Citrus Sinensis ID: 014780


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MDGFSYEFEFGFRTNCGLDSFTTQGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFTEKVAKFDCGPVEGSHLGNSSSESHSPGASGSNVAVGMSDSSITALESECKNDSLEKMVNCELHGTFKSKCEYQAPDMEKCPSSHDMDRFDELDSDDNVLLSSILSKCKKRVKSTVLGTKVKRLRKPTKRYIEESSDLKPGSLMRGQNVSTATLKDKHPKVTPCNGSSKGSQVASESWLRGGRLKKRSPILGFESDDDIFSSDSDDDRVRKRKSKIDDRRKNQRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNKGEVDPKHAMRSLPKPVLCRIRELATIHPYPRVPYSKKCNGDTDSSRHPIKAKSAPFSSHGRNLRTTIKEQ
ccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
ccccccccEEccccccccccccccccccccEHHHcccccccccHHHHHcccccccccccccccEEHHcccccccccccccccccccccccccccccccccEEEEcccccccccHHHccccHHHHHHHHHHHHHccccccccccccccccccccccHHHccccccccHHHHHHHHHHHcccccccHHcccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHcc
MDGFSYEFEfgfrtncgldsfttqgeddLKLEVLDGLlddidevddfhaandlstvcddFLLDIEFTEkvakfdcgpvegshlgnssseshspgasgsnvavgmsdsSITALESEckndslekmvncelhgtfkskceyqapdmekcpsshdmdrfdeldsddNVLLSSILSKCKKRvkstvlgtkvkrlrkptkryieessdlkpgslmrgqnvstatlkdkhpkvtpcngsskgsqvaseswlrggrlkkrspilgfesdddifssdsdddrVRKRKSKIDDRRKNQRMWTLSEVMKLIDGisqfgvgkwtDIKRLLfsssshrtpidlRDKWRNLLRASYAHqknkgevdpkhamrslpkpvLCRIRelatihpyprvpyskkcngdtdssrhpikaksapfsshgrnlrttikeq
MDGFSYEFEFGFRTNCGLDSFTTQGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFTEKVAKFDCGPVEGSHLgnssseshspgASGSNVAVGMSDSSITALESECKNDSLEKMVNCELHGTFKSKCEYQAPDMEKCPSSHDMDRFDELDSDDNVLLSSilskckkrvkstvlgtkvkrlrkptkryieessdlkpgslmrgQNVStatlkdkhpkvtpcngsskgsqvaseswlrggrlkkrspilgfesdddifssdsdddrvrkrkskiddrrknqrmwtlsEVMKLIDGISQFGVGKWTDIKRLLfsssshrtpidlrDKWRNLLRASYAhqknkgevdpkhamrslPKPVLCRIRELatihpyprvpyskKCNGDTDSSrhpikaksapfsshgrnlrttikeq
MDGFSYEFEFGFRTNCGLDSFTTQGEDDLKlevldgllddidevddFHAANDLSTVCDDFLLDIEFTEKVAKFDCGPVegshlgnssseshspgasgsnVAVGMSDSSITALESECKNDSLEKMVNCELHGTFKSKCEYQAPDMEKCPSSHDMDRFDELDSDDNVLLSSILSKCKKRVKSTVLGTKVKRLRKPTKRYIEESSDLKPGSLMRGQNVSTATLKDKHPKVTPCNGSSKGSQVASESWLRGGRLKKRSPILGFEsdddifssdsdddrvrkrkskiddrrkNQRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNKGEVDPKHAMRSLPKPVLCRIRELATIHPYPRVPYSKKCNGDTDSSRHPIKAKSAPFSSHGRNLRTTIKEQ
***FSYEFEFGFRTNCGLDSFTTQGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFTEKVAKFDCGP***********************************************VNCELHGTF*******************************VLLSSILSKCKKRVKSTVLG**********************************************************************************************************MWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASY*******************KPVLCRIRELATIHPYPRVPY************************************
***FSYEFEFGFRTNCG**********DLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFT*********************************************************************************************************************************************************************************************************************************TLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLL********************************************************************************
MDGFSYEFEFGFRTNCGLDSFTTQGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFTEKVAKFDCGPVEGS***********************SDSSITALESECKNDSLEKMVNCELHGTFKSKCEYQAPDMEKCPSSHDMDRFDELDSDDNVLLSSILSKCKKRVKSTVLGTKVKRLRKPTKRYIEESSDLKPGSLMRGQNVSTATLKDK**********************RGGRLKKRSPILGFESDDDIFS******************RKNQRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQ**********AMRSLPKPVLCRIRELATIHPYPRVPYSKK**********PIKAKSAPFSSHGRNLRTTIKEQ
**GFSYEFEFGFRTNCGLDSFTTQGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFTEKVAKFDCGPVEGSHLGN********GASGSNVAVGMSDSSITALES**KNDSLEKMVNCELHGTFKSKCEYQAPDMEKCPSSHDMDRFDELDSDDNVLLSSILSKCKKRV****************************************************************************************************************MWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYA***************SLPKPVLCRIRELATIH*******************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGFSYEFEFGFRTNCGLDSFTTQGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIEFTEKVAKFDCGPVEGSHLGNSSSESHSPGASGSNVAVGMSDSSITALESECKNDSLEKMVNCELHGTFKSKCEYQAPDMEKCPSSHDMDRFDELDSDDNVLLSSILSKCKKRVKSTVLGTKVKRLRKPTKRYIEESSDLKPGSLMRGQNVSTATLKDKHPKVTPCNGSSKGSQVASESWLRGGRLKKRSPILGFESDDDIFSSDSDDDRVRKRKSKIDDRRKNQRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNKGEVDPKHAMRSLPKPVLCRIRELATIHPYPRVPYSKKCNGDTDSSRHPIKAKSAPFSSHGRNLRTTIKEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query419 2.2.26 [Sep-21-2011]
Q9FFY9640 Telomere repeat-binding p no no 0.236 0.154 0.314 2e-10
Q9C7B1619 Telomere repeat-binding p no no 0.176 0.119 0.346 3e-09
Q9LL45633 Telomere-binding protein no no 0.233 0.154 0.323 4e-09
Q6R0E3630 Telomere repeat-binding p no no 0.198 0.131 0.333 1e-08
Q9SNB9553 Telomere repeat-binding p no no 0.202 0.153 0.290 2e-08
Q9M347400 Telomere repeat-binding p no no 0.169 0.177 0.361 6e-08
Q8L7L8578 Telomere repeat-binding p no no 0.159 0.115 0.338 4e-07
F4IEY4 287 Telomere repeat-binding f no no 0.121 0.177 0.462 0.0001
F4I7L1 296 Telomere repeat-binding f no no 0.121 0.172 0.462 0.0002
>sp|Q9FFY9|TRP4_ARATH Telomere repeat-binding protein 4 OS=Arabidopsis thaliana GN=TRP4 PE=1 SV=1 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 255 PILGFESDDDIFSSDSDDDRVRKRKSKIDDRRKNQRMWTLSEVMKLIDGISQFGVGKWTD 314
           P+L  ESD       ++    + +++++  RR  +R ++++EV  L+  + + G G+W D
Sbjct: 506 PVLALESDALALVPVNE----KPKRTELSQRR-TRRPFSVTEVEALVSAVEEVGTGRWRD 560

Query: 315 IKRLLFSSSSHRTPIDLRDKWRNLLR-ASYAHQKNKGEVDPKHAM 358
           +K   F ++SHRT +DL+DKW+ L+  AS + Q+ +GE  P+  +
Sbjct: 561 VKLRSFENASHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELL 605




Binds specifically to the plant telomeric double-stranded DNA sequences 5'-TTTAGGG-3'. At least 2 repeats of telomeric sequences are required for binding. Induces DNA bending.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7B1|TRP3_ARATH Telomere repeat-binding protein 3 OS=Arabidopsis thaliana GN=TRP3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LL45|TBP1_ORYSJ Telomere-binding protein 1 OS=Oryza sativa subsp. japonica GN=TBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q6R0E3|TRP5_ARATH Telomere repeat-binding protein 5 OS=Arabidopsis thaliana GN=TRP5 PE=1 SV=2 Back     alignment and function description
>sp|Q9SNB9|TRP2_ARATH Telomere repeat-binding protein 2 OS=Arabidopsis thaliana GN=TRP2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M347|TRP6_ARATH Telomere repeat-binding protein 6 OS=Arabidopsis thaliana GN=TRP6 PE=1 SV=1 Back     alignment and function description
>sp|Q8L7L8|TRP1_ARATH Telomere repeat-binding protein 1 OS=Arabidopsis thaliana GN=TRP1 PE=1 SV=2 Back     alignment and function description
>sp|F4IEY4|TRB5_ARATH Telomere repeat-binding factor 5 OS=Arabidopsis thaliana GN=At1g72740 PE=2 SV=1 Back     alignment and function description
>sp|F4I7L1|TRB4_ARATH Telomere repeat-binding factor 4 OS=Arabidopsis thaliana GN=At1g17520 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
297741622 542 unnamed protein product [Vitis vinifera] 0.961 0.743 0.454 1e-83
225440021455 PREDICTED: uncharacterized protein LOC10 0.902 0.830 0.450 5e-78
356548325477 PREDICTED: uncharacterized protein LOC10 0.921 0.809 0.421 4e-57
357440365463 hypothetical protein MTR_1g063940 [Medic 0.880 0.796 0.405 2e-55
356533240464 PREDICTED: uncharacterized protein LOC10 0.926 0.836 0.411 4e-55
449451024477 PREDICTED: uncharacterized protein LOC10 0.861 0.756 0.376 4e-51
449482457477 PREDICTED: uncharacterized LOC101219571 0.861 0.756 0.373 9e-51
297823525395 hypothetical protein ARALYDRAFT_482686 [ 0.711 0.754 0.366 4e-47
110741390410 hypothetical protein [Arabidopsis thalia 0.756 0.773 0.357 3e-45
30687001410 protein TRF-like 8 [Arabidopsis thaliana 0.756 0.773 0.357 4e-45
>gi|297741622|emb|CBI32754.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  317 bits (811), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 281/469 (59%), Gaps = 66/469 (14%)

Query: 8   FEFGFRTNCG-LDSFTT-QGEDDLKLEVLDGLLDDIDEVDDFHAANDLSTVCDDFLLDIE 65
           FE G  ++ G +DS TT +GED+LKL V DG+L ++ EV D HA N LS  C+D+LLDIE
Sbjct: 69  FECGLESHSGGMDSNTTREGEDELKLGVFDGMLHEVAEVGDLHATNSLSGACEDYLLDIE 128

Query: 66  FTEKVAKFDCGPVEGSHLGNSSSESHSPGASGS-NVAVGMSDSSITALE-SECKNDSLEK 123
           F E V++ D GP  GSHLGNSSSESHSPG SGS N AVG+S+SS   +   EC N+ L+K
Sbjct: 129 FAETVSELDNGPCAGSHLGNSSSESHSPGFSGSDNGAVGISESSTGTIPVPECGNN-LDK 187

Query: 124 MVNCELHGTFKSKCEYQA---PDME-KCPSSHDMDRFDELDSDDNVLLSSILSKCKKRV- 178
           M  C LHGT +SKCE +      ME +  +S ++   D +D+  N++    L + +K V 
Sbjct: 188 MTICTLHGTSRSKCECKMLVEGKMELQGSASFNLQNPDGVDNVSNLVSGIPLVENRKDVT 247

Query: 179 -------KSTVLGTKV---------------------------KRLRKPTKRYIEESSDL 204
                  K++ +G  +                           KR+R+PT+RYIEE SDL
Sbjct: 248 FTNLQYNKASSIGQGMKKESFAGRKGSRKRSVEASDVGMLLSEKRMRRPTRRYIEEFSDL 307

Query: 205 KPGS-LMRGQNVSTAT----LKDKHPKVTPCNGSSKGSQVASESWLRG------------ 247
           K  S   R +N +T T    L ++H   T   G S    V S S+ R             
Sbjct: 308 KSKSNRGRPKNSTTTTKNKLLGNRHRSETHHKGFSAAPLVPSGSYGRSSDRTPFEVGVQK 367

Query: 248 GRLKKRSPILGFESDDDIFSSDSDDDRVR-KRKSKIDDRRKNQRMWTLSEVMKLIDGISQ 306
           G LKK + I   +SD++   ++S+DD +  KR     DRRK+QR+WTLSEVMKL+DG+S 
Sbjct: 368 GCLKKYASISDLDSDEESSPAESEDDCMTIKRPETSGDRRKHQRLWTLSEVMKLVDGVSH 427

Query: 307 FGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNKGEVDP--KHAMRSLPKP 364
           +GVG+WTDIKRLLFSSS++RTP+DLRDKWRNLLRAS A  ++K EV+   KHAMR LP+ 
Sbjct: 428 YGVGRWTDIKRLLFSSSAYRTPVDLRDKWRNLLRASCAQLQSKREVEQKRKHAMRPLPQT 487

Query: 365 VLCRIRELATIHPYPRVPYSKKCN-GDTDSSRHPIKAKSAPFSSHGRNL 412
           +L R+ ELA IHPYP+   SK  + G   S+  P  +K AP SS GR L
Sbjct: 488 LLHRVSELAIIHPYPKGSNSKLPHVGHVTSAMLPTTSKDAP-SSLGRRL 535




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225440021|ref|XP_002276488.1| PREDICTED: uncharacterized protein LOC100263609 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548325|ref|XP_003542553.1| PREDICTED: uncharacterized protein LOC100810255 [Glycine max] Back     alignment and taxonomy information
>gi|357440365|ref|XP_003590460.1| hypothetical protein MTR_1g063940 [Medicago truncatula] gi|355479508|gb|AES60711.1| hypothetical protein MTR_1g063940 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356533240|ref|XP_003535174.1| PREDICTED: uncharacterized protein LOC100777720 [Glycine max] Back     alignment and taxonomy information
>gi|449451024|ref|XP_004143262.1| PREDICTED: uncharacterized protein LOC101219571 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449482457|ref|XP_004156288.1| PREDICTED: uncharacterized LOC101219571 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297823525|ref|XP_002879645.1| hypothetical protein ARALYDRAFT_482686 [Arabidopsis lyrata subsp. lyrata] gi|297325484|gb|EFH55904.1| hypothetical protein ARALYDRAFT_482686 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|110741390|dbj|BAF02244.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30687001|ref|NP_850275.1| protein TRF-like 8 [Arabidopsis thaliana] gi|79324500|ref|NP_001031497.1| protein TRF-like 8 [Arabidopsis thaliana] gi|330254243|gb|AEC09337.1| protein TRF-like 8 [Arabidopsis thaliana] gi|330254244|gb|AEC09338.1| protein TRF-like 8 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query419
TAIR|locus:504955960410 TRFL8 "TRF-like 8" [Arabidopsi 0.264 0.270 0.550 3.4e-29
TAIR|locus:2030255630 TRFL6 "TRF-like 6" [Arabidopsi 0.202 0.134 0.5 3.9e-21
UNIPROTKB|Q9LL45633 TBP1 "Telomere-binding protein 0.224 0.148 0.326 3.1e-07
TAIR|locus:2159048640 TBP1 "AT5G13820" [Arabidopsis 0.167 0.109 0.366 3.1e-07
TAIR|locus:2101232619 TRFL9 "TRF-like 9" [Arabidopsi 0.167 0.113 0.352 1.4e-06
TAIR|locus:2148383578 TRP1 "AT5G59430" [Arabidopsis 0.167 0.121 0.338 1.6e-06
TAIR|locus:2075145553 TRFL1 "TRF-like 1" [Arabidopsi 0.167 0.126 0.338 3.2e-06
TAIR|locus:2025007630 TRFL2 "TRF-like 2" [Arabidopsi 0.167 0.111 0.338 6.9e-06
TAIR|locus:2030275 287 AT1G72740 [Arabidopsis thalian 0.121 0.177 0.481 0.00063
TAIR|locus:2007878 296 AT1G17520 [Arabidopsis thalian 0.121 0.172 0.462 0.00088
TAIR|locus:504955960 TRFL8 "TRF-like 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 324 (119.1 bits), Expect = 3.4e-29, P = 3.4e-29
 Identities = 65/118 (55%), Positives = 82/118 (69%)

Query:   288 NQRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQK 347
             NQR+WTL EVM L+DGIS FGVGKWTDIK   F  ++HR P+D+RDKWRNLL+ASY  + 
Sbjct:   291 NQRIWTLDEVMNLVDGISHFGVGKWTDIKNHFFHYAAHRKPVDIRDKWRNLLKASYNEKH 350

Query:   348 NKGEVDPKH--AMRSLPKPVLCRIRELATIHPYPRVPYSKK-CN-GDTDSSRHPIKAK 401
             N G+ + K     RS+PK +L R+RELA++HPYP   +SK  C   D+  SR   K K
Sbjct:   351 NDGQAEEKRKSVARSIPKDILHRVRELASLHPYP---FSKSPCIVHDSSRSRSTSKNK 405




GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2030255 TRFL6 "TRF-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9LL45 TBP1 "Telomere-binding protein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2159048 TBP1 "AT5G13820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101232 TRFL9 "TRF-like 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148383 TRP1 "AT5G59430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075145 TRFL1 "TRF-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025007 TRFL2 "TRF-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030275 AT1G72740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007878 AT1G17520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 2e-17
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 8e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 9e-08
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-05
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 0.002
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
 Score = 75.3 bits (186), Expect = 2e-17
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 290 RMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLR 340
           R WT  E   L++G+ ++GVG W  I +  +   ++RT +DL+DKWRNL +
Sbjct: 1   RKWTDEEDEALVEGVEKYGVGNWAKILK-DYFFVNNRTSVDLKDKWRNLKK 50


Human telomere repeat binding factors, TRF1 and TRF2, function as part of the 6 component shelterin complex. TRF2 binds DNA and recruits RAP1 (via binding to the RAP1 protein c-terminal (RCT)) and TIN2 in the protection of telomeres from DNA repair machinery. Metazoan shelterin consists of 3 DNA binding proteins (TRF2, TRF1, and POT1) and 3 recruited proteins that bind to one or more of these DNA-binding proteins (RAP1, TIN2, TPP1). Schizosaccharomyces pombe TAZ1 is an orthlog and binds RAP1. Human TRF1 and TRF2 bind double-stranded DNA. hTRF2 consists of a basic N-terminus, a TRF homology domain, the RAP1 binding motif (RBM), the TIN2 binding motif (TBM) and a myb-like DNA binding domain, SANT, named after 'SWI3, ADA2, N-CoR and TFIIIB', several factors that share this domain. Tandem copies of the domain bind telomeric DNA tandem repeats as part of the capping complex. The single myb-like domain of TRF-type proteins is similar to the tandem myb_like domains found in yeast RAP1. Length = 50

>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 419
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.09
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.79
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.68
PLN03212249 Transcription repressor MYB5; Provisional 98.62
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.5
PLN03091 459 hypothetical protein; Provisional 98.35
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.08
PLN03212249 Transcription repressor MYB5; Provisional 97.92
PLN03091 459 hypothetical protein; Provisional 97.78
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.73
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.36
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.34
KOG0048238 consensus Transcription factor, Myb superfamily [T 96.83
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.44
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.44
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.41
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.08
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.86
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 95.73
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.25
PLN031421033 Probable chromatin-remodeling complex ATPase chain 92.58
KOG4282 345 consensus Transcription factor GT-2 and related pr 91.82
COG5147512 REB1 Myb superfamily proteins, including transcrip 91.79
KOG1279 506 consensus Chromatin remodeling factor subunit and 91.48
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 91.4
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 89.65
COG5147 512 REB1 Myb superfamily proteins, including transcrip 89.05
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 88.42
KOG0051607 consensus RNA polymerase I termination factor, Myb 87.3
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 83.46
PF08074173 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR01295 82.0
KOG2656 445 consensus DNA methyltransferase 1-associated prote 81.98
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
Probab=99.09  E-value=1.7e-10  Score=84.03  Aligned_cols=48  Identities=29%  Similarity=0.603  Sum_probs=42.9

Q ss_pred             CCCCCHHHHHHHHHHHhhcCCCChHHHHHHhcCCCCCCChhhHHHHHHHhh
Q 014780          289 QRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLL  339 (419)
Q Consensus       289 rr~WT~EEveaLv~GV~KyG~GkWk~Il~~~f~~f~~RT~VDLKDKWRNLl  339 (419)
                      +.+||++|++.|+++|++||.++|..|...++   .+||..+|+.+|++++
T Consensus         1 r~~Wt~eE~~~l~~~v~~~g~~~W~~Ia~~~~---~~Rt~~qc~~~~~~~~   48 (48)
T PF00249_consen    1 RGPWTEEEDEKLLEAVKKYGKDNWKKIAKRMP---GGRTAKQCRSRYQNLL   48 (48)
T ss_dssp             S-SS-HHHHHHHHHHHHHSTTTHHHHHHHHHS---SSSTHHHHHHHHHHHT
T ss_pred             CCCCCHHHHHHHHHHHHHhCCcHHHHHHHHcC---CCCCHHHHHHHHHhhC
Confidence            46899999999999999999988999999886   5999999999999985



These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....

>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF08074 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR012957 The CHDCT2 C-terminal domain is found in PHD/RING fingers and chromo domain-associated CHD-like helicases [] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
2qhb_A86 Crystal Structure Of Ngtrf Complexed With Telomeric 2e-09
2ckx_A83 Crystal Structure Of Ngtrf1, Double-Stranded Telome 2e-09
2juh_A121 Solution Structure Of Dna Binding Domain Of Ngtrf1 4e-09
2roh_A122 The Dna Binding Domain Of Rtbp1 Length = 122 2e-08
2aje_A105 Solution Structure Of The Arabidopsis Thaliana Telo 2e-08
>pdb|2QHB|A Chain A, Crystal Structure Of Ngtrf Complexed With Telomeric Dna Length = 86 Back     alignment and structure

Iteration: 1

Score = 60.5 bits (145), Expect = 2e-09, Method: Composition-based stats. Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Query: 289 QRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLR-ASYAHQK 347 +R ++++EV L++ + G G+W D+K F ++ HRT +DL+DKW+ L+ AS A Q+ Sbjct: 4 RRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQ 63 Query: 348 NKGEVDPK 355 +GE P+ Sbjct: 64 RRGEPVPQ 71
>pdb|2CKX|A Chain A, Crystal Structure Of Ngtrf1, Double-Stranded Telomeric Repeat Binding Factor From Nicotiana Tabacum Length = 83 Back     alignment and structure
>pdb|2JUH|A Chain A, Solution Structure Of Dna Binding Domain Of Ngtrf1 Length = 121 Back     alignment and structure
>pdb|2ROH|A Chain A, The Dna Binding Domain Of Rtbp1 Length = 122 Back     alignment and structure
>pdb|2AJE|A Chain A, Solution Structure Of The Arabidopsis Thaliana Telomeric Repeat-Binding Protein Dna Binding Domain Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query419
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-23
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 4e-22
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 7e-22
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 2e-21
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-15
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 5e-15
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 8e-15
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-14
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-06
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 2e-04
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-04
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
 Score = 91.6 bits (227), Expect = 4e-23
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 290 RMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNK 349
           R ++++EV  L++ +   G G+W D+K   F ++ HRT +DL+DKW+ L+  +       
Sbjct: 1   RPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAP--- 57

Query: 350 GEVDPKHAMRSLPKPVLCRIRELA 373
                +     +P+ +L R+    
Sbjct: 58  ----QQRRGEPVPQDLLDRVLAAH 77


>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 62 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.92
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.89
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.88
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.87
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.72
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.64
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.52
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.51
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.21
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.17
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.13
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.08
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.01
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.92
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.86
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.84
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.8
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.77
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.73
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.71
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.68
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.67
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.62
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.61
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.61
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.59
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.58
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.56
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.49
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.44
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 97.75
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.28
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.24
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.04
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.89
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.81
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 97.76
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.4
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.35
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.28
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.06
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.04
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 96.79
2crg_A70 Metastasis associated protein MTA3; transcription 96.79
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.56
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.53
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.16
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 96.04
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 95.56
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 95.46
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.15
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 93.98
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 92.99
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 90.93
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 86.51
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.92  E-value=1.2e-25  Score=190.10  Aligned_cols=95  Identities=26%  Similarity=0.581  Sum_probs=82.4

Q ss_pred             cCCCCCCCCCHHHHHHHHHHHhhcCCCChHHHHHHhcCCCCCCChhhHHHHHHHhhhccccccccCCCCCcccccCCCCH
Q 014780          284 DRRKNQRMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNKGEVDPKHAMRSLPK  363 (419)
Q Consensus       284 ~rRK~rr~WT~EEveaLv~GV~KyG~GkWk~Il~~~f~~f~~RT~VDLKDKWRNLlKas~~p~~~r~~~~rK~~~~~iP~  363 (419)
                      ..|+++++||+||+++|++||++||.|+|++|+..+|..|.+||.+|||||||||+|.+.++.+.+++       .|||+
T Consensus         8 ~~rr~r~~WT~EEd~~L~~gV~k~G~g~W~~I~~~~~~~f~~RT~v~lKdrWrnllk~~~~~p~~~rg-------~~~P~   80 (105)
T 2aje_A            8 PQRRIRRPFSVAEVEALVQAVEKLGTGRWRDVKLCAFEDADHRTYVDLKDKWKTLVHTAKISPQQRRG-------EPVPQ   80 (105)
T ss_dssp             -CCCCCCSCCHHHHHHHHHHHHHHCSSSHHHHHSSSSSSTTCCCHHHHHHHHHHHHHTTTCCTTTTTC-------CSCCC
T ss_pred             cCCCCCCCCCHHHHHHHHHHHHHhCCCChHHHHHHhccccCCCCHHHHHHHHHHHHhhccCCcccccC-------CCCCH
Confidence            36788999999999999999999999999999999988899999999999999999977765554443       36999


Q ss_pred             HHHHHHHHHHhhCCCCCCcCCCccC
Q 014780          364 PVLCRIRELATIHPYPRVPYSKKCN  388 (419)
Q Consensus       364 ~lL~RVreLa~~hpyp~~~~~~~~~  388 (419)
                      ++|+||++   +|+||.+.+.|.-.
T Consensus        81 ~~l~rv~~---~~~~~~~~~~~~~~  102 (105)
T 2aje_A           81 ELLNRVLN---AHGYWTQQQMQQLQ  102 (105)
T ss_dssp             HHHHHHHH---HHHHHHHHTTTTSS
T ss_pred             HHHHHHHH---HHHHHHHHHHHHHh
Confidence            99999999   77888887777544



>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 419
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 7e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-09
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-08
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-06
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-04
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 0.003
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Telomere binding protein TBP1
species: Tobacco (Nicotiana tabacum) [TaxId: 4097]
 Score = 61.6 bits (149), Expect = 7e-13
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 290 RMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNK 349
           R ++++EV  L++ +   G G+W D+K   F ++ HRT +DL+DKW+ L+  +       
Sbjct: 1   RPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAP--- 57

Query: 350 GEVDPKHAMRSLPKPVLCRIREL 372
                +     +P+ +L R+   
Sbjct: 58  ----QQRRGEPVPQDLLDRVLAA 76


>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query419
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.81
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.67
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.65
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.17
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.16
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 98.93
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.93
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.9
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.8
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.77
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.66
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.53
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.42
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.38
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.49
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.41
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.33
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 96.15
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 95.19
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 86.34
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Telomere binding protein TBP1
species: Tobacco (Nicotiana tabacum) [TaxId: 4097]
Probab=99.81  E-value=3.4e-20  Score=147.39  Aligned_cols=78  Identities=28%  Similarity=0.643  Sum_probs=68.4

Q ss_pred             CCCCHHHHHHHHHHHhhcCCCChHHHHHHhcCCCCCCChhhHHHHHHHhhhccccccccCCCCCcccccCCCCHHHHHHH
Q 014780          290 RMWTLSEVMKLIDGISQFGVGKWTDIKRLLFSSSSHRTPIDLRDKWRNLLRASYAHQKNKGEVDPKHAMRSLPKPVLCRI  369 (419)
Q Consensus       290 r~WT~EEveaLv~GV~KyG~GkWk~Il~~~f~~f~~RT~VDLKDKWRNLlKas~~p~~~r~~~~rK~~~~~iP~~lL~RV  369 (419)
                      |+||.||+++|++||++||.|+|+.|.+.++..|.+||++|||||||||++......+.+++.       ++|+++|++|
T Consensus         1 r~WT~eEd~~L~~~V~~~G~~~W~~I~~~~~~~~~~Rt~~qck~RWrn~l~~~~~~~~~~~~~-------~~p~ell~~v   73 (83)
T d2ckxa1           1 RPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGE-------PVPQDLLDRV   73 (83)
T ss_dssp             CCCCHHHHHHHHHHHHHHCSSCHHHHHHHHCTTCTTSCHHHHHHHHHHHHHHHHSCGGGCCSS-------CCCHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHCcccHHHHHHHHHhhccCCCHHHHHHHHHHHhhhhccCcccccCC-------CCCHHHHHHH
Confidence            689999999999999999999999999988777899999999999999999877665544433       4899999999


Q ss_pred             HHHHh
Q 014780          370 RELAT  374 (419)
Q Consensus       370 reLa~  374 (419)
                      .++.+
T Consensus        74 ~~~~~   78 (83)
T d2ckxa1          74 LAAHA   78 (83)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            99554



>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure