Citrus Sinensis ID: 014403

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----
MPSNYLGSPVLKSSQFAGRFLGGKEVRLLDGESFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
ccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccEEEEEEEccEEEEEccEEEEEEccccccEEEEEEEEEcccccEEEEEEEEccccccccccccccccccEEEEcccccEEccEEEEEEEEEcccccHHccccccccccccEEEEEEEEcccccEEEEccccccccHHEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEEEEEEEcccEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEEEEccccEEEEEccc
ccccccccccccccHHHHHHHcccccccccccccccccHHHHccccccEEEcccccHHcccccccHHEEEccEEEEEccEEEEEccccccEEEEEEEcEEcccccEEEEEEEEEcHHHccccccccccccEEEEEcccccccEEEEcccEEEEcHHHHHHHHcccccccccEEEEEEEEcccccccccHHHccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccEccccEEEEEEcccccEEEEEEEEEEEEcccEEEEEEcccccccccccccEEEEHHHHHccccccccEccccccccccccccccccEEEEEcccEEEEEEccccEEEEEEEEccccEEEEEccc
mpsnylgspvlkssqfagrflggkevrlldgesfkdvqsgtlgQYTKEFLWLGSSWMSRKKRKHYQsfcrngvkvsVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDevgiflphnfndrEIFFSLCLQDLSIECIDGlatvlspqhfekfmneatypqlqpficdkqfenddvkpfdiTLVKGYWRQEIIRHLftftspkncsssqqpfdgqrAEKIVNDVVEtrpkkrlrqskdadvcdytnrkepmdaacmdlkistkssvdggvgtlAGVGGAAllskkeadpssqylkvgshvevlsqdsgmrgcwyRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASrvaapdqlglrvsgrrivrpspeshkgrvsWAIDVGTIVDAWWHDGWWEGIVIqkdsedklhvyfpg
mpsnylgspvlkssqfaGRFLGGKEVRLLDGesfkdvqsgtlgqYTKEFLWLGSSWMSRKKRKHYQsfcrngvkvsVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKncsssqqpfdgqraEKIVNDvvetrpkkrlrqskdadvcdytnrkepmdaACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVevlsqdsgmrgCWYRAsvikkhkdkvKVRYNDVQDAADEVNLLEEWVLAsrvaapdqlglrvsgrrivrpspeshkgrvswaIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
MPSNYLGSPVLKSSQFAGRFLGGKEVRLLDGESFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSvdggvgtlagvggaallSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
***************FAGRFLGGKEVRLLDGESFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFT******************************************************CMDLKI*****VDGGVGTLAGVGGAAL***********YLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIV********GRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVY***
**SNYL********************************************WLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIF*PHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIR*****************************************************************************TLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVA****************************AIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
********PVLKSSQFAGRFLGGKEVRLLDGESFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSP************QRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
********************************SFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTS***************************************************************************************PSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSNYLGSPVLKSSQFAGRFLGGKEVRLLDGESFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVCDYTNRKEPMDAACMDLKISTKSSVDGGVGTLAGVGGAALLSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query425
359472972 731 PREDICTED: uncharacterized protein LOC10 0.922 0.536 0.641 1e-146
224108500 598 predicted protein [Populus trichocarpa] 0.910 0.647 0.632 1e-142
147856929 669 hypothetical protein VITISV_000033 [Viti 0.868 0.551 0.621 1e-139
224101713 629 predicted protein [Populus trichocarpa] 0.811 0.548 0.610 1e-135
255576463 685 DNA binding protein, putative [Ricinus c 0.948 0.588 0.591 1e-134
356577654 669 PREDICTED: uncharacterized protein LOC10 0.910 0.578 0.580 1e-124
449520461 692 PREDICTED: uncharacterized protein LOC10 0.950 0.583 0.548 1e-122
449467377 692 PREDICTED: uncharacterized protein LOC10 0.950 0.583 0.548 1e-122
357488501 685 Agenet and bromo-adjacent homology (BAH) 0.912 0.566 0.553 1e-119
297838619 649 hypothetical protein ARALYDRAFT_475982 [ 0.861 0.563 0.526 1e-101
>gi|359472972|ref|XP_002279093.2| PREDICTED: uncharacterized protein LOC100242253 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  525 bits (1351), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/402 (64%), Positives = 313/402 (77%), Gaps = 10/402 (2%)

Query: 32  ESFKDVQSGTLGQYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRL 91
           +S KD+Q   LG +TKEFLWLGS W  RK+R HYQSF RNG+K+SVHDFVYVLAEE+KRL
Sbjct: 120 DSLKDIQLQRLGHFTKEFLWLGSPWTCRKRRNHYQSFRRNGIKISVHDFVYVLAEEDKRL 179

Query: 92  IAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLAT 151
           +AYLEDMYEDSRGN+MVVVRWFHKIDEVGI LP NFNDREIFFSLC QDLSIECIDGLAT
Sbjct: 180 VAYLEDMYEDSRGNRMVVVRWFHKIDEVGIVLPLNFNDREIFFSLCHQDLSIECIDGLAT 239

Query: 152 VLSPQHFEKFMNEATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPK 211
           VL PQHFEKF+NEAT+ QL+PF+C KQF+ND+VKPFDIT VKGYW+QEI+R+++T T   
Sbjct: 240 VLGPQHFEKFLNEATHTQLEPFVCHKQFDNDEVKPFDITQVKGYWKQEILRYMYTSTLMP 299

Query: 212 NCSSSQQPFDGQRAEKIVNDVVETRPKKRLRQSKDADVC-DYTNRKEPMDAACMDLKIST 270
           +  S  Q  D    E  +ND   +RP KR  +S+DAD C   TN++E +D +  + +  +
Sbjct: 300 DVRS--QSSDDVGVEGNLNDASGSRPNKRHCRSEDADACLQLTNKEESVDTSRANFQNIS 357

Query: 271 KSSVD--GGVGTLAGVGGAAL--LSKKEA--DPSSQYLKVGSHVEVLSQDSGMRGCWYRA 324
            S +D      T A   G+A+  + +KEA      Q+L +GS VEVLSQDSG+RGCW RA
Sbjct: 358 NSLIDYRNEPETCALKDGSAVPFIHRKEAIIQKLPQFLAIGSQVEVLSQDSGIRGCWLRA 417

Query: 325 SVIKKHKDKVKVRYNDVQDAADEVNLLEEWVLASRVAAPDQLGLRVSGRRIVRPSPE-SH 383
            +IKKH+ KVKVRY D+ DAADE + LEEW+LASRVA PD+ GLR+ GR  +RP P  S+
Sbjct: 418 LIIKKHRCKVKVRYQDIMDAADETSNLEEWILASRVAVPDESGLRICGRTTIRPPPPGSN 477

Query: 384 KGRVSWAIDVGTIVDAWWHDGWWEGIVIQKDSEDKLHVYFPG 425
           KGRVSWA DVG++VDAWWHDGWWEGIV+QK+SED++HVYFPG
Sbjct: 478 KGRVSWAFDVGSVVDAWWHDGWWEGIVVQKESEDRIHVYFPG 519

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224108500|ref|XP_002314870.1| predicted protein [Populus trichocarpa] gi|222863910|gb|EEF01041.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147856929|emb|CAN78632.1| hypothetical protein VITISV_000033 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101713|ref|XP_002312391.1| predicted protein [Populus trichocarpa] gi|222852211|gb|EEE89758.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255576463|ref|XP_002529123.1| DNA binding protein, putative [Ricinus communis] gi|223531402|gb|EEF33236.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356577654|ref|XP_003556939.1| PREDICTED: uncharacterized protein LOC100817358 [Glycine max] Back     alignment and taxonomy information
>gi|449520461|ref|XP_004167252.1| PREDICTED: uncharacterized protein LOC101229627 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449467377|ref|XP_004151400.1| PREDICTED: uncharacterized protein LOC101211122 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357488501|ref|XP_003614538.1| Agenet and bromo-adjacent homology (BAH) domain-containing protein-like protein [Medicago truncatula] gi|355515873|gb|AES97496.1| Agenet and bromo-adjacent homology (BAH) domain-containing protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297838619|ref|XP_002887191.1| hypothetical protein ARALYDRAFT_475982 [Arabidopsis lyrata subsp. lyrata] gi|297333032|gb|EFH63450.1| hypothetical protein ARALYDRAFT_475982 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query425
TAIR|locus:2026874 648 AT1G68580 [Arabidopsis thalian 0.861 0.564 0.513 8.4e-97
TAIR|locus:2162117 663 AT5G55600 [Arabidopsis thalian 0.896 0.574 0.348 1.5e-53
TAIR|locus:2130878 2037 G2484-1 "G2484-1 protein" [Ara 0.275 0.057 0.330 1.8e-07
TAIR|locus:2203018 517 AT1G09320 [Arabidopsis thalian 0.254 0.208 0.348 6.3e-06
TAIR|locus:2197985 695 AT1G26540 [Arabidopsis thalian 0.242 0.148 0.284 0.00071
TAIR|locus:2026874 AT1G68580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 962 (343.7 bits), Expect = 8.4e-97, P = 8.4e-97
 Identities = 197/384 (51%), Positives = 251/384 (65%)

Query:    44 QYTKEFLWLGSSWMSRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSR 103
             Q  K F W+G SW  RK+RKHYQS+ RNGV++SV+DFVYVLAE++KRL+AY+ED+YEDS+
Sbjct:   120 QQIKTFSWMGFSWTCRKRRKHYQSYLRNGVRISVNDFVYVLAEQHKRLVAYIEDLYEDSK 179

Query:   104 GNKMVVVRWFHKIDEVGIFLPHNFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMN 163
             G KMVVVRWFHK +EVG  L  + NDREIFFSL  QD+SIECID LATVLSPQH+EKF+ 
Sbjct:   180 GKKMVVVRWFHKTEEVGSVLSDDDNDREIFFSLNRQDISIECIDYLATVLSPQHYEKFLK 239

Query:   164 EATYPQLQPFICDKQFENDDVKPFDITLVKGYWRQEIIRHLFTFTSPKNCSSSQQPFDGQ 223
                + Q   F C K + +D +KP+DIT ++GYWRQE++R+L   +  K+   +Q P    
Sbjct:   240 VPMHVQTVAFFCQKLYGDDGLKPYDITQLEGYWRQEMLRYL-NVSILKSFEGAQAPGTDP 298

Query:   224 RAEKIVNDVVETRPKKRLRQSKDADV-CDYTNRKEPMDAACMDLKISTKSSXXXXXXXXX 282
               +  +   V  R +KR R S    +   Y            D+K   KSS         
Sbjct:   299 GLKAPLVGCVGIRSRKRRRPSPVGTLNVSYAG----------DMKGDCKSSPDSVLAVTD 348

Query:   283 XXXXXXXXSKKEADPSSQYLKVGSHVEVLSQDSGMRGCWYRASVIKKHKDKVKVRYNDVQ 342
                      K + D SS ++K GS +EVLS+DSG+RGCW++A V+KKHKDKVKV+Y D+Q
Sbjct:   349 ASIF-----KGDEDGSSHHIKKGSLIEVLSEDSGIRGCWFKALVLKKHKDKVKVQYQDIQ 403

Query:   343 DAADEVNLLEEWVLASRVAAPDQLG-LRVSGRRIVRPSPESHKGRVSWAIDVGTIVDAWW 401
             DA DE   LEEW+L SRVAA D LG LR+ GR++VRP  +  K      I VG  VD WW
Sbjct:   404 DADDESKKLEEWILTSRVAAGDHLGDLRIKGRKVVRPMLKPSKENDVCVIGVGMPVDVWW 463

Query:   402 HDGWWEGIVIQKDSEDKLHVYFPG 425
              DGWWEGIV+Q+ SE+K  VY PG
Sbjct:   464 CDGWWEGIVVQEVSEEKFEVYLPG 487
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009506 "plasmodesma" evidence=IDA
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
TAIR|locus:2162117 AT5G55600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130878 G2484-1 "G2484-1 protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203018 AT1G09320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197985 AT1G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query425
cd04721130 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol 2e-59
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 7e-14
pfam0564166 pfam05641, Agenet, Agenet domain 2e-11
pfam01426120 pfam01426, BAH, BAH domain 2e-10
smart00439121 smart00439, BAH, Bromo adjacent homology domain 2e-09
smart0074359 smart00743, Agenet, Tudor-like domain present in p 2e-07
cd04713146 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol 1e-06
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 4e-04
cd04719128 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent 0.002
cd04715159 cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Ho 0.003
>gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information 
 Score =  189 bits (482), Expect = 2e-59
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 2/130 (1%)

Query: 68  FCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFL-PHN 126
           FCRNGV +SVHDFVYVL+EE  R +AY+ED+YED +G+KMV VRWFH  DEVG  L P +
Sbjct: 1   FCRNGVTISVHDFVYVLSEEEDRYVAYIEDLYEDKKGSKMVKVRWFHTTDEVGAALSPDS 60

Query: 127 FNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYP-QLQPFICDKQFENDDVK 185
            N REIF S  LQ +S+ECIDGLATVL+ +H+EKF +      +LQ + C +Q +N+ VK
Sbjct: 61  VNPREIFLSPNLQVISVECIDGLATVLTREHYEKFQSVPKNSSELQAYFCYRQIDNNKVK 120

Query: 186 PFDITLVKGY 195
           PFDIT ++GY
Sbjct: 121 PFDITQLRGY 130

BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 130
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|218672 pfam05641, Agenet, Agenet domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|214798 smart00743, Agenet, Tudor-like domain present in plant sequences Back     alignment and domain information
>gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>gnl|CDD|240070 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>gnl|CDD|240066 cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 425
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 100.0
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 99.93
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 99.93
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.87
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 99.84
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.84
smart00439120 BAH Bromo adjacent homology domain. 99.81
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 99.81
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 99.79
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 99.79
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.75
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 99.73
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.63
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 99.63
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 99.6
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 99.58
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 99.54
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 99.53
KOG1886464 consensus BAH domain proteins [Transcription] 99.38
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 99.13
smart0074361 Agenet Tudor-like domain present in plant sequence 98.83
smart0074361 Agenet Tudor-like domain present in plant sequence 98.56
KOG1827629 consensus Chromatin remodeling complex RSC, subuni 97.86
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 97.64
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 96.47
PF15057124 DUF4537: Domain of unknown function (DUF4537) 96.26
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 95.92
PF1214885 DUF3590: Protein of unknown function (DUF3590); In 94.51
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 94.28
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 94.01
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 93.88
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 89.73
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 89.57
PF00567121 TUDOR: Tudor domain; InterPro: IPR008191 There are 88.24
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 86.65
PF07039130 DUF1325: SGF29 tudor-like domain; InterPro: IPR010 85.28
PLN00104 450 MYST -like histone acetyltransferase; Provisional 83.32
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 81.27
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information 
Probab=100.00  E-value=5.6e-42  Score=302.62  Aligned_cols=128  Identities=59%  Similarity=1.065  Sum_probs=124.4

Q ss_pred             eeeCCeEEEeeeEEEEEeccccchhhhhHhhhhccCCCeeEEEEEeeeccccceecCCC-CCCceEEeecccceeeeeee
Q 014403           68 FCRNGVKVSVHDFVYVLAEENKRLIAYLEDMYEDSRGNKMVVVRWFHKIDEVGIFLPHN-FNDREIFFSLCLQDLSIECI  146 (425)
Q Consensus        68 f~r~G~~i~v~dfV~v~~e~~~~~vayvEdmyED~~~~k~v~VRWF~~~~E~~~~lp~~-~~~~Evf~s~~~q~is~ecI  146 (425)
                      |||||++|+|||||||+++++++|||+||+||||.+|.+||+||||++++|+.+.+|+. ++++|||+|++.|+++++||
T Consensus         1 ~~r~~~~i~vGD~V~v~~~~~~~~va~Ie~i~ed~~g~~~v~v~WF~~p~E~~~~~~~~~~~~~EvFlS~~~d~i~~~~I   80 (130)
T cd04721           1 FCRNGVTISVHDFVYVLSEEEDRYVAYIEDLYEDKKGSKMVKVRWFHTTDEVGAALSPDSVNPREIFLSPNLQVISVECI   80 (130)
T ss_pred             CccCCEEEECCCEEEEeCCCCCcEEEEEEEEEEcCCCCEEEEEEEecCHHHhccccCCCCCCCCeEEEcCCccccchHHe
Confidence            89999999999999999999999999999999999999999999999999999999987 99999999999999999999


Q ss_pred             eccceeeChhhHHhhhhhcCC-CCCceEEEEeeccCCCcceeeeecccee
Q 014403          147 DGLATVLSPQHFEKFMNEATY-PQLQPFICDKQFENDDVKPFDITLVKGY  195 (425)
Q Consensus       147 dg~a~Vlt~~hy~k~~~~~~~-~~~~~~~C~~q~~n~~vkpFdit~l~GY  195 (425)
                      +|+|+|||++||+|+.++.++ +...+|+|+|+|+++++||||+++||||
T Consensus        81 ~gk~~Vls~~~y~k~~~~~~~~~~~~~f~C~~~~d~~~~~~fd~~~~~g~  130 (130)
T cd04721          81 DGLATVLTREHYEKFQSVPKNSSELQAYFCYRQIDNNKVKPFDITQLRGY  130 (130)
T ss_pred             eeeeEECCHHHHhhhhccccCccccccEEEEEEecCCCCceeeeeccccC
Confidence            999999999999999998877 5689999999999999999999999998

BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>PF12148 DUF3590: Protein of unknown function (DUF3590); InterPro: IPR021991 This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>PF00567 TUDOR: Tudor domain; InterPro: IPR008191 There are multiple copies of this domain in the Drosophila melanogaster tudor protein and it has been identified in several RNA-binding proteins [] Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>PF07039 DUF1325: SGF29 tudor-like domain; InterPro: IPR010750 SAGA-associated factor 29 is involved in transcriptional regulation, probably through association with histone acetyltransferase (HAT) complexes like the TFTC-HAT or STAGA complexes Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query425
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 2e-30
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 7e-25
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 2e-13
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query425
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 99.94
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.82
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.81
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 99.8
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 99.5
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 99.35
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.31
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.11
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 98.75
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 98.73
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 98.37
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 97.56
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 97.53
3sd4_A69 PHD finger protein 20; tudor domain, transcription 97.18
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 97.16
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 97.13
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 97.08
2d9t_A78 Tudor domain-containing protein 3; structural geno 97.04
3ask_A 226 E3 ubiquitin-protein ligase UHRF1; histone reader 96.93
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 96.88
1oz2_A 331 Lethal(3)malignant brain tumor-like protein; prope 96.83
3s6w_A54 Tudor domain-containing protein 3; methylated argi 96.76
2eqk_A85 Tudor domain-containing protein 4; structural geno 96.7
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 96.69
2lcc_A76 AT-rich interactive domain-containing protein 4A; 96.67
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 96.66
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 96.66
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 96.57
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 96.53
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 96.48
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 96.48
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.37
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 95.99
3dlm_A 213 Histone-lysine N-methyltransferase setdb1; setdb1_ 95.85
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 94.72
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 95.61
3qii_A85 PHD finger protein 20; tudor domain, structural ge 95.56
2diq_A110 Tudor and KH domain-containing protein; tudor doma 95.49
3ut1_A 324 Lethal(3)malignant brain tumor-like protein 3; chr 95.26
3feo_A 437 MBT domain-containing protein 1; MBTL1, structural 95.23
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 94.99
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 94.93
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 93.83
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 94.8
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 94.18
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 94.18
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 93.74
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 93.56
2lcd_A118 AT-rich interactive domain-containing protein 4A; 92.42
3feo_A 437 MBT domain-containing protein 1; MBTL1, structural 93.2
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 93.04
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 92.95
2bud_A92 Males-absent on the first protein; transferase, MO 92.72
3f70_A 456 Lethal(3)malignant brain tumor-like 2 protein; MBT 92.71
3qii_A85 PHD finger protein 20; tudor domain, structural ge 92.66
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 92.58
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 92.55
3sd4_A69 PHD finger protein 20; tudor domain, transcription 92.48
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 92.18
3mp6_A522 MBP, SGF29, maltose-binding periplasmic protein, l 91.97
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 91.93
3mea_A180 SAGA-associated factor 29 homolog; structural geno 91.2
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 91.09
3f70_A 456 Lethal(3)malignant brain tumor-like 2 protein; MBT 91.07
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 90.8
3s6w_A54 Tudor domain-containing protein 3; methylated argi 90.33
3h6z_A 447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 90.27
3h6z_A 447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 90.09
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 89.27
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 88.57
2d9t_A78 Tudor domain-containing protein 3; structural geno 87.81
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 87.34
3bdl_A570 Staphylococcal nuclease domain-containing protein 87.28
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 86.82
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 86.57
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 86.44
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 86.44
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 86.32
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 85.74
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 85.4
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 85.61
2k3y_A136 Chromatin modification-related protein EAF3; dimet 84.98
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 84.51
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 82.87
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 81.51
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 81.11
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 81.42
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2lcd_A AT-rich interactive domain-containing protein 4A; tudor domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>3mea_A SAGA-associated factor 29 homolog; structural genomics consortium, SGC, nucleus, transcription, transcription regulation, chromosomal protein, DNA-binding; HET: M3L; 1.26A {Homo sapiens} PDB: 3meu_A* 3met_A* 3me9_A* 3mev_A* 3lx7_A 3mew_A Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 425
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 1e-06
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 46.9 bits (111), Expect = 1e-06
 Identities = 25/177 (14%), Positives = 46/177 (25%), Gaps = 29/177 (16%)

Query: 58  SRKKRKHYQSFCRNGVKVSVHDFVYVLAEENKRLIAYL---------------------- 95
              K +HY     +G+K+   D V +  E       Y+                      
Sbjct: 36  RGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLR 95

Query: 96  --EDMYEDSRGNKMVVVRWFHKIDE-VGIFLPHNFNDREIFFSLCLQDLSIECIDGLATV 152
             E                 ++             N  E++ +  L +L +     +A V
Sbjct: 96  WFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANV 155

Query: 153 LSPQHFEKFMNEATYPQLQPFICDKQFENDDVK--PFDITLVKGYWRQEIIRHLFTF 207
           +    +E         +   F      E    K    +I  VK Y ++   R    +
Sbjct: 156 MDGSKWEVLKGNVDPERD--FTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEY 210

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query425
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 99.23
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 97.1
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 96.69
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 96.63
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 96.12
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 95.71
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 95.46
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 95.31
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 95.11
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 94.99
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 94.43
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 94.14
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 94.07
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 94.04
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 90.2
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 89.68
d1wjra_127 Scm-like with four MBT domains protein 2, SFMBT2 ( 88.23
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 85.28
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 85.1
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.23  E-value=1.2e-13  Score=128.35  Aligned_cols=126  Identities=14%  Similarity=0.193  Sum_probs=98.6

Q ss_pred             CCeEEEeeeEEEEEecccc-chhhhhHhhhhcc-----------------------CCCeeEEEEEeeecccc-ceecCC
Q 014403           71 NGVKVSVHDFVYVLAEENK-RLIAYLEDMYEDS-----------------------RGNKMVVVRWFHKIDEV-GIFLPH  125 (425)
Q Consensus        71 ~G~~i~v~dfV~v~~e~~~-~~vayvEdmyED~-----------------------~~~k~v~VRWF~~~~E~-~~~lp~  125 (425)
                      -|+++++||.|||-+++.+ .+|+.|+++=...                       .++++++++||.+++|. ..+.++
T Consensus        49 D~~e~~~GD~Vlvk~~~~~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~~~~~~w~~~p~e~~~~k~r~  128 (217)
T d1m4za_          49 DGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSE  128 (217)
T ss_dssp             TCCEECTTCEEEEEETTTTEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHHCHHHHHSCCCHHHHHHHHHH
T ss_pred             CCeEEecCCEEEEeCCCCCCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhcccceeeecCchhhhhhcccc
Confidence            5899999999999988866 5777777753222                       24566666777777774 345556


Q ss_pred             CCCCceEEeecccceeeeeeeeccceeeChhhHHhhhhhcCCCCCceEEEEeeccC--CCcceeeeeccceehHh
Q 014403          126 NFNDREIFFSLCLQDLSIECIDGLATVLSPQHFEKFMNEATYPQLQPFICDKQFEN--DDVKPFDITLVKGYWRQ  198 (425)
Q Consensus       126 ~~~~~Evf~s~~~q~is~ecIdg~a~Vlt~~hy~k~~~~~~~~~~~~~~C~~q~~n--~~vkpFdit~l~GY~~Q  198 (425)
                      ..+++|||+|+++.+|.+++|.|+|.||+++.|+.+....  .....|||++.|+.  .+++|+||..+.....+
T Consensus       129 ~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~~~~~--~~~~~F~cr~~~D~~~~~f~~id~~~~~~~~~~  201 (217)
T d1m4za_         129 TANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNV--DPERDFTVRYICEPTGEKFVDINIEDVKAYIKK  201 (217)
T ss_dssp             HSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHHGGGC--CTTTEEEEEEECCTTSCCCEECCHHHHHHHHTT
T ss_pred             ccCcceeEecCccceeehhheeeeEEEecHHHhcchhhcc--CCCCeEEEEEEEcCCCCceeeccHHHhhhhccc
Confidence            7899999999999999999999999999999998665431  13578999999996  49999998887766533
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure