Citrus Sinensis ID: 014533

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MAFHHNHLSQDLPLHHFTDQQQQQQQQPPSPPQQQHHQHQQSIETTAPNWLNSALLRSQQAQQQAAHFSDTNFLNLRTTANNNNSNNNNTASDSDASQTPNQWLSRTSSSLLHRNHSDVIDDVTPANDSIIAAVESADLKNANSENMNNASTNNKSEGVVVESGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGTGATMSDDDEDQVDSDANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR
ccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHcccc
ccccccccccccccccccHHHccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHcccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccEEEEccccc
mafhhnhlsqdlplhhftdqqqqqqqqppsppqqqhhqhqQSIETTAPNWLNSALLRSQQAQQQAAhfsdtnflnlrttannnnsnnnntasdsdasqtpnqwlsrtsssllhrnhsdviddvtpanDSIIAAVESAdlknansenmnnastnnksegvvvesgadgvVNWQNARYKAEILSHPLYEQLLSAHVACLRiatpvdqlprIDAQLAQSQHVVSKYSalgagqglvtddKELDQFMQHVRVHAMEAVMACWEIEQSLqsltgvspgegtgatmsdddedqvdsdanlfdgslegpdtmgfgplipteSERSLMERVRQELKHELKQGYKEKIVDIREEILRKRragklpgdttSVLKSWWqshskwpypteedKARLVQETGLQLKQINNWFINqrkrnwhsnpststvlkskrkr
MAFHHNHLSQDLPLHHFTDQQQQQQQQPPSPPQQQHHQHQQSIETTAPNWLNSALLRSQQAQQQAAHFSDTNFLNLRTTANNNnsnnnntasdsdasqtpNQWLSRTSSSLLHRNHSDVIDDVTPANDSIIAAVESAdlknansenmnnastnnksegvVVESGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGTGATMSDDDEDQVDSDANLFDGslegpdtmgfgpLIPTESERSLMERVRQELKhelkqgykekivDIREEIlrkrragklpgdttsvlkswwqshskwpypteeDKARLVQETGLQLKQINNWFinqrkrnwhsnpststvlkskrkr
MAFHHNHLSQDLPLHHFTDqqqqqqqqppsppqqqhhqhqqsIETTAPNWLNSALLRSqqaqqqaaHFSDTNFLNLRttannnnsnnnntasdsdasQTPNQWLSRTSSSLLHRNHSDVIDDVTPANDSIIAAVESADLknansenmnnastnnkseGVVVESGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGTGATMSdddedqvdsdANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR
***************************************************************************************************************************************************************VVESGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSL**********************************************************************YKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR********************
*************************************************WLNSAL**************************************************************************************************************************AEILSHPLYEQLLSAHVACLRIATPVDQLPRIDA****************************DQFMQHVRVHAMEAVMACWEIEQSLQS**********************DSD********************************************************************TSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW****************
********SQDLPLHHF**************************ETTAPNWLNSALL***********FSDTNFLNLRTTANNNNSNNN***************LSRTSSSLLHRNHSDVIDDVTPANDSIIAAVESADLKNANSENMNNASTNNKSEGVVVESGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGTGATMSDDDEDQVDSDANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHS**************
********************************************TTAPNWLNSALLRSQQAQQQAAHFSDTNFLNLRTTANNNN*********************RTSSSLLHRNHSDVIDDVTPANDSIIAAVESADLKNANS*************************NWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSLQSLTG****************************************************RVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSN*S***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFHHNHLSQDLPLHHFTDQQQQQQQQPPSPPQQQHHQHQQSIETTAPNWLNSALLRSQQAQQQAAHFSDTNFLNLRTTANNNNSNNNNTASDSDASQTPNQWLSRTSSSLLHRNHSDVIDDVTPANDSIIAAVESADLKNANSENMNNASTNNKSEGVVVESGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQGLVTDDKELDQFMQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGTGATMSDDDEDQVDSDANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query423 2.2.26 [Sep-21-2011]
P48000431 Homeobox protein knotted- yes no 0.931 0.914 0.690 1e-156
O04136427 Homeobox protein knotted- N/A no 0.936 0.927 0.702 1e-151
P48001393 Homeobox protein knotted- no no 0.841 0.905 0.638 1e-137
O22300426 Homeobox protein knotted- N/A no 0.858 0.852 0.604 1e-118
Q0J6N4374 Homeobox protein knotted- yes no 0.579 0.655 0.794 1e-117
P48002383 Homeobox protein knotted- no no 0.846 0.934 0.540 1e-115
Q0E3C3313 Homeobox protein knotted- yes no 0.581 0.785 0.712 1e-102
Q94LW4323 Homeobox protein knotted- yes no 0.560 0.733 0.707 1e-99
Q9FPQ8291 Homeobox protein knotted- no no 0.605 0.879 0.635 4e-96
P46606294 Homeobox protein HD1 OS=B N/A no 0.588 0.846 0.643 3e-94
>sp|P48000|KNAT3_ARATH Homeobox protein knotted-1-like 3 OS=Arabidopsis thaliana GN=KNAT3 PE=1 SV=1 Back     alignment and function desciption
 Score =  552 bits (1422), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 308/446 (69%), Positives = 337/446 (75%), Gaps = 52/446 (11%)

Query: 1   MAFHHNHLSQDLPLHHFTDQQQQQQQQPPSPPQQQHHQHQQSIETTAPNWLNSALLRSQQ 60
           MAFHHNHLSQDL  +HFTDQ Q    QPP PP QQ    Q   E   PNWLN+ALLRS  
Sbjct: 1   MAFHHNHLSQDLSFNHFTDQHQPPPPQPPPPPPQQQQHFQ---EAPPPNWLNTALLRSSD 57

Query: 61  AQQQAAHFSDTNFLNLRTTANNNNSNNNNTASDSDASQTP-NQWLSRTSSSLLHRNH--- 116
                   ++ NFLNL T   N  + +++ +  S A+    NQWLSR SSS L RN+   
Sbjct: 58  --------NNNNFLNLHTATANTTTASSSDSPSSAAAAAAANQWLSR-SSSFLQRNNNNN 108

Query: 117 ----SDVIDDVTPANDSIIAAVESADLKNANSENMNNASTNNKSEGVVVESGADGVVNWQ 172
                D IDDVT   D++I      ++K    EN N+             + ADGVV+WQ
Sbjct: 109 ASIVGDGIDDVTGGADTMI----QGEMKTGGGENKNDGGG---------ATAADGVVSWQ 155

Query: 173 NARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAG-QG 231
           NAR+KAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVV+KYSALGA  QG
Sbjct: 156 NARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVAKYSALGAAAQG 215

Query: 232 LVTDDKELDQFM---------------QHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGT 276
           LV DDKELDQFM               QHVRVHAMEAVMACWEIEQSLQSLTGVSPGEG 
Sbjct: 216 LVGDDKELDQFMTHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGM 275

Query: 277 GATMSDDDEDQVDSDANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQELKHELKQGYK 336
           GATMSDD+++QV+SDAN+FDG L   D +GFGPLIPTESERSLMERVRQELKHELKQGYK
Sbjct: 276 GATMSDDEDEQVESDANMFDGGL---DVLGFGPLIPTESERSLMERVRQELKHELKQGYK 332

Query: 337 EKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQIN 396
           EKIVDIREEILRKRRAGKLPGDTTSVLK+WWQSHSKWPYPTEEDKARLVQETGLQLKQIN
Sbjct: 333 EKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQIN 392

Query: 397 NWFINQRKRNWHSNPSTSTVLKSKRK 422
           NWFINQRKRNWHSNPS+STVLK+KRK
Sbjct: 393 NWFINQRKRNWHSNPSSSTVLKNKRK 418

Arabidopsis thaliana (taxid: 3702)
>sp|O04136|KNAP3_MALDO Homeobox protein knotted-1-like 3 OS=Malus domestica PE=2 SV=1 Back     alignment and function description
>sp|P48001|KNAT4_ARATH Homeobox protein knotted-1-like 4 OS=Arabidopsis thaliana GN=KNAT4 PE=2 SV=3 Back     alignment and function description
>sp|O22300|LET12_SOLLC Homeobox protein knotted-1-like LET12 OS=Solanum lycopersicum GN=LET12 PE=2 SV=1 Back     alignment and function description
>sp|Q0J6N4|KNOSD_ORYSJ Homeobox protein knotted-1-like 13 OS=Oryza sativa subsp. japonica GN=OSH45 PE=2 SV=2 Back     alignment and function description
>sp|P48002|KNAT5_ARATH Homeobox protein knotted-1-like 5 OS=Arabidopsis thaliana GN=KNAT5 PE=1 SV=2 Back     alignment and function description
>sp|Q0E3C3|KNOS2_ORYSJ Homeobox protein knotted-1-like 2 OS=Oryza sativa subsp. japonica GN=HOS58 PE=2 SV=2 Back     alignment and function description
>sp|Q94LW4|KNOSB_ORYSJ Homeobox protein knotted-1-like 11 OS=Oryza sativa subsp. japonica GN=HOS59 PE=2 SV=2 Back     alignment and function description
>sp|Q9FPQ8|KNAT7_ARATH Homeobox protein knotted-1-like 7 OS=Arabidopsis thaliana GN=KNAT7 PE=2 SV=1 Back     alignment and function description
>sp|P46606|HD1_BRANA Homeobox protein HD1 OS=Brassica napus GN=HD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
356507510411 PREDICTED: homeobox protein knotted-1-li 0.912 0.939 0.680 1e-159
111038269448 class II knotted-like homeobox protein [ 0.940 0.888 0.702 1e-157
449455557455 PREDICTED: homeobox protein knotted-1-li 0.943 0.876 0.682 1e-156
312282373434 unnamed protein product [Thellungiella h 0.919 0.896 0.676 1e-156
302398821437 HD domain class transcription factor [Ma 0.936 0.906 0.709 1e-155
210160856482 KNAT3-like transcription factor [Juglans 0.978 0.858 0.679 1e-155
79328660419 homeobox protein knotted-1-like 3 [Arabi 0.933 0.942 0.691 1e-155
224143241426 predicted protein [Populus trichocarpa] 0.931 0.924 0.722 1e-154
15238743431 homeobox protein knotted-1-like 3 [Arabi 0.931 0.914 0.690 1e-154
21554222431 KNAT3 homeodomain protein [Arabidopsis t 0.931 0.914 0.688 1e-154
>gi|356507510|ref|XP_003522507.1| PREDICTED: homeobox protein knotted-1-like 3-like [Glycine max] Back     alignment and taxonomy information
 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 304/447 (68%), Positives = 337/447 (75%), Gaps = 61/447 (13%)

Query: 1   MAFHHNHLSQDLPLHHFTDQQQQQQQ---------QPPSPPQQQHHQHQQSIETTAPNWL 51
           MA+HHN   Q+LPLHHFTDQQQ   Q          P S P    HQ        APNWL
Sbjct: 1   MAYHHN--PQELPLHHFTDQQQHHNQPLVDNSLLSDPASKPASDPHQ-------PAPNWL 51

Query: 52  NSALLRSQQAQQQAAHFSDTNFLNLRTTANNNNSNNNNTASDSDASQTPNQWLSRTSSSL 111
           N+ALLR+        H++D N  N    ANNN +N  N  +   ++    QWL+R    +
Sbjct: 52  NNALLRT--------HYTDNNNNNNVNAANNNTNNGTNFLNLHTSTSDSGQWLAR---PI 100

Query: 112 LHRNHSDVIDDVTPANDSIIAAVESADLKNANSENMNNASTNNKSEGVVVESGADGVVNW 171
           L+RNHS+VIDDVT A DS +AA ES DLK                +   VE G+DG++NW
Sbjct: 101 LNRNHSEVIDDVTGAGDSNMAAAESGDLKG---------------DAAAVEGGSDGLMNW 145

Query: 172 QNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQG 231
           QNAR KAEIL+HPLYEQLLSAHVACLRIATPVDQLPRIDAQL QSQ+VV+KYSA G  Q 
Sbjct: 146 QNARLKAEILAHPLYEQLLSAHVACLRIATPVDQLPRIDAQLTQSQNVVAKYSAFG--QA 203

Query: 232 LVTDDKELDQFM---------------QHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGT 276
           +V DDKELDQF+               QHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGT
Sbjct: 204 IVGDDKELDQFLSHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQSLTGVSPGEGT 263

Query: 277 GATMSDDDEDQVDSDANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQELKHELKQGYK 336
           GATMSD++++QVDSDANLFDG+L+GPD+MGFGPLIPTE+ERSLMERVR ELKHELKQGYK
Sbjct: 264 GATMSDEEDEQVDSDANLFDGALDGPDSMGFGPLIPTENERSLMERVRHELKHELKQGYK 323

Query: 337 EKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQIN 396
           EKIVDIREEILRKRRAGKLPGDTTSVLK+WWQSHSKWPYPTEEDKARLVQETGLQLKQIN
Sbjct: 324 EKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQIN 383

Query: 397 NWFINQRKRNWHSNPSTSTVLKSKRKR 423
           NWFINQRKRNWHSNPSTST LKSKRKR
Sbjct: 384 NWFINQRKRNWHSNPSTSTALKSKRKR 410

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|111038269|gb|ABH03531.1| class II knotted-like homeobox protein [Prunus persica] gi|215983122|gb|ACJ71731.1| class II knotted-like homeobox transcription factor [Prunus persica] Back     alignment and taxonomy information
>gi|449455557|ref|XP_004145519.1| PREDICTED: homeobox protein knotted-1-like 3-like [Cucumis sativus] gi|449485171|ref|XP_004157089.1| PREDICTED: homeobox protein knotted-1-like 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|312282373|dbj|BAJ34052.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|302398821|gb|ADL36705.1| HD domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|210160856|gb|ACJ09316.1| KNAT3-like transcription factor [Juglans nigra] Back     alignment and taxonomy information
>gi|79328660|ref|NP_001031938.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana] gi|332006031|gb|AED93414.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224143241|ref|XP_002324890.1| predicted protein [Populus trichocarpa] gi|222866324|gb|EEF03455.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15238743|ref|NP_197904.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana] gi|1346387|sp|P48000.1|KNAT3_ARATH RecName: Full=Homeobox protein knotted-1-like 3; AltName: Full=Protein KNAT3 gi|1045042|emb|CAA63130.1| KNAT3 homeobox protein [Arabidopsis thaliana] gi|4063731|gb|AAC98441.1| KNAT3 homeodomain protein [Arabidopsis thaliana] gi|332006030|gb|AED93413.1| homeobox protein knotted-1-like 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21554222|gb|AAM63298.1| KNAT3 homeodomain protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
TAIR|locus:2146945431 KNAT3 "KNOTTED1-like homeobox 0.853 0.837 0.669 1.8e-133
TAIR|locus:2184911393 KNAT4 "KNOTTED1-like homeobox 0.588 0.633 0.824 7.3e-121
TAIR|locus:2116632383 KNAT5 "KNOTTED1-like homeobox 0.614 0.678 0.682 5.6e-101
TAIR|locus:2015554291 KNAT7 "KNOTTED-like homeobox o 0.626 0.910 0.604 1e-82
UNIPROTKB|P46609361 OSH1 "Homeobox protein knotted 0.539 0.631 0.376 1.6e-31
TAIR|locus:2026810310 KNAT2 "KNOTTED-like from Arabi 0.196 0.267 0.506 3.7e-29
TAIR|locus:2027089382 STM "SHOOT MERISTEMLESS" [Arab 0.508 0.562 0.329 5.7e-27
TAIR|locus:2128828398 KNAT1 "KNOTTED-like from Arabi 0.196 0.208 0.481 1.8e-26
UNIPROTKB|A0A098934 GSM1 "Gamete-specific protein 0.200 0.091 0.423 1.2e-14
UNIPROTKB|H0YKK4204 MEIS3 "Homeobox protein Meis3" 0.153 0.318 0.430 8.7e-12
TAIR|locus:2146945 KNAT3 "KNOTTED1-like homeobox gene 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1236 (440.2 bits), Expect = 1.8e-133, Sum P(2) = 1.8e-133
 Identities = 265/396 (66%), Positives = 282/396 (71%)

Query:    44 ETTAPNWLNSALLRSXXXXXXXXHFSDTNFLNLRXXXXXXXXXXXXXX-XXXXXXQTPNQ 102
             E   PNWLN+ALLRS          ++ NFLNL                         NQ
Sbjct:    41 EAPPPNWLNTALLRSSD--------NNNNFLNLHTATANTTTASSSDSPSSAAAAAAANQ 92

