Citrus Sinensis ID: 014587
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 422 | ||||||
| 225462092 | 555 | PREDICTED: uncharacterized protein LOC10 | 0.388 | 0.295 | 0.471 | 2e-25 | |
| 224097319 | 570 | predicted protein [Populus trichocarpa] | 0.511 | 0.378 | 0.365 | 2e-24 | |
| 255546850 | 584 | Caldesmon, putative [Ricinus communis] g | 0.675 | 0.488 | 0.355 | 2e-22 | |
| 357470491 | 870 | FK506-binding protein [Medicago truncatu | 0.585 | 0.283 | 0.356 | 4e-18 | |
| 225455553 | 525 | PREDICTED: uncharacterized protein LOC10 | 0.789 | 0.634 | 0.305 | 7e-16 | |
| 356497385 | 503 | PREDICTED: uncharacterized protein LOC10 | 0.151 | 0.127 | 0.609 | 4e-15 | |
| 356538942 | 503 | PREDICTED: uncharacterized protein LOC10 | 0.151 | 0.127 | 0.609 | 5e-15 | |
| 334186914 | 444 | peptidylprolyl isomerase [Arabidopsis th | 0.175 | 0.166 | 0.527 | 5e-15 | |
| 18416534 | 477 | peptidylprolyl isomerase [Arabidopsis th | 0.175 | 0.155 | 0.527 | 8e-15 | |
| 5123924 | 487 | putative protein [Arabidopsis thaliana] | 0.175 | 0.151 | 0.527 | 1e-14 |
| >gi|225462092|ref|XP_002271499.1| PREDICTED: uncharacterized protein LOC100267010 [Vitis vinifera] gi|296086769|emb|CBI32918.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 123 bits (308), Expect = 2e-25, Method: Compositional matrix adjust.
Identities = 82/174 (47%), Positives = 112/174 (64%), Gaps = 10/174 (5%)
Query: 250 KSLEADSVDCTNVIKGDKALHDEVKHDRMGQDTPGRVEQ---NEQQVTDVIPGNDVDQSV 306
K LE DSV+ N +K DKA +E K D M Q+ P R E N + D VDQ
Sbjct: 330 KHLEVDSVNHKNDLKEDKAPQNENKADNMDQNLPERKENQRPNSYKSCDT----KVDQLA 385
Query: 307 AELQPEKKKKKKKRR---TEEDGKDSNMETHPLSMDAMSGSVMVTENSSAEGKLSLLRTL 363
+ Q ++KK K+KR+ T+E+ +NME PLSM+ SGS + ++ +++ S +R +
Sbjct: 386 GDNQSDEKKIKRKRKKSKTQENEGVANMEVPPLSMNKKSGSHLEVKDRNSDANSSQVRMM 445
Query: 364 PNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGSTPLKFHLG 417
NGLVI++L TGKPDGK+A GKK+SV YTGKLK++GQ+FDSN+G PLKF LG
Sbjct: 446 SNGLVIEELITGKPDGKIACQGKKVSVYYTGKLKDSGQIFDSNIGRAPLKFRLG 499
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224097319|ref|XP_002310907.1| predicted protein [Populus trichocarpa] gi|222853810|gb|EEE91357.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255546850|ref|XP_002514483.1| Caldesmon, putative [Ricinus communis] gi|223546382|gb|EEF47883.1| Caldesmon, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357470491|ref|XP_003605530.1| FK506-binding protein [Medicago truncatula] gi|355506585|gb|AES87727.1| FK506-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225455553|ref|XP_002268439.1| PREDICTED: uncharacterized protein LOC100258340 [Vitis vinifera] gi|296084130|emb|CBI24518.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356497385|ref|XP_003517541.1| PREDICTED: uncharacterized protein LOC100789099 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538942|ref|XP_003537959.1| PREDICTED: uncharacterized protein LOC100792856 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|334186914|ref|NP_001190836.1| peptidylprolyl isomerase [Arabidopsis thaliana] gi|332659644|gb|AEE85044.1| peptidylprolyl isomerase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18416534|ref|NP_567717.1| peptidylprolyl isomerase [Arabidopsis thaliana] gi|75163771|sp|Q93ZG9.1|FKB53_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP53; Short=PPIase FKBP53; AltName: Full=FK506-binding protein 53; Short=AtFKBP53; AltName: Full=Immunophilin FKBP53; AltName: Full=Rotamase gi|15982872|gb|AAL09783.1| AT4g25340/T30C3_20 [Arabidopsis thaliana] gi|23506115|gb|AAN28917.1| At4g25340/T30C3_20 [Arabidopsis thaliana] gi|332659643|gb|AEE85043.1| peptidylprolyl isomerase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|5123924|emb|CAB45512.1| putative protein [Arabidopsis thaliana] gi|7269385|emb|CAB81345.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 422 | ||||||
| TAIR|locus:2092467 | 499 | AT3G12340 "AT3G12340" [Arabido | 0.324 | 0.274 | 0.356 | 2.9e-19 | |
| TAIR|locus:2138029 | 477 | FKBP53 "AT4G25340" [Arabidopsi | 0.516 | 0.457 | 0.279 | 4e-18 | |
| UNIPROTKB|Q7XUX5 | 525 | OSJNBa0027P08.21 "Peptidyl-pro | 0.341 | 0.274 | 0.313 | 4.2e-13 | |
| UNIPROTKB|Q0J2V8 | 416 | Os09g0293900 "Peptidyl-prolyl | 0.149 | 0.151 | 0.430 | 2.9e-12 | |
| TAIR|locus:2153519 | 143 | AT5G05420 "AT5G05420" [Arabido | 0.165 | 0.489 | 0.426 | 3.7e-11 | |
| UNIPROTKB|A8JAS8 | 104 | FKB53 "Peptidyl-prolyl cis-tra | 0.113 | 0.461 | 0.510 | 9.2e-08 | |
| POMBASE|SPBC1347.02 | 361 | fkbp39 "FKBP-type peptidyl-pro | 0.191 | 0.224 | 0.367 | 2.6e-05 | |
| SGD|S000004441 | 392 | FPR4 "Peptidyl-prolyl cis-tran | 0.376 | 0.405 | 0.251 | 7e-05 | |
| FB|FBgn0013269 | 357 | FK506-bp1 "FK506-binding prote | 0.381 | 0.450 | 0.252 | 0.00045 |
| TAIR|locus:2092467 AT3G12340 "AT3G12340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 197 (74.4 bits), Expect = 2.9e-19, Sum P(2) = 2.9e-19
Identities = 51/143 (35%), Positives = 73/143 (51%)
Query: 276 DRMGQDTPGRVEQNEQQVTDVIPGNDVDQSVAELQPEXXXXXXXRRTEEDGKDSNMETHP 335
D G++ P + QNE V+D G V L ++ + D ++ + P
Sbjct: 306 DGEGKNMPESL-QNENPVSD--KGIKSSSDVL-LSQNGDATLSKKKKKRDRREETTDV-P 360
Query: 336 LSMDAMSGSVMVTENSSAEGKLSL-LRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTG 394
+ ++ A K L RTL NG++I+ + GK DGK A GKK+S+LYTG
Sbjct: 361 ECPEKKKQAIDKNIEKEAGTKKPLETRTLSNGVIIEDIEKGKLDGKSAVKGKKVSILYTG 420
Query: 395 KLKENGQVFDSNLGSTPLKFHLG 417
KLK+ G +FDSNLG PL+F LG
Sbjct: 421 KLKDTGNLFDSNLGEDPLRFRLG 443
|
|
| TAIR|locus:2138029 FKBP53 "AT4G25340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7XUX5 OSJNBa0027P08.21 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0J2V8 Os09g0293900 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153519 AT5G05420 "AT5G05420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8JAS8 FKB53 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC1347.02 fkbp39 "FKBP-type peptidyl-prolyl cis-trans isomerase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004441 FPR4 "Peptidyl-prolyl cis-trans isomerase (PPIase) (proline isomerase)" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013269 FK506-bp1 "FK506-binding protein 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 422 | |||
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 7e-06 | |
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 0.002 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 46.3 bits (110), Expect = 7e-06
Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 3/46 (6%)
Query: 361 RTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSN 406
+TLP+GL + L G DG G ++V YTG L +G VFDS+
Sbjct: 97 KTLPSGLQYKVLKAG--DGAAPKKGDTVTVHYTGTL-IDGTVFDSS 139
|
Length = 205 |
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 422 | |||
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.5 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.22 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.21 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.03 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.95 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.93 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 98.66 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 97.76 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 95.46 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 85.41 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 83.44 |
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.50 E-value=3.2e-14 Score=134.35 Aligned_cols=66 Identities=36% Similarity=0.656 Sum_probs=63.0
Q ss_pred ccccccCCceecCCCeEEEEeeeCCCCCCCCCCCCeEEEEEEEEecCCCceeccCCCC-CCeEEEcCcee
Q 014587 352 SAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGDIL 420 (422)
Q Consensus 352 ~~~~k~s~vrtlpsGL~ievLk~G~~cG~kpk~GDtVsVhYtGkL~~DGkvFDSS~~r-kPftF~LG~vI 420 (422)
.++++..+++++++||+|.+|..|+ |+.|+.|++|+|||+|+| .||++||||+.| +||.|.||.+|
T Consensus 88 ~~~~k~~~v~~~~sgl~y~~~~~G~--G~~~~~~~~V~vhY~G~l-~~G~vFDsS~~rg~p~~f~l~~vI 154 (205)
T COG0545 88 EKNAKEKGVKTLPSGLQYKVLKAGD--GAAPKKGDTVTVHYTGTL-IDGTVFDSSYDRGQPAEFPLGGVI 154 (205)
T ss_pred hhhcccCCceECCCCcEEEEEeccC--CCCCCCCCEEEEEEEEec-CCCCccccccccCCCceeecCCee
Confidence 5678888999999999999999999 999999999999999999 999999999987 99999999887
|
|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 422 | |||
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 1e-10 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 6e-10 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 3e-09 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 4e-08 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 5e-08 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 6e-08 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 7e-08 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 7e-08 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 6e-07 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 9e-07 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 9e-07 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 2e-06 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 2e-06 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 2e-06 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 3e-06 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 6e-06 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 1e-05 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 8e-05 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 3e-04 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 5e-04 |
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
Score = 58.1 bits (141), Expect = 1e-10
Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 3/59 (5%)
Query: 362 TLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLG---STPLKFHLG 417
+ I+ L + G + V Y G L+++G +F S P+ F LG
Sbjct: 9 IPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLG 67
|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 422 | |||
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.15 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.15 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.13 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.11 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.08 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.07 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.06 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.02 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.02 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 98.98 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 98.98 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 98.97 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 98.87 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 98.85 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 98.84 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 98.83 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 98.82 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 98.81 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 98.8 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.77 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 98.76 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 98.74 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 98.68 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 98.57 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.55 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 98.41 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 98.39 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.22 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 98.19 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 97.64 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 97.63 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 97.57 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 96.92 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 95.96 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 95.22 |
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
Probab=99.15 E-value=1.3e-11 Score=110.76 Aligned_cols=65 Identities=35% Similarity=0.597 Sum_probs=59.1
Q ss_pred cccccCCceecCCCeEEEEeeeCCCCCCC-CCCCCeEEEEEEEEecCCCceeccCCCC-CCeEEEcCcee
Q 014587 353 AEGKLSLLRTLPNGLVIQKLGTGKPDGKV-AAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGDIL 420 (422)
Q Consensus 353 ~~~k~s~vrtlpsGL~ievLk~G~~cG~k-pk~GDtVsVhYtGkL~~DGkvFDSS~~r-kPftF~LG~vI 420 (422)
.+++..++.++++||+|.+|+.|+ |.. |..||+|+|||+|+| .||++||+++.+ .|+.|.||.+|
T Consensus 25 ~~~~~~~~~~~~sGl~~~vl~~G~--G~~~~~~gd~V~v~Y~g~l-~dG~~fdss~~~g~p~~f~lg~vI 91 (167)
T 1jvw_A 25 QKAAQPDAVKLPSGLVFQRIARGS--GKRAPAIDDKCEVHYTGRL-RDGTVFDSSRERGKPTTFRPNEVI 91 (167)
T ss_dssp HHHHSTTEEECTTSCEEEEEECCC--CSBCCCTTCCEEEEEEEEC-TTSCEEEEHHHHTSCEEECGGGSC
T ss_pred hcccCCCcEECCCCEEEEEEEcCC--CCcCCCCCCEEEEEEEEEE-CCCCEEeeccccCCCEEEEeCchh
Confidence 355667899999999999999999 888 999999999999999 899999999865 89999998765
|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 422 | |||
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.32 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.28 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.13 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.0 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 98.96 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 98.93 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 98.86 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 98.85 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 98.81 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 98.7 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 98.16 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 97.73 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 95.94 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 85.0 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 80.76 |
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: Peptidyl-prolyl cis-trans isomerase FkpA species: Escherichia coli [TaxId: 562]
Probab=99.32 E-value=5.7e-13 Score=120.41 Aligned_cols=66 Identities=30% Similarity=0.508 Sum_probs=60.8
Q ss_pred ccccccCCceecCCCeEEEEeeeCCCCCCCCCCCCeEEEEEEEEecCCCceeccCCCC-CCeEEEcCcee
Q 014587 352 SAEGKLSLLRTLPNGLVIQKLGTGKPDGKVAAPGKKISVLYTGKLKENGQVFDSNLGS-TPLKFHLGDIL 420 (422)
Q Consensus 352 ~~~~k~s~vrtlpsGL~ievLk~G~~cG~kpk~GDtVsVhYtGkL~~DGkvFDSS~~r-kPftF~LG~vI 420 (422)
..+++..++.++++||+|.+|+.|+ |..|..||+|+|||+|+| .||++||+|+.+ .|+.|.||.+|
T Consensus 94 ~~~~~~~~v~~~~sGl~y~v~~~G~--G~~p~~gd~v~v~y~g~l-~dG~~fd~s~~~~~p~~~~~~~vi 160 (210)
T d1q6ha_ 94 EKFAKEKGVKTSSTGLVYQVVEAGK--GEAPKDSDTVVVNYKGTL-IDGKEFDNSYTRGEPLSFRLDGVI 160 (210)
T ss_dssp HHHHHSTTEEECTTSCEEEEEECCS--SCCCCTTCEEEEEEEEEE-TTSCEEEEGGGGTSCEEEEGGGSC
T ss_pred HhhcccCceEEccCceEEEEeeCCC--CCCCCCCceEEEEEEEEE-cCCCEEeecccCCCcceeccCccc
Confidence 3556677899999999999999999 999999999999999999 899999999875 99999999876
|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|