/378 (99%)

Query: 25  KGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYI 84
           KGLVETDPEGALAGFAEVV+MEPEKAEWGFKALKQTVKLYYRLGKYKEMM+AYREMLTYI
Sbjct: 34  KGLVETDPEGALAGFAEVVSMEPEKAEWGFKALKQTVKLYYRLGKYKEMMEAYREMLTYI 93

Query: 85  KSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCK 144
           KSAVTRNYSEKCINNIMDFVSGSASQNF LL+EFYQTTLKALEEAKNERLWFKTNLKLCK
Sbjct: 94  KSAVTRNYSEKCINNIMDFVSGSASQNFGLLQEFYQTTLKALEEAKNERLWFKTNLKLCK 153

Query: 145 IWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQL 204
           IWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQL
Sbjct: 154 IWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQL 213

Query: 205 YQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCL 264
           YQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWA+AATDFFEAFKNYDEAGNQRRIQCL
Sbjct: 214 YQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWAEAATDFFEAFKNYDEAGNQRRIQCL 273

Query: 265 KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTI 324
           KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEI+EFEKILKSNR+TI
Sbjct: 274 KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEILEFEKILKSNRRTI 333

Query: 325 MDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNR 384
           MDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNR
Sbjct: 334 MDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNR 393

Query: 385 IDGHIDQVNRLLERGDRS 402
           IDGHIDQVNRLLERGDRS
Sbjct: 394 IDGHIDQVNRLLERGDRS 411

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255583651\|ref\|XP_002532580.1\| cop9 signalosome complex subunit, putative [Ricinus communis] gi\|223527689\|gb\|EEF29797.1\| cop9 signalosome complex subunit, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224120594\|ref\|XP_002330981.1\| predicted protein [Populus trichocarpa] gi\|222872773\|gb\|EEF09904.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225440232\|ref\|XP_002283810.1\| PREDICTED: COP9 signalosome complex subunit 2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297741725\|emb\|CBI32857.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|56783671\|dbj\|BAD81083.1\| putative COP9 signalosome complex subunit 2 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|115435976\|ref\|NP_001042746.1\| Os01g0279200 [Oryza sativa Japonica Group] gi\|113532277\|dbj\|BAF04660.1\| Os01g0279200 [Oryza sativa Japonica Group] gi\|218187979\|gb\|EEC70406.1\| hypothetical protein OsI_01398 [Oryza sativa Indica Group] gi\|222618201\|gb\|EEE54333.1\| hypothetical protein OsJ_01306 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|242057017\|ref\|XP_002457654.1\| hypothetical protein SORBIDRAFT_03g011260 [Sorghum bicolor] gi\|241929629\|gb\|EES02774.1\| hypothetical protein SORBIDRAFT_03g011260 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|223943737\|gb\|ACN25952.1\| unknown [Zea mays] gi\|414877058\|tpg\|DAA54189.1\| TPA: COP9 signalosome complex subunit 2 [Zea mays]	Back alignment and taxonomy information

>gi\|356503363\|ref\|XP_003520479.1\| PREDICTED: COP9 signalosome complex subunit 2-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		426
TAIR\|locus:2059289		439	FUS12 "FUSCA 12" [Arabidopsis	0.882	0.856	0.864	4.7e-174
DICTYBASE\|DDB_G0289361		449	csn2 "proteasome component reg	0.910	0.864	0.621	9.3e-130
UNIPROTKB\|E2REA8		443	COPS2 "Uncharacterized protein	0.870	0.837	0.640	3.2e-129
UNIPROTKB\|P61201		443	COPS2 "COP9 signalosome comple	0.870	0.837	0.640	3.2e-129
MGI\|MGI:1330276		443	Cops2 "COP9 (constitutive phot	0.870	0.837	0.640	3.2e-129
RGD\|628791		443	Cops2 "COP9 signalosome subuni	0.870	0.837	0.640	3.2e-129
UNIPROTKB\|P61203		443	Cops2 "COP9 signalosome comple	0.870	0.837	0.640	3.2e-129
ZFIN\|ZDB-GENE-040625-15		443	cops2 "COP9 constitutive photo	0.870	0.837	0.638	5.2e-129
UNIPROTKB\|G3X736		450	COPS2 "Uncharacterized protein	0.875	0.828	0.632	2.8e-128
FB\|FBgn0013746		444	alien "alien" [Drosophila mela	0.870	0.835	0.609	1.5e-120

TAIR\|locus:2059289 FUS12 "FUSCA 12" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1691 (600.3 bits), Expect = 4.7e-174, P = 4.7e-174
 Identities = 325/376 (86%), Positives = 345/376 (91%)

Query:    25 KGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYI 84
             KG+VET+PE AL+GFAEVV MEPEKA+WGFKALKQTVK+YYRLGKYKEMM+AY EMLTYI
Sbjct:    34 KGMVETEPEEALSGFAEVVQMEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYI 93

Query:    85 KSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCK 144
             KSAVTRNYSEKCINNIMDFVSGSASQN  LL+EFYQTTLKALEEAKNERLWFKTNLKLC 
Sbjct:    94 KSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCN 153

Query:   145 IWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETXXXXXXXXX 204
             IWFD+GEY RM+KILKELHKSCQ+EDGTDDQKKGSQLLEVYAIEIQ+YTET         
Sbjct:   154 IWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQL 213

Query:   205 XXXXXXXXSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKNYDEAGNQRRIQCL 264
                     SAIPHPRIMGIIRECGGKMHMAERQW +AATDFFEAFKNYDEAGNQRRIQCL
Sbjct:   214 YHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCL 273

Query:   265 KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTI 324
             KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFE+ILKSNR+TI
Sbjct:   274 KYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFERILKSNRRTI 333

Query:   325 MDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNR 384
             MDDPFIRNY+EDLLK VRTQVLLKLIKPYT+I IPFISKELNVPE DV +LLVSLILD+R
Sbjct:   334 MDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDVTELLVSLILDSR 393

Query:   385 IDGHIDQVNRLLERGD 400
             IDGHID++NR L RGD
Sbjct:   394 IDGHIDEMNRYLLRGD 409

GO:0005634 "nucleus" evidence=ISM;TAS

GO:0030163 "protein catabolic process" evidence=TAS

GO:0008180 "signalosome" evidence=TAS;IPI

GO:0009640 "photomorphogenesis" evidence=RCA;TAS

GO:0005515 "protein binding" evidence=IPI

GO:0010388 "cullin deneddylation" evidence=RCA;IMP

GO:0005829 "cytosol" evidence=IDA

DICTYBASE\|DDB_G0289361 csn2 "proteasome component region PCI (PINT) domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|E2REA8 COPS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P61201 COPS2 "COP9 signalosome complex subunit 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1330276 Cops2 "COP9 (constitutive photomorphogenic) homolog, subunit 2 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|628791 Cops2 "COP9 signalosome subunit 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P61203 Cops2 "COP9 signalosome complex subunit 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040625-15 cops2 "COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|G3X736 COPS2 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

FB\|FBgn0013746 alien "alien" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O01422	CSN2_CAEEL	No assigned EC number	0.5628	0.8474	0.7292	yes	no
Q6IR75	CSN2_XENLA	No assigned EC number	0.6782	0.8708	0.8412	N/A	no
Q54HL6	CSN2_DICDI	No assigned EC number	0.6564	0.9154	0.8685	yes	no
Q5B3U7	CSN2_EMENI	No assigned EC number	0.5426	0.8450	0.7114	yes	no
Q8W207	CSN2_ARATH	No assigned EC number	0.9042	0.8826	0.8564	yes	no
Q94899	CSN2_DROME	No assigned EC number	0.6417	0.8708	0.8355	yes	no
P61201	CSN2_HUMAN	No assigned EC number	0.6729	0.8708	0.8374	yes	no
P61203	CSN2_RAT	No assigned EC number	0.6729	0.8708	0.8374	yes	no
P61202	CSN2_MOUSE	No assigned EC number	0.6729	0.8708	0.8374	yes	no
Q6IQT4	CSN2_DANRE	No assigned EC number	0.6702	0.8708	0.8374	yes	no
Q9HFR0	CSN2_SCHPO	No assigned EC number	0.4736	0.8802	0.8581	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		426
pfam01399		100	pfam01399, PCI, PCI domain	9e-24
COG5159		421	COG5159, RPN6, 26S proteasome regulatory complex c	4e-22
smart00753		88	smart00753, PAM, PCI/PINT associated module	1e-16
smart00088		88	smart00088, PINT, motif in proteasome subunits, In	1e-16
pfam10075		144	pfam10075, PCI_Csn8, COP9 signalosome, subunit CSN	2e-11

>gnl\|CDD\|216479 pfam01399, PCI, PCI domain	Back alignment and domain information

 Score = 94.6 bits (236), Expect = 9e-24
 Identities = 34/100 (34%), Positives = 58/100 (58%), Gaps = 1/100 (1%)

Query: 298 MTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIR 357
             +L+ A+   ++ +FE+IL  N +  + D  +   +EDL + +R   L +L KPY+ I 
Sbjct: 1   YRDLLRAFYSGDLSDFEEILADN-EDELLDDGLAELLEDLRRKIRELNLRRLAKPYSSIS 59

Query: 358 IPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLE 397
           +  ++K L +   +VE++L  LI D RI G IDQVN ++ 
Sbjct: 60  LSDLAKLLGLSVDEVEKILSKLIRDGRIRGKIDQVNGIVV 99

This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Length = 100

>gnl\|CDD\|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214803 smart00753, PAM, PCI/PINT associated module	Back alignment and domain information

>gnl\|CDD\|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15	Back alignment and domain information

>gnl\|CDD\|220553 pfam10075, PCI_Csn8, COP9 signalosome, subunit CSN8	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		426
KOG1464		440	consensus COP9 signalosome, subunit CSN2 [Posttran	100.0
KOG1463		411	consensus 26S proteasome regulatory complex, subun	100.0
COG5159		421	RPN6 26S proteasome regulatory complex component [	100.0
KOG1498		439	consensus 26S proteasome regulatory complex, subun	100.0
COG5071		439	RPN5 26S proteasome regulatory complex component [	100.0
KOG0687		393	consensus 26S proteasome regulatory complex, subun	99.97
COG5187		412	RPN7 26S proteasome regulatory complex component,	99.95
KOG0686		466	consensus COP9 signalosome, subunit CSN1 [Posttran	99.93
KOG1497		399	consensus COP9 signalosome, subunit CSN4 [Posttran	99.89
KOG2758		432	consensus Translation initiation factor 3, subunit	99.86
KOG2908		380	consensus 26S proteasome regulatory complex, subun	99.86
PF01399		105	PCI: PCI domain; InterPro: IPR000717 A homology do	99.79
KOG2581		493	consensus 26S proteasome regulatory complex, subun	99.78
KOG2582		422	consensus COP9 signalosome, subunit CSN3 [Posttran	99.52
smart00088		88	PINT motif in proteasome subunits, Int-6, Nip-1 an	99.44
smart00753		88	PAM PCI/PINT associated module.	99.44
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	99.33
COG5600		413	Transcription-associated recombination protein [DN	98.87
KOG1076		843	consensus Translation initiation factor 3, subunit	98.83
KOG2753		378	consensus Uncharacterized conserved protein, conta	98.79
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.77
KOG2688		394	consensus Transcription-associated recombination p	98.69
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.46
PRK11788		389	tetratricopeptide repeat protein; Provisional	98.44
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	98.35
PRK11788		389	tetratricopeptide repeat protein; Provisional	98.35
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	98.24
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	98.11
KOG2072		988	consensus Translation initiation factor 3, subunit	98.06
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	98.01
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	98.01
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	98.0
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	97.98
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	97.96
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	97.85
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	97.82
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.82
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	97.8
KOG2003		840	consensus TPR repeat-containing protein [General f	97.75
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.75
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.74
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	97.72
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	97.66
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	97.61
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	97.58
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	97.55
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	97.51
PF10255		404	Paf67: RNA polymerase I-associated factor PAF67; I	97.47
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	97.47
KOG2003		840	consensus TPR repeat-containing protein [General f	97.45
PF10075		143	PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro	97.44
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	97.31
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.12
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	97.11
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	97.1
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	97.1
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	97.08
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	97.08
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	97.05
PRK12370		553	invasion protein regulator; Provisional	97.01
PF04190		260	DUF410: Protein of unknown function (DUF410) ; Int	97.0
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	96.98
COG4105		254	ComL DNA uptake lipoprotein [General function pred	96.97
PRK11189		296	lipoprotein NlpI; Provisional	96.91
PLN03218		1060	maturation of RBCL 1; Provisional	96.86
PRK10803		263	tol-pal system protein YbgF; Provisional	96.82
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	96.82
KOG1126		638	consensus DNA-binding cell division cycle control	96.79
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	96.79
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	96.75
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	96.7
PLN03218		1060	maturation of RBCL 1; Provisional	96.67
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	96.65
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	96.53
PRK10370		198	formate-dependent nitrite reductase complex subuni	96.49
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	96.46
PRK04841		903	transcriptional regulator MalT; Provisional	96.46
KOG1585		308	consensus Protein required for fusion of vesicles	96.43
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	96.39
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	96.39
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	96.39
PF09756		188	DDRGK: DDRGK domain; InterPro: IPR019153 This is a	96.38
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.37
PF03399		204	SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I	96.36
PRK12370		553	invasion protein regulator; Provisional	96.34
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	96.33
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	96.32
KOG2076		895	consensus RNA polymerase III transcription factor	96.27
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	96.27
PRK10370		198	formate-dependent nitrite reductase complex subuni	96.27
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	96.26
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	96.25
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	96.15
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	96.14
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	96.11
TIGR02552		135	LcrH_SycD type III secretion low calcium response	96.0
PRK11189		296	lipoprotein NlpI; Provisional	95.99
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	95.92
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	95.91
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	95.91
KOG2300		629	consensus Uncharacterized conserved protein [Funct	95.88
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	95.86
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	95.79
KOG1126		638	consensus DNA-binding cell division cycle control	95.77
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	95.76
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	95.66
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	95.64
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	95.59
PRK15359		144	type III secretion system chaperone protein SscB;	95.52
PF09012		69	FeoC: FeoC like transcriptional regulator; InterPr	95.5
KOG0547		606	consensus Translocase of outer mitochondrial membr	95.38
KOG2076		895	consensus RNA polymerase III transcription factor	95.37
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	95.36
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	95.31
KOG1125		579	consensus TPR repeat-containing protein [General f	95.31
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	95.23
PLN03077		857	Protein ECB2; Provisional	95.19
PF13512		142	TPR_18: Tetratricopeptide repeat	95.17
PRK14574		822	hmsH outer membrane protein; Provisional	95.16
TIGR02552		135	LcrH_SycD type III secretion low calcium response	95.15
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	95.13
KOG1861		540	consensus Leucine permease transcriptional regulat	95.1
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	95.1
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	94.96
PRK04841		903	transcriptional regulator MalT; Provisional	94.91
KOG1586		288	consensus Protein required for fusion of vesicles	94.9
PF13371		73	TPR_9: Tetratricopeptide repeat	94.82
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	94.81
KOG1941		518	consensus Acetylcholine receptor-associated protei	94.72
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	94.71
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	94.68
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	94.56
KOG0495		913	consensus HAT repeat protein [RNA processing and m	94.38
KOG2376		652	consensus Signal recognition particle, subunit Srp	94.33
KOG3060		289	consensus Uncharacterized conserved protein [Funct	94.32
KOG1129		478	consensus TPR repeat-containing protein [General f	94.26
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	94.22
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	94.21
PRK15359		144	type III secretion system chaperone protein SscB;	94.11
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	94.07
PLN03077		857	Protein ECB2; Provisional	94.04
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	94.03
PRK10803		263	tol-pal system protein YbgF; Provisional	93.89
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	93.88
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	93.87
KOG1586		288	consensus Protein required for fusion of vesicles	93.73
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	93.71
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	93.67
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	93.6
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	93.39
KOG2376		652	consensus Signal recognition particle, subunit Srp	92.74
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	92.67
PRK14574		822	hmsH outer membrane protein; Provisional	92.59
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	92.43
PRK15431		78	ferrous iron transport protein FeoC; Provisional	92.15
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	92.03
KOG0495		913	consensus HAT repeat protein [RNA processing and m	91.67
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	91.61
PF08784		102	RPA_C: Replication protein A C terminal; InterPro:	91.57
PF03704		146	BTAD: Bacterial transcriptional activator domain;	91.51
KOG3060		289	consensus Uncharacterized conserved protein [Funct	91.51
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	91.5
PF03704		146	BTAD: Bacterial transcriptional activator domain;	91.47
COG4783		484	Putative Zn-dependent protease, contains TPR repea	91.39
COG4105		254	ComL DNA uptake lipoprotein [General function pred	91.37
PRK14720		906	transcript cleavage factor/unknown domain fusion p	91.28
KOG1129		478	consensus TPR repeat-containing protein [General f	91.15
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	91.12
PF12688		120	TPR_5: Tetratrico peptide repeat	91.06
PF08220		57	HTH_DeoR: DeoR-like helix-turn-helix domain; Inter	90.7
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	90.55
KOG3054		299	consensus Uncharacterized conserved protein [Funct	90.45
KOG1941		518	consensus Acetylcholine receptor-associated protei	90.26
PF13431		34	TPR_17: Tetratricopeptide repeat	89.89
PF13371		73	TPR_9: Tetratricopeptide repeat	89.61
KOG0547		606	consensus Translocase of outer mitochondrial membr	89.6
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	89.22
KOG2908		380	consensus 26S proteasome regulatory complex, subun	89.13
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	89.07
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	88.87
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	88.84
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	88.75
PRK14720		906	transcript cleavage factor/unknown domain fusion p	88.56
PF13512		142	TPR_18: Tetratricopeptide repeat	88.46
PF13412		48	HTH_24: Winged helix-turn-helix DNA-binding; PDB:	88.43
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	88.42
PRK15331		165	chaperone protein SicA; Provisional	88.16
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	87.87
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	87.82
PF12688		120	TPR_5: Tetratrico peptide repeat	87.38
KOG3616		1636	consensus Selective LIM binding factor [Transcript	87.17
COG3118		304	Thioredoxin domain-containing protein [Posttransla	87.1
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	86.84
KOG4340		459	consensus Uncharacterized conserved protein [Funct	86.75
KOG0553		304	consensus TPR repeat-containing protein [General f	86.52
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	86.36
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	85.98
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	85.86
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	85.71
smart00550		68	Zalpha Z-DNA-binding domain in adenosine deaminase	85.53
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	85.03
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	84.78
KOG2300		629	consensus Uncharacterized conserved protein [Funct	84.76
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	84.61
KOG0553		304	consensus TPR repeat-containing protein [General f	84.56
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	83.36
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	83.19
PF12802		62	MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP	83.06
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	82.96
KOG4234		271	consensus TPR repeat-containing protein [General f	82.82
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	82.48
TIGR03504		44	FimV_Cterm FimV C-terminal domain. This protein is	82.02
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	81.49
smart00345		60	HTH_GNTR helix_turn_helix gluconate operon transcr	81.25
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	80.82
KOG1585		308	consensus Protein required for fusion of vesicles	80.21

>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=1.3e-73  Score=519.86  Aligned_cols=388  Identities=70%  Similarity=1.095  Sum_probs=378.3

Q ss_pred             cchhhHhHHHHhhcccCCCCHHHHHHHHHHHhcCCccchhhhHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhhhhhhhh
Q 014350           12 EFTVSRVLCSILEKGLVETDPEGALAGFAEVVAMEPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRN   91 (426)
Q Consensus        12 ~~~~~~~~~~~~ak~~~~~~~~~Ai~~~~~ii~~~~~~~~~~~k~l~~l~~l~~~~~~~~~l~e~~~~l~~~~~~~~~k~   91 (426)
                      +-.|.-++-||++|+++.++|++|+..|+++++.+.++++|+||+|+|++++++..|+++++++.|++++++.++.++++
T Consensus        23 EpdVDlENQYYnsK~l~e~~p~~Al~sF~kVlelEgEKgeWGFKALKQmiKI~f~l~~~~eMm~~Y~qlLTYIkSAVTrN  102 (440)
T KOG1464|consen   23 EPDVDLENQYYNSKGLKEDEPKEALSSFQKVLELEGEKGEWGFKALKQMIKINFRLGNYKEMMERYKQLLTYIKSAVTRN  102 (440)
T ss_pred             CCCcchHhhhhccccccccCHHHHHHHHHHHHhcccccchhHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHhcc
Confidence            44577789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCChhHHHHHHHHHHHHHHhhhhhhhHHHHhHHHHHHHHHhccHHHHHHHHHHHHhhcccCCC
Q 014350           92 YSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKELHKSCQREDG  171 (426)
Q Consensus        92 ~~~k~v~~il~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~kl~~r~~~~La~~~~~~g~~~~A~~ll~el~~~~~~~~~  171 (426)
                      +.+|+++.++|+++.+.+  ...++++|+++++.++.+.|+|+||+++.+|+++|++.|+|.+..+++.++++.|.+.+|
T Consensus       103 ySEKsIN~IlDyiStS~~--m~LLQ~FYeTTL~ALkdAKNeRLWFKTNtKLgkl~fd~~e~~kl~KIlkqLh~SCq~edG  180 (440)
T KOG1464|consen  103 YSEKSINSILDYISTSKN--MDLLQEFYETTLDALKDAKNERLWFKTNTKLGKLYFDRGEYTKLQKILKQLHQSCQTEDG  180 (440)
T ss_pred             ccHHHHHHHHHHHhhhhh--hHHHHHHHHHHHHHHHhhhcceeeeeccchHhhhheeHHHHHHHHHHHHHHHHHhccccC
Confidence            999999999999997555  889999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhhhhhHHHHHHHHHHHHHhhcCHHHHHHHHHHHHhhhccCCChhHHHHHHHhhHHHhHHhhcHHHHHHHHHHHHhh
Q 014350          172 TDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAIPHPRIMGIIRECGGKMHMAERQWADAATDFFEAFKN  251 (426)
Q Consensus       172 ~~d~~~~~~l~e~~l~e~rl~~~~~d~~kak~~l~~a~~i~~~~~~p~~~~~i~~~~g~~~~~~~~y~~A~~~f~ea~~~  251 (426)
                      .+|.+++..++|+++.++++|...+|..+.+.+|+++..+.+++|||.+++.|++|+|.+|+.+|.|.+|...|+++|.+
T Consensus       181 edD~kKGtQLLEiYAlEIQmYT~qKnNKkLK~lYeqalhiKSAIPHPlImGvIRECGGKMHlreg~fe~AhTDFFEAFKN  260 (440)
T KOG1464|consen  181 EDDQKKGTQLLEIYALEIQMYTEQKNNKKLKALYEQALHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKN  260 (440)
T ss_pred             chhhhccchhhhhHhhHhhhhhhhcccHHHHHHHHHHHHhhccCCchHHHhHHHHcCCccccccchHHHHHhHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcchhHHHHHHHHHHHHHhhCCCCCCCCcccccccCCCcccHHHHHHHHHHhhCCHHHHHHHHHHhHHHhcCChhHH
Q 014350          252 YDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIR  331 (426)
Q Consensus       252 ~~~~~~~~~~~~lky~~L~~lL~~~~~~~~~s~~~~~~~~~~~~~~l~~L~~af~~~dl~~f~~~l~~~~~~l~~D~~l~  331 (426)
                      |++.|+|.+..||+|++|+.+|..+++|||+++++.||+++|++-+|..|+.||.+.|+.+|+.++..++..+++|||+.
T Consensus       261 YDEsGspRRttCLKYLVLANMLmkS~iNPFDsQEAKPyKNdPEIlAMTnlv~aYQ~NdI~eFE~Il~~~~~~IM~DpFIR  340 (440)
T KOG1464|consen  261 YDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVAAYQNNDIIEFERILKSNRSNIMDDPFIR  340 (440)
T ss_pred             ccccCCcchhHHHHHHHHHHHHHHcCCCCCcccccCCCCCCHHHHHHHHHHHHHhcccHHHHHHHHHhhhccccccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhccccccccchhHHhHhCCChHHHHHHHHHhHHcCceeEEEecCCCEEEEecC
Q 014350          332 NYIEDLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDR  401 (426)
Q Consensus       332 ~~~~~L~~~l~~~~l~~i~~pYs~I~l~~iA~~l~l~~~evE~~l~~lI~~g~i~akID~~~g~v~~~~~  401 (426)
                      +|+++|.++||.++++++++||++|.+.+|++.|++|+.+||.+|+.+|+|.+|+|+||++++.+...+.
T Consensus       341 eh~EdLl~niRTQVLlkLIkPYt~i~Ipfis~~Lnv~~~dV~~LLV~~ILD~~i~g~Ide~n~~l~~~~~  410 (440)
T KOG1464|consen  341 EHIEDLLRNIRTQVLLKLIKPYTNIGIPFISKELNVPEADVESLLVSCILDDTIDGRIDEVNQYLELDKS  410 (440)
T ss_pred             HHHHHHHHHHHHHHHHHHhccccccCchhhHhhcCCCHHHHHHHHHHHHhccccccchHHhhhHhccCcc
Confidence            9999999999999999999999999999999999999999999999999999999999999999988664

>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins	Back alignment and domain information

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15	Back alignment and domain information

>smart00753 PAM PCI/PINT associated module	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 []	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>KOG1861 consensus Leucine permease transcriptional regulator [Transcription]	Back alignment and domain information

Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PRK15431 ferrous iron transport protein FeoC; Provisional	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A)	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>KOG3054 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03504 FimV_Cterm FimV C-terminal domain	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		426
3txm_A		394	Crystal Structure Of Rpn6 From Drosophila Melanogas		3e-20
4b4t_Q		434	Near-Atomic Resolution Structural Model Of The Yeas		2e-12

>pdb|3TXM|A Chain A, Crystal Structure Of Rpn6 From Drosophila Melanogaster, Gd(3+) Complex Length = 394

Back alignment and structure

Iteration: 1

Score = 96.3 bits (238), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 86/347 (24%), Positives = 170/347 (48%), Gaps = 32/347 (9%) Query: 59 QTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMD-FVSGSASQNFSLLRE 117 Q +LY + GK KE+ D + ++ S++++ + K + +++D F+ A + Sbjct: 24 QQGELYKQEGKAKELADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDAGTGIEV--- 79 Query: 118 FYQTTLKALEEAKNE-RLWFKTNL--KLCKIWFDMGEYGRM----SKILKELHKSCQRED 170 Q +E AK E R + + +L +L ++FD Y +++L+EL K Sbjct: 80 --QLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKK------ 131 Query: 171 GTDDQKKGSQLLEVYAIEIQMYTETXXXXXXXXXXXXXXXXXSAI--PHPRIMGIIRECG 228 DD+ + L+EV +E + Y +AI P P++ G + Sbjct: 132 -LDDK---NLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCP-PKVQGALDLQS 186 Query: 229 GKMHMA-ERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLM--ESEVNPF-DGQ 284 G +H A ER + A + F+EAF+ +D + + + LKY++L +++ +VN G+ Sbjct: 187 GILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGK 246 Query: 285 EAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQ 344 A Y +I AM ++ A + + +F+ LK +K + +D ++ ++ L + Q Sbjct: 247 LAITYSG-RDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQ 305 Query: 345 VLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQ 391 L ++I+PY+R+++ +++ + +P VE+ L +ILD + G +DQ Sbjct: 306 NLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQ 352

PyMOL of 3txm

>pdb|4B4T|Q Chain Q, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		426
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	4e-93
3t5x_A		203	PCI domain-containing protein 2; PCI, mRNA nuclear	3e-30
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-08
1ufm_A		84	COP9 complex subunit 4; helix-turn-helix, structur	6e-09
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	1e-04

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394	Back alignment and structure

 Score =  285 bits (729), Expect = 4e-93
 Identities = 71/365 (19%), Positives = 163/365 (44%), Gaps = 14/365 (3%)

Query: 46  EPEKAEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIK---SAVTRNYSEKCINNIMD 102
             E  E   +  +Q +     L K +       +++   +   S++++  + K + +++D
Sbjct: 7   GAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVD 66

Query: 103 FVSGSASQNFSLLREFYQTTLKALEEAKNERLWFKTNLKLCKIWFDMGEYGRMSKILKEL 162
                      +  +  +  ++  ++ K   L      +L  ++FD   Y     +  +L
Sbjct: 67  MFL-DMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQL 125

Query: 163 HKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQKALAIKSAI-PHPRIM 221
            +  ++ D  +       L+EV  +E + Y    N  K +     A    +AI   P++ 
Sbjct: 126 LRELKKLDDKN------LLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQ 179

Query: 222 GIIRECGGKMHM-AERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLME--SEV 278
           G +    G +H   ER +  A + F+EAF+ +D   + + +  LKY++L  +++    +V
Sbjct: 180 GALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDV 239

Query: 279 NPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLL 338
           N     +     +  +I AM ++  A  +  + +F+  LK  +K + +D  ++ ++  L 
Sbjct: 240 NQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLY 299

Query: 339 KNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLER 398
             +  Q L ++I+PY+R+++  +++ + +P   VE+ L  +ILD +  G +DQ   +L  
Sbjct: 300 DTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIV 359

Query: 399 GDRSA 403
            + + 
Sbjct: 360 FEETP 364

PyMOL of 3txn

>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		426
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	100.0
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	100.0
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	100.0
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	100.0
4b4t_O		393	26S proteasome regulatory subunit RPN9; hydrolase,	99.93
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	99.87
3t5x_A		203	PCI domain-containing protein 2; PCI, mRNA nuclear	99.83
3t5v_B		455	Nuclear mRNA export protein THP1; PCI, mRNA nuclea	99.8
1ufm_A		84	COP9 complex subunit 4; helix-turn-helix, structur	99.7
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.28
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.27
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.22
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.15
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.15
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.15
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.09
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.07
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.06
3chm_A		169	COP9 signalosome complex subunit 7; heat/ARM repea	99.05
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.03
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	98.98
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	98.92
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	98.87
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	98.82
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	98.79
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.75
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	98.75
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	98.74
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.67
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	98.67
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.64
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.64
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	98.64
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	98.62
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.62
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	98.6
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	98.6
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	98.59
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.58
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	98.55
4b0z_A		229	RPN12, 26S proteasome regulatory subunit RPN12; pr	98.52
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	98.52
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	98.51
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	98.5
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	98.5
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	98.5
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	98.49
3u4t_A		272	TPR repeat-containing protein; structural genomics	98.49
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	98.46
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	98.45
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	98.45
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	98.43
3u4t_A		272	TPR repeat-containing protein; structural genomics	98.41
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	98.4
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	98.4
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.38
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	98.38
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	98.37
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	98.32
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.32
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.32
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	98.28
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	98.26
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	98.25
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.25
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	98.24
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	98.23
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	98.23
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	98.22
2gw1_A		514	Mitochondrial precursor proteins import receptor;	98.22
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.2
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	98.18
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	98.17
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.1
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	98.08
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.08
2gw1_A		514	Mitochondrial precursor proteins import receptor;	98.06
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	97.99
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	97.99
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	97.99
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	97.95
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	97.94
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	97.94
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.9
4g1t_A		472	Interferon-induced protein with tetratricopeptide	97.9
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	97.89
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	97.88
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	97.84
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	97.83
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	97.82
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	97.8
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	97.8
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	97.78
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	97.76
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	97.75
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	97.74
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	97.72
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	97.7
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	97.69
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	97.68
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	97.66
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	97.65
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	97.65
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	97.65
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	97.59
4g1t_A		472	Interferon-induced protein with tetratricopeptide	97.56
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	97.56
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	97.55
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	97.55
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	97.48
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	97.47
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	97.45
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	97.43
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.42
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	97.42
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	97.32
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	97.29
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.23
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.23
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.23
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.22
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.22
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.2
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	97.15
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	97.15
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	97.14
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	97.13
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.03
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.01
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.01
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	96.99
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	96.99
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	96.97
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	96.96
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	96.95
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	96.95
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	96.94
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	96.91
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	96.9
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	96.89
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	96.88
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	96.88
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	96.87
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	96.85
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	96.83
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	96.8
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	96.79
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	96.76
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	96.76
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	96.75
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	96.75
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	96.72
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	96.72
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	96.72
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	96.67
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	96.62
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	96.62
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	96.59
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	96.58
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	96.58
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	96.55
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	96.55
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	96.55
4b4t_T		274	26S proteasome regulatory subunit RPN12; hydrolase	96.54
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	96.52
1wi9_A		72	Protein C20ORF116 homolog; helix-turn-helix motif,	96.49
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	96.47
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	96.41
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	96.3
2kat_A		115	Uncharacterized protein; NESG, structure, structur	96.29
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	96.28
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	96.24
2l6j_A		111	TPR repeat-containing protein associated with HSP;	96.19
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	96.19
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	96.15
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	96.11
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	96.09
2l6j_A		111	TPR repeat-containing protein associated with HSP;	95.96
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	95.81
2kat_A		115	Uncharacterized protein; NESG, structure, structur	95.72
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	95.72
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	95.68
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	95.6
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	95.55
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	95.48
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	95.46
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	95.39
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	95.27
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	95.25
3lpz_A		336	GET4 (YOR164C homolog); protein targeting, tail-an	95.16
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	95.16
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	95.12
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	94.9
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	94.76
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	94.73
3k9i_A		117	BH0479 protein; putative protein binding protein,	94.53
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	94.19
1rz4_A		226	Eukaryotic translation initiation factor 3 subuni;	94.13
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	94.1
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	94.07
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	93.8
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	93.64
2wpv_A		312	GET4, UPF0363 protein YOR164C; golgi-ER traffickin	93.6
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	93.03
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	92.73
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	92.65
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	92.28
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	92.12
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	91.91
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	91.76
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	91.55
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	91.37
1pc2_A		152	Mitochondria fission protein; unknown function; NM	91.3
1xn7_A		78	Hypothetical protein YHGG; alpha+beta, GFT structu	91.23
1qgp_A		77	Protein (double stranded RNA adenosine deaminase);	90.92
2k02_A		87	Ferrous iron transport protein C; FEOC, iron-sulfu	90.49
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	89.97
1qbj_A		81	Protein (double-stranded RNA specific adenosine D	89.48
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	89.33
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	89.11
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	88.76
1klx_A		138	Cysteine rich protein B; structural genomics, heli	88.71
2jt1_A		77	PEFI protein; solution structure, winged helix-tur	88.35
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	88.19
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	87.74
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	87.64
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	87.4
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	87.36
2heo_A		67	Z-DNA binding protein 1; protein DLM1-Z-DNA comple	87.14
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	84.77
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	84.31
3t5v_A		316	Nuclear mRNA export protein SAC3; PCI, mRNA nuclea	83.69
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	83.22
2htj_A		81	P fimbrial regulatory protein KS71A; winged helix-	82.66

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

Probab=100.00  E-value=1.5e-60  Score=475.18  Aligned_cols=341  Identities=24%  Similarity=0.404  Sum_probs=316.2

Q ss_pred             hhhhHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCCCChhHHHHHHHHHHHHHHhh
Q 014350           50 AEWGFKALKQTVKLYYRLGKYKEMMDAYREMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNFSLLREFYQTTLKALEEA  129 (426)
Q Consensus        50 ~~~~~k~l~~l~~l~~~~~~~~~l~e~~~~l~~~~~~~~~k~~~~k~v~~il~~~~~~~~~~~~~~~~~~~~~l~~l~~~  129 (426)
                      .+....++.+++++|.++|+++++.++++.+++++ +.++|++++|+||+++|.++.+|+    ....++++|+++++|+
T Consensus        15 ~~~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~~~~kak~~k~v~~l~~~~~~~~~----~~~~~~~~~~~~~~~a   89 (394)
T 3txn_A           15 IRIKEQGILQQGELYKQEGKAKELADLIKVTRPFL-SSISKAKAAKLVRSLVDMFLDMDA----GTGIEVQLCKDCIEWA   89 (394)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCHHHHHHHHHHTTTGG-GGSCHHHHHHHHHHHHHHHTTSCC----CHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH-HHhchHHHHHHHHHHHHHHhcCCC----cHHHHHHHHHHHHHHH
Confidence            44578899999999999999999999999999999 999999999999999999999887    3578899999999999


Q ss_pred             hhh-hhHHH--HhHHHHHHHHHhccHHHHHHHHHHHHhhcccCCCCcchhhhhhHHHHHHHHHHHHHhhcCHHHHHHHHH
Q 014350          130 KNE-RLWFK--TNLKLCKIWFDMGEYGRMSKILKELHKSCQREDGTDDQKKGSQLLEVYAIEIQMYTETKNNKKLKQLYQ  206 (426)
Q Consensus       130 ~~~-kl~~r--~~~~La~~~~~~g~~~~A~~ll~el~~~~~~~~~~~d~~~~~~l~e~~l~e~rl~~~~~d~~kak~~l~  206 (426)
                      .++ |.|+|  ++.+||++|++.|+|.+|.+++.+++.+|.+.   ||   +..++|+++.|+++|+..+|+++++.+++
T Consensus        90 ~~~~r~flr~~l~~kL~~l~~~~~~y~~a~~~i~~l~~~~~~~---dd---~~~llev~lle~~~~~~~~n~~k~k~~l~  163 (394)
T 3txn_A           90 KQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKL---DD---KNLLVEVQLLESKTYHALSNLPKARAALT  163 (394)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTS---SC---THHHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhcc---cc---chhHHHHHHHHHHHHHHhccHHHHHHHHH
Confidence            876 57777  55599999999999999999999999999875   35   38999999999999999999999999999


Q ss_pred             HHHhhhccC-CChhHHHHHHHhhHHHhH-HhhcHHHHHHHHHHHHhhhhhhcchhHHHHHHHHHHHHHhhCCC--CCCCC
Q 014350          207 KALAIKSAI-PHPRIMGIIRECGGKMHM-AERQWADAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESE--VNPFD  282 (426)
Q Consensus       207 ~a~~i~~~~-~~p~~~~~i~~~~g~~~~-~~~~y~~A~~~f~ea~~~~~~~~~~~~~~~lky~~L~~lL~~~~--~~~~~  282 (426)
                      +|+++.+++ ++|.+++.+++|+|++|+ .+++|++|+++|+++|++|++.+++.+.++++|++||+||++++  ++++.
T Consensus       164 ~a~~~~~ai~~~p~i~a~i~~~~Gi~~l~~~rdyk~A~~~F~eaf~~f~~~~~~~~~~~lkYlvL~aLl~~~r~el~~~l  243 (394)
T 3txn_A          164 SARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLV  243 (394)
T ss_dssp             HHHHHHHHSCCCHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHTTCGGGHHHHH
T ss_pred             HHHhhhccCCCCHHHHHHHHHHhhHHHHHhccCHHHHHHHHHHHHhcccccccHHHHHHHHHHHHHHHHcCCHHHHHHHh
Confidence            999999998 679999999999999999 99999999999999999999999999999999999999999774  33333


Q ss_pred             c-ccccccCCCcccHHHHHHHHHHhhCCHHHHHHHHHHhHHHhcCChhHHHHHHHHHHHHHHHHHHHhccccccccchhH
Q 014350          283 G-QEAKPYKNDPEILAMTNLIAAYQRNEIIEFEKILKSNRKTIMDDPFIRNYIEDLLKNVRTQVLLKLIKPYTRIRIPFI  361 (426)
Q Consensus       283 s-~~~~~~~~~~~~~~l~~L~~af~~~dl~~f~~~l~~~~~~l~~D~~l~~~~~~L~~~l~~~~l~~i~~pYs~I~l~~i  361 (426)
                      + +...+| .+|+++|+..|+.+|+++|+..|..+++.+++.+..||++.+|+..|+++|+++|++++++||++|+|++|
T Consensus       244 ~~~~~~~~-~~pei~~l~~L~~a~~~~dl~~f~~iL~~~~~~l~~D~~l~~h~~~L~~~Ir~~~L~~i~~pYsrIsl~~i  322 (394)
T 3txn_A          244 SGKLAITY-SGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHV  322 (394)
T ss_dssp             HSHHHHTT-CSHHHHHHHHHHHHHHTTCHHHHHHHHHHSTTTTTTSHHHHHHHHHHHHHHHHHHHHHHHTTCSEEEHHHH
T ss_pred             cccccccc-CCccHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHHhHhhceeeHHHH
Confidence            3 334556 47999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHhCCChHHHHHHHHHhHHcCceeEEEecCCCEEEEecCc
Q 014350          362 SKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRS  402 (426)
Q Consensus       362 A~~l~l~~~evE~~l~~lI~~g~i~akID~~~g~v~~~~~~  402 (426)
                      |+.||+|++++|++|++||.+|+|+|+|||++|+|++.+++
T Consensus       323 A~~l~ls~~evE~~L~~lI~dg~I~a~IDq~~giv~~~~~~  363 (394)
T 3txn_A          323 AESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEET  363 (394)
T ss_dssp             HHHHTCCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCC-
T ss_pred             HHHHCcCHHHHHHHHHHHHHCCCeeEEEcCCCCEEEECCCc
Confidence            99999999999999999999999999999999999998873

PyMOL of 3txn

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens}	Back alignment and structure

>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62	Back alignment and structure

>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19	Back alignment and structure

>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2}	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>3t5v_A Nuclear mRNA export protein SAC3; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		426
d1ufma_		84	a.4.5.47 (A:) COP9 signalosome complex subunit 4,	6e-13

>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84	Back information, alignment and structure


class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 61.7 bits (150), Expect = 6e-13
 Identities = 16/61 (26%), Positives = 29/61 (47%)

Query: 337 LLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLL 396
           L + V    LL   K Y  I    +   L +P    E++   +I + R++G IDQ++ ++
Sbjct: 12  LDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIV 71

Query: 397 E 397
            
Sbjct: 72  H 72

PyMOL of d1ufma_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		426
d1ufma_		84	COP9 signalosome complex subunit 4, GSN4 {Mouse (M	99.66
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.06
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.86
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.68
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	98.66
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	98.28
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	98.24
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	98.16
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	97.96
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	97.78
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	97.76
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.59
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	97.57
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	97.56
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	97.53
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.51
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.48
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	97.44
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.42
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.29
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	97.14
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	97.13
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.05
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	97.03
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	96.87
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	96.82
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	96.77
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	96.72
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	96.71
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	96.71
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	96.48
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	96.3
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	96.29
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	96.24
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	96.15
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	96.08
d1wi9a_		72	Hypothetical protein C20orf116 homolog {Mouse (Mus	96.05
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	95.62
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	95.62
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	95.38
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	95.18
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	95.03
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	94.95
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	94.78
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	94.66
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	94.56
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	93.96
d2cfxa1		63	Transcriptional regulator LrpC {Bacillus subtilis	93.38
d2cg4a1		63	Regulatory protein AsnC {Escherichia coli [TaxId:	92.79
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	91.07
d2cyya1		60	Putative transcriptional regulator PH1519 {Archaeo	90.39
d1i1ga1		60	LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]}	90.06
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	89.66
d1z05a1		71	Transcriptional regulator VC2007 N-terminal domain	88.52
d1z6ra1		70	Mlc protein N-terminal domain {Escherichia coli [T	86.91
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	86.6
d1dpua_		69	C-terminal domain of RPA32 {Human (Homo sapiens) [	86.21
d3bwga1		78	Transcriptional regulator YydK {Bacillus subtilis	83.42
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	82.49
d2hs5a1		69	Putative transcriptional regulator RHA1_ro03477 {R	81.57

>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.66  E-value=3.1e-17  Score=125.21  Aligned_cols=68  Identities=26%  Similarity=0.411  Sum_probs=64.9

Q ss_pred             HHHHHHHHHHHHHhccccccccchhHHhHhCCChHHHHHHHHHhHHcCceeEEEecCCCEEEEecCch
Q 014350          336 DLLKNVRTQVLLKLIKPYTRIRIPFISKELNVPEKDVEQLLVSLILDNRIDGHIDQVNRLLERGDRSA  403 (426)
Q Consensus       336 ~L~~~l~~~~l~~i~~pYs~I~l~~iA~~l~l~~~evE~~l~~lI~~g~i~akID~~~g~v~~~~~~~  403 (426)
                      -|++++++|||+.+.+||++|+|++||++|++|++++|.+|++||.+|+|+|+|||++|+|+|.+++.
T Consensus        11 ~L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~   78 (84)
T d1ufma_          11 ILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA   78 (84)
T ss_dssp             CCCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSC
T ss_pred             HHHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCc
Confidence            36789999999999999999999999999999999999999999999999999999999999988754

PyMOL of d1ufma_

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]}	Back information, alignment and structure