Query:   103 WLSRTSSSLLHRNHSDVIDDVTPANDSIIAAVESADLXXXXXXXXXXXXXXXXXXGVVVE 162
             WLSR SSS L RN+++   + +   D I      AD                   G    
Sbjct:    93 WLSR-SSSFLQRNNNN---NASIVGDGIDDVTGGADTMIQGEMKTGGGENKNDGGGA--- 145

Query:   163 SGADGVVNWQNARYKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVSK 222
             + ADGVV+WQNAR+KAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVV+K
Sbjct:   146 TAADGVVSWQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVAK 205

Query:   223 YSALGAG-QGLVTDDKELDQFM---------------QHVRVHAMEAVMACWEIEQSLQS 266
             YSALGA  QGLV DDKELDQFM               QHVRVHAMEAVMACWEIEQSLQS
Sbjct:   206 YSALGAAAQGLVGDDKELDQFMTHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQS 265

Query:   267 LTGVSPGEGTGATMSXXXXXXXXXXANLFDGSLEGPDTMGFGPLIPTESERSLMERVRQE 326
             LTGVSPGEG GATMS          AN+FDG L   D +GFGPLIPTESERSLMERVRQE
Sbjct:   266 LTGVSPGEGMGATMSDDEDEQVESDANMFDGGL---DVLGFGPLIPTESERSLMERVRQE 322

Query:   327 LKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQ 386
             LKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLK+WWQSHSKWPYPTEEDKARLVQ
Sbjct:   323 LKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWPYPTEEDKARLVQ 382

Query:   387 ETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRK 422
             ETGLQLKQINNWFINQRKRNWHSNPS+STVLK+KRK
Sbjct:   383 ETGLQLKQINNWFINQRKRNWHSNPSSSTVLKNKRK 418
GO:0003677 "DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0005829 "cytosol" evidence=IDA
GO:0009722 "detection of cytokinin stimulus" evidence=IEP
GO:0071345 "cellular response to cytokine stimulus" evidence=IDA
GO:0048513 "organ development" evidence=RCA
GO:0009416 "response to light stimulus" evidence=IEP
TAIR|locus:2184911 KNAT4 "KNOTTED1-like homeobox gene 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116632 KNAT5 "KNOTTED1-like homeobox gene 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015554 KNAT7 "KNOTTED-like homeobox of Arabidopsis thaliana 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P46609 OSH1 "Homeobox protein knotted-1-like 6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2026810 KNAT2 "KNOTTED-like from Arabidopsis thaliana 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027089 STM "SHOOT MERISTEMLESS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128828 KNAT1 "KNOTTED-like from Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A0A098 GSM1 "Gamete-specific protein minus 1" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|H0YKK4 MEIS3 "Homeobox protein Meis3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O04136KNAP3_MALDONo assigned EC number0.70260.93610.9274N/Ano
Q0J6N4KNOSD_ORYSJNo assigned EC number0.79460.57910.6550yesno
Q94LW4KNOSB_ORYSJNo assigned EC number0.70700.56020.7337yesno
P56665KNOX7_MAIZENo assigned EC number0.91760.20091.0N/Ano
P56664KNOX6_MAIZENo assigned EC number0.91760.20091.0N/Ano
P56660KNOX2_MAIZENo assigned EC number0.90900.20801.0N/Ano
Q0E3C3KNOS2_ORYSJNo assigned EC number0.71210.58150.7859yesno
O22300LET12_SOLLCNo assigned EC number0.60450.85810.8521N/Ano
P48000KNAT3_ARATHNo assigned EC number0.69050.93140.9141yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 1e-17
pfam0379045 pfam03790, KNOX1, KNOX1 domain 3e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 7e-11
smart0038957 smart00389, HOX, Homeodomain 3e-10
pfam0379152 pfam03791, KNOX2, KNOX2 domain 1e-07
pfam0378922 pfam03789, ELK, ELK domain 4e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-04
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information 
 Score = 76.0 bits (188), Expect = 1e-17
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 366 WWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 405
           W   H   PYP+EE+K+ L ++TGL  KQI+NWFIN R+R
Sbjct: 1   WLLEHLHNPYPSEEEKSELARQTGLSRKQIDNWFINARRR 40

This is a homeobox transcription factor KN domain conserved from fungi to human and plants. Length = 40
>gnl|CDD|112596 pfam03790, KNOX1, KNOX1 domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|112597 pfam03791, KNOX2, KNOX2 domain Back     alignment and domain information
>gnl|CDD|217729 pfam03789, ELK, ELK domain Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 423
KOG0774334 consensus Transcription factor PBX and related HOX 99.96
KOG0773342 consensus Transcription factor MEIS1 and related H 99.91
PF0379045 KNOX1: KNOX1 domain ; InterPro: IPR005540 The MEIN 99.77
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.62
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.46
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.42
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.39
KOG0775304 consensus Transcription factor SIX and related HOX 99.38
PF0379152 KNOX2: KNOX2 domain ; InterPro: IPR005541 The MEIN 99.33
PF03792191 PBC: PBC domain; InterPro: IPR005542 Pbx proteins 99.1
KOG0487308 consensus Transcription factor Abd-B, contains HOX 98.79
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.76
KOG0843197 consensus Transcription factor EMX1 and related HO 98.67
KOG0489261 consensus Transcription factor zerknullt and relat 98.64
KOG0493342 consensus Transcription factor Engrailed, contains 98.58
KOG3802398 consensus Transcription factor OCT-1, contains POU 98.58
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 98.55
COG5576156 Homeodomain-containing transcription factor [Trans 98.52
KOG0850245 consensus Transcription factor DLX and related pro 98.51
KOG0483198 consensus Transcription factor HEX, contains HOX a 98.5
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 98.47
KOG0488309 consensus Transcription factor BarH and related HO 98.34
KOG0491194 consensus Transcription factor BSH, contains HOX d 98.3
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 98.27
KOG2251 228 consensus Homeobox transcription factor [Transcrip 98.23
KOG0492246 consensus Transcription factor MSH, contains HOX d 98.2
KOG0848317 consensus Transcription factor Caudal, contains HO 98.1
KOG0494 332 consensus Transcription factor CHX10 and related H 98.05
KOG4577 383 consensus Transcription factor LIM3, contains LIM 98.01
KOG0486 351 consensus Transcription factor PTX1, contains HOX 97.99
KOG0847288 consensus Transcription factor, contains HOX domai 97.71
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 97.71
KOG2252558 consensus CCAAT displacement protein and related h 97.66
KOG0490 235 consensus Transcription factor, contains HOX domai 97.61
KOG0849 354 consensus Transcription factor PRD and related pro 97.55
KOG0773 342 consensus Transcription factor MEIS1 and related H 97.44
KOG0844 408 consensus Transcription factor EVX1, contains HOX 97.32
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.82
PF0378922 ELK: ELK domain ; InterPro: IPR005539 This domain 96.53
KOG0490235 consensus Transcription factor, contains HOX domai 94.71
KOG1146 1406 consensus Homeobox protein [General function predi 91.03
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 82.24
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information 
Probab=99.96  E-value=2.2e-29  Score=243.26  Aligned_cols=205  Identities=24%  Similarity=0.377  Sum_probs=175.8

Q ss_pred             hhhHHHHHHHhhCCChHHHHHHHHhh-----hhccCCCcchhhHHHHHHHhHhHhhhhhhcCCCCC-------CCCCChH
Q 014533          171 WQNARYKAEILSHPLYEQLLSAHVAC-----LRIATPVDQLPRIDAQLAQSQHVVSKYSALGAGQG-------LVTDDKE  238 (423)
Q Consensus       171 ~e~e~lKAkI~sHPLYp~LL~AyIdC-----lKVGAPpdvv~rLd~~l~~s~~~~~~~sa~~~~~~-------~~gdDPE  238 (423)
                      |++.+.|.+|-|||+||.|.++.++.     +.|....|+-+. |.++.++++|+...++.|+..+       ..|+..|
T Consensus        26 Deaqa~K~~lnch~mk~AlfsVLcE~KeKt~lsir~~qdeep~-dpqlmRLDnML~AEGVagPekgga~~~~Asgg~hsd  104 (334)
T KOG0774|consen   26 DEAQARKHALNCHRMKPALFSVLCEIKEKTVLSIRGMQDEEPP-DPQLMRLDNMLLAEGVAGPEKGGARAAAASGGDHSD  104 (334)
T ss_pred             chHHhhhhccccccchHHHHHHHHHhhhhheeeeccccccCCC-ChHHHHHHHHHHHhcccCccccchhhhhccCCChHH
Confidence            56668999999999999999999994     444444443332 7788899999999998887642       2357899


Q ss_pred             HHHHHHHHhhhHHH---HH-hhhhhHHHHHhhhhCCCCCCCCCCCCCCcchhcccCCCccCCCCCCCCCCCCCCCCCCch
Q 014533          239 LDQFMQHVRVHAME---AV-MACWEIEQSLQSLTGVSPGEGTGATMSDDDEDQVDSDANLFDGSLEGPDTMGFGPLIPTE  314 (423)
Q Consensus       239 LDQFMe~lr~pf~E---A~-~Fc~~IEsQL~sL~g~s~~eg~g~~~Sdded~~~~sd~~~~~g~~~~~ds~~f~pi~p~~  314 (423)
                      +++-+..+|..+.+   ++ .+|+++.+.+.+|..                                 +.+.++||.+.+
T Consensus       105 YR~kL~qiR~iy~~ElekyeqaCneftthV~nlL~---------------------------------eQsr~RPi~~ke  151 (334)
T KOG0774|consen  105 YRAKLLQIRQIYHNELEKYEQACNEFTTHVMNLLR---------------------------------EQSRTRPIMPKE  151 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------------------------------HhcccCCCCHHH
Confidence            99999888876532   22 589999999999985                                 233689999999


Q ss_pred             hhhHH--HHHHHHHHHHHHHhhhhhHHHhHHHHHhh-ccCCCCCChHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHhCCC
Q 014533          315 SERSL--MERVRQELKHELKQGYKEKIVDIREEILR-KRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQ  391 (423)
Q Consensus       315 ~er~~--m~r~~~ELK~~Lk~ky~~~i~~lree~~k-kRKrgklpKea~~iLk~Wf~~H~~~PYPSe~eK~~LA~~TgLs  391 (423)
                      .||++  |.+.|.-++..|++..|..+..||.+++. +|||++|+|.++.||..||+.|..+|||+++.|++||++||++
T Consensus       152 ~e~m~~~i~~kF~~iq~~lkqstce~vmiLr~r~ldarRKRRNFsK~aTeiLneyF~~h~~nPYPSee~K~eLAkqCnIt  231 (334)
T KOG0774|consen  152 IERMVQIISKKFSHIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKQCNIT  231 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHhcCCCCCcHHHHHHHHHHcCce
Confidence            99885  89999999999999999999999999996 6778899999999999999999999999999999999999999


Q ss_pred             hhhhhhhhhhhhhhcccC
Q 014533          392 LKQINNWFINQRKRNWHS  409 (423)
Q Consensus       392 ~kQV~NWFiN~RkR~kK~  409 (423)
                      ..||+|||.|+|.|.||.
T Consensus       232 vsQvsnwfgnkrIrykK~  249 (334)
T KOG0774|consen  232 VSQVSNWFGNKRIRYKKN  249 (334)
T ss_pred             ehhhccccccceeehhhh
Confidence            999999999999999983

>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF03790 KNOX1: KNOX1 domain ; InterPro: IPR005540 The MEINOX region is comprised of two domains, KNOX1 and KNOX2 Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF03791 KNOX2: KNOX2 domain ; InterPro: IPR005541 The MEINOX region is comprised of two domains, KNOX1 and KNOX2 Back     alignment and domain information
>PF03792 PBC: PBC domain; InterPro: IPR005542 Pbx proteins are members of the TALE (three-amino-acid loop extension) family of atypical homeodomain proteins, whose members are characterised by a three-residue insertion in the first helix of the homeodomain involved in their interaction with Hox proteins Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF03789 ELK: ELK domain ; InterPro: IPR005539 This domain is required for the nuclear localisation of these proteins [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 8e-11
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 3e-09
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 3e-09
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 1e-06
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 4e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 5e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 7e-06
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-05
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 4e-05
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 4e-04
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)
Query: 349 KRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 408
           K + G LP   T+V++SW   H   PYPTE++K ++  +T L L Q+NNWFIN R+R   
Sbjct: 8   KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 67
Query: 409 SNPST 413
           S PS+
Sbjct: 68  SGPSS 72
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 8e-30
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 4e-27
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 6e-27
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 1e-26
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 1e-26
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 1e-26
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 1e-25
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 3e-24
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 4e-23
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 9e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 3e-07
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-07
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-06
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-06
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 4e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-04
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
 Score =  109 bits (274), Expect = 8e-30
 Identities = 30/66 (45%), Positives = 42/66 (63%)

Query: 348 RKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW 407
            K + G LP   T+V++SW   H   PYPTE++K ++  +T L L Q+NNWFIN R+R  
Sbjct: 7   GKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRIL 66

Query: 408 HSNPST 413
            S PS+
Sbjct: 67  QSGPSS 72
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.72
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.7
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.7
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.68
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.67
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.67
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.66
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.65
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.64
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.63
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.52
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.52
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.52
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.51
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.51
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.51
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.5
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.49
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.49
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.48
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.47
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.47
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.46
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.44
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.43
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.43
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.43
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.42
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.42
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.42
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.42
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.42
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.42
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.41
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.4
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.4
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.4
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.38
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.38
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.37
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.37
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.36
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.36
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.36
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.36
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.36
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.35
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.35
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.34
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.34
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.33
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.32
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.32
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.32
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.31
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.31
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.3
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.3
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.29
2e19_A64 Transcription factor 8; homeobox domain, structura 99.29
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.29
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.28
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.28
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.26
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.24
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.23
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.22
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.21
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.21
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.19
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.17
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.13
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.13
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.99
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.95
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.91
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.9
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 95.56
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.08
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
Probab=99.72  E-value=6e-18  Score=137.24  Aligned_cols=63  Identities=41%  Similarity=0.758  Sum_probs=59.4

Q ss_pred             hhccCCCCCChHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHhCCChhhhhhhhhhhhhhcccC
Q 014533          347 LRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHS  409 (423)
Q Consensus       347 ~kkRKrgklpKea~~iLk~Wf~~H~~~PYPSe~eK~~LA~~TgLs~kQV~NWFiN~RkR~kK~  409 (423)
                      .++|+|+.|+++++.+|+.||..|..+|||+.++|..||..|||+..||.+||+|+|+|.|+.
T Consensus         6 ~~rk~R~~~s~~q~~~L~~~f~~~~~~pYPs~~~r~~LA~~~gLs~~qV~~WFqNrR~r~k~~   68 (83)
T 2dmn_A            6 SGKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPD   68 (83)
T ss_dssp             CCCCCCSSCCHHHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHTHHH
T ss_pred             CCCCCCCcCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHhhHHhhhhHhhhcHH
Confidence            356778899999999999999999999999999999999999999999999999999999874
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 423
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 8e-18
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 5e-15
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 7e-07
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 9e-07
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-06
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-05
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 6e-05
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-04
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-04
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 6e-04
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 9e-04
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 0.001
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 0.002
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 0.002
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 0.002
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 0.002
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 0.002
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 0.003
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.8 bits (184), Expect = 8e-18
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 349 KRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 405
           K + G LP   T+V++SW   H   PYPTE++K ++  +T L L Q+NNWFIN R+R
Sbjct: 3   KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 59
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.77
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.73
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.59
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.52
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.51
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.51
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.51
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.51
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.51
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.51
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.5
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.49
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.49
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.46
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.46
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.46
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.46
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.46
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.45
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.44
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.43
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.43
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.38
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.38
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.35
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.35
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.35
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.33
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.3
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.29
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.24
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=1.7e-19  Score=138.28  Aligned_cols=60  Identities=45%  Similarity=0.843  Sum_probs=56.9

Q ss_pred             hccCCCCCChHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHhCCChhhhhhhhhhhhhhcc
Q 014533          348 RKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW  407 (423)
Q Consensus       348 kkRKrgklpKea~~iLk~Wf~~H~~~PYPSe~eK~~LA~~TgLs~kQV~NWFiN~RkR~k  407 (423)
                      .||||++||++++.+|+.||..|..+|||+.++|..||..|||+.+||.|||+|+|+|..
T Consensus         2 ~krkR~~~~~~~~~iL~~wf~~~~~nPyPs~~e~~~La~~~~l~~~qI~~WF~N~R~R~l   61 (62)
T d1x2na1           2 GKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRIL   61 (62)
T ss_dssp             SCCSSCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHhccCCCcCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhc
Confidence            356778999999999999999999999999999999999999999999999999999975
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure