Citrus Sinensis ID: 014807
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 418 | 2.2.26 [Sep-21-2011] | |||||||
| P26294 | 474 | 15-cis-phytoene desaturas | yes | no | 0.715 | 0.630 | 0.200 | 3e-09 | |
| P29273 | 472 | Phytoene dehydrogenase OS | N/A | no | 0.720 | 0.637 | 0.186 | 2e-08 | |
| Q31N27 | 481 | Probable zeta-carotene de | no | no | 0.854 | 0.742 | 0.209 | 6e-08 | |
| P80093 | 582 | 15-cis-phytoene desaturas | N/A | no | 0.722 | 0.518 | 0.188 | 2e-07 | |
| P49086 | 571 | Phytoene dehydrogenase, c | N/A | no | 0.722 | 0.528 | 0.201 | 3e-07 | |
| Q07356 | 566 | 15-cis-phytoene desaturas | yes | no | 0.722 | 0.533 | 0.194 | 6e-07 | |
| P28553 | 570 | Phytoene dehydrogenase, c | yes | no | 0.717 | 0.526 | 0.187 | 1e-06 | |
| Q0DUI8 | 578 | Phytoene dehydrogenase, c | no | no | 0.720 | 0.520 | 0.196 | 3e-06 | |
| A2XDA1 | 578 | Phytoene dehydrogenase, c | N/A | no | 0.720 | 0.520 | 0.196 | 3e-06 | |
| Q40406 | 570 | Phytoene dehydrogenase, c | N/A | no | 0.717 | 0.526 | 0.193 | 1e-05 |
| >sp|P26294|PDS_SYNE7 15-cis-phytoene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=pds PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 63.5 bits (153), Expect = 3e-09, Method: Compositional matrix adjust.
Identities = 63/314 (20%), Positives = 143/314 (45%), Gaps = 15/314 (4%)
Query: 68 DSITARELFKQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDL 127
D + E ++ ER+ V + + F ++ SA L L L +K +
Sbjct: 147 DQYSWTEWLRKQNIPERVNDEVFIAMAKALNFIDPDEISATVVLTALNRF-LQEKKGSMM 205
Query: 128 VWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCG-----KETYS 182
+ G E++ +P ++ ++ RG + L + +F+ +++ + + G ++
Sbjct: 206 AFLDGAPPERLCQPIVEHVQARGGDVLLNAPLKEFVLNDDSSVQAFRIAGIKGQEEQLIE 265
Query: 183 AGAVVLAVGISTLQELIKNSILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNACS 242
A A V A+ + L+ L+ ++ F ++ L + V+++ LWFD+K+T ++ +
Sbjct: 266 ADAYVSALPVDPLKLLLPDAWKA-MPYFQQLDGLQGVPVINIHLWFDRKLT--DIDHLLF 322
Query: 243 GFGDSLAWTFFDLNKIYDEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCI-K 301
L+ + D++ E++D ++++ F A + + D+ ++A ++ + K +
Sbjct: 323 SRSPLLS-VYADMSNTCREYEDPDRSMLELVFAPAKDWIGRSDEDILAATMAEIEKLFPQ 381
Query: 302 DFS---TATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQE 358
FS A + +KI + P S+ PG +Y + N F+ GD+ R+ + S E
Sbjct: 382 HFSGENPARLRKYKIVKTPLSVYKATPGRQQYRPDQASPIANFFLTGDYTMQRYLA-SME 440
Query: 359 RSYVTGLEAANRVV 372
+ ++G A ++
Sbjct: 441 GAVLSGKLTAQAII 454
|
This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene. Also active with phytofluene and 1,2-epoxyphytoene as substrates. Synechococcus elongatus (strain PCC 7942) (taxid: 1140) EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 5 |
| >sp|P29273|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q31N27|ZDS_SYNE7 Probable zeta-carotene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=zds PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P80093|PDS_CAPAN 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=PDS PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P49086|CRTI_MAIZE Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Zea mays GN=PDS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q07356|PDS_ARATH 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=PDS PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P28553|CRTI_SOYBN Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Glycine max GN=PDS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0DUI8|CRTI_ORYSJ Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. japonica GN=PDS PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|A2XDA1|CRTI_ORYSI Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. indica GN=PDS1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q40406|CRTI_NARPS Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=PDS1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 418 | ||||||
| 255560501 | 530 | Phytoene dehydrogenase, putative [Ricinu | 0.997 | 0.786 | 0.763 | 0.0 | |
| 359474834 | 530 | PREDICTED: phytoene dehydrogenase-like [ | 0.992 | 0.783 | 0.754 | 0.0 | |
| 297744581 | 531 | unnamed protein product [Vitis vinifera] | 0.992 | 0.781 | 0.724 | 0.0 | |
| 449458684 | 533 | PREDICTED: phytoene dehydrogenase-like [ | 0.990 | 0.776 | 0.691 | 1e-178 | |
| 148910773 | 574 | unknown [Picea sitchensis] | 0.995 | 0.724 | 0.661 | 1e-173 | |
| 168030354 | 532 | predicted protein [Physcomitrella patens | 0.995 | 0.781 | 0.573 | 1e-151 | |
| 38345844 | 529 | OSJNBa0084K11.8 [Oryza sativa Japonica G | 0.995 | 0.786 | 0.580 | 1e-150 | |
| 116311132 | 529 | B0103C08-B0602B01.15 [Oryza sativa Indic | 0.995 | 0.786 | 0.580 | 1e-150 | |
| 302804622 | 527 | hypothetical protein SELMODRAFT_180688 [ | 0.966 | 0.766 | 0.595 | 1e-150 | |
| 302753308 | 530 | hypothetical protein SELMODRAFT_74261 [S | 0.971 | 0.766 | 0.589 | 1e-149 |
| >gi|255560501|ref|XP_002521265.1| Phytoene dehydrogenase, putative [Ricinus communis] gi|223539533|gb|EEF41121.1| Phytoene dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 684 bits (1764), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 319/418 (76%), Positives = 364/418 (87%), Gaps = 1/418 (0%)
Query: 1 MKSAQYSEEGLEVEFPIFQDLNQLPTPLGTLFYTQFSRLPLVDRLTSLPLMAAVIDFDNT 60
++SA YS EGLEVEFP+FQD QLPTPLGTL+YTQF+RLPLVDRLTSLPLMAAVIDFDNT
Sbjct: 113 IRSALYSSEGLEVEFPVFQDQPQLPTPLGTLYYTQFTRLPLVDRLTSLPLMAAVIDFDNT 172
Query: 61 DVAWRKYDSITARELFKQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILA 120
D AWRKYDSITARELFKQFGCSE+LYRNV GPL+QVGLFAPAEQCSAAATLGILY+I LA
Sbjct: 173 DTAWRKYDSITARELFKQFGCSEKLYRNVFGPLLQVGLFAPAEQCSAAATLGILYYISLA 232
Query: 121 HQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKET 180
HQK+FD+VWCRGT+REKIF PWMDS+RT+GC FLDG +V DFI +EE CI +VVC ET
Sbjct: 233 HQKDFDMVWCRGTIREKIFSPWMDSLRTKGCRFLDGEKVIDFIINEETSCIEEVVCSNET 292
Query: 181 YSAGAVVLAVGISTLQELIKNS-ILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSN 239
+A AV+LAVGIS +QEL+KNS L REEFLKVLNLA ID+++ KL D+KV + + SN
Sbjct: 293 INADAVILAVGISKVQELVKNSAALSTREEFLKVLNLAGIDILTCKLQLDRKVNLAHASN 352
Query: 240 ACSGFGDSLAWTFFDLNKIYDEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKC 299
ACSGF DS +WTFFDLN ++DEHKD+ T +QADFYHANEL+PL D+ VV K +SYLSKC
Sbjct: 353 ACSGFDDSFSWTFFDLNALHDEHKDNQVTTLQADFYHANELLPLTDELVVTKTMSYLSKC 412
Query: 300 IKDFSTATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQER 359
IKDF A V+D +I RFPKSLTHFFPGSYK+MMRG TSFPNLFMAGDWI TRHGSWSQE+
Sbjct: 413 IKDFENAVVIDKEISRFPKSLTHFFPGSYKHMMRGSTSFPNLFMAGDWIITRHGSWSQEK 472
Query: 360 SYVTGLEAANRVVDYLGDGSFSKIIPVEEDEPHIEALRTVNRRFNEIRAQLPLSDYFL 417
SYVTGLEAANRVVD+L +GSF+KII VEEDEPH++ALR+VNRRFNEI Q+PL YFL
Sbjct: 473 SYVTGLEAANRVVDFLEEGSFAKIIAVEEDEPHVQALRSVNRRFNEISDQIPLFGYFL 530
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359474834|ref|XP_002278046.2| PREDICTED: phytoene dehydrogenase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744581|emb|CBI37843.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449458684|ref|XP_004147077.1| PREDICTED: phytoene dehydrogenase-like [Cucumis sativus] gi|449518113|ref|XP_004166088.1| PREDICTED: phytoene dehydrogenase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|148910773|gb|ABR18453.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|168030354|ref|XP_001767688.1| predicted protein [Physcomitrella patens subsp. patens] gi|162681008|gb|EDQ67439.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
| >gi|38345844|emb|CAE01845.2| OSJNBa0084K11.8 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|116311132|emb|CAH68058.1| B0103C08-B0602B01.15 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|302804622|ref|XP_002984063.1| hypothetical protein SELMODRAFT_180688 [Selaginella moellendorffii] gi|300148415|gb|EFJ15075.1| hypothetical protein SELMODRAFT_180688 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302753308|ref|XP_002960078.1| hypothetical protein SELMODRAFT_74261 [Selaginella moellendorffii] gi|300171017|gb|EFJ37617.1| hypothetical protein SELMODRAFT_74261 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 418 | ||||||
| TAIR|locus:2129515 | 566 | PDS3 "phytoene desaturase 3" [ | 0.722 | 0.533 | 0.194 | 2.8e-06 |
| TAIR|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 140 (54.3 bits), Expect = 2.8e-06, P = 2.8e-06
Identities = 61/313 (19%), Positives = 130/313 (41%)
Query: 68 DSITARELFKQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILAHQKNFDL 127
D ++ +E ++ G ER+ V + + F ++ S L I L + +
Sbjct: 240 DGLSVKEWMEKQGVPERVTDEVFIAMSKALNFINPDELSMQCIL-IALNRFLQEKHGSKM 298
Query: 128 VWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSAGAVV 187
+ G E++ P +D +R+ G E R+ +++ S ++ T A V
Sbjct: 299 AFLDGNPPERLCMPVVDHIRSLGGEVQLNSRIKKIELNDDGTVKSFLLTNGSTVEGDAYV 358
Query: 188 LAVGISTLQELIKNSILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNACSGFGDS 247
A + L+ L+ + F K+ L + V++V +WFD+K+ N + +
Sbjct: 359 FAAPVDILKLLLPDPWK-EIPYFKKLDKLVGVPVINVHIWFDRKLK--NTYDHLLFSRSN 415
Query: 248 LAWTFFDLNKIYDEHKDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCIKDF---- 303
L + D++ E+ D + ++++ F A E + D ++ + L K D
Sbjct: 416 LLSVYADMSLTCKEYYDPNRSMLELVFAPAEEWISRTDSDIIDATMKELEKLFPDEISAD 475
Query: 304 -STATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYV 362
S A ++ + + + P+S+ P + ++AGD+ ++ + S E + +
Sbjct: 476 QSKAKILKYHVVKTPRSVYKTIPNCEPCRPLQRSPIEGFYLAGDYTKQKYLA-SMEGAVL 534
Query: 363 TGLEAANRVV-DY 374
+G + +V DY
Sbjct: 535 SGKFCSQSIVQDY 547
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.324 0.138 0.423 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 418 418 0.00082 118 3 11 22 0.48 33
34 0.45 37
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 619 (66 KB)
Total size of DFA: 280 KB (2147 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 34.62u 0.16s 34.78t Elapsed: 00:00:01
Total cpu time: 34.63u 0.16s 34.79t Elapsed: 00:00:01
Start: Mon May 20 19:18:38 2013 End: Mon May 20 19:18:39 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 418 | |||
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 1e-68 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 2e-11 | |
| TIGR03467 | 411 | TIGR03467, HpnE, squalene-associated FAD-dependent | 2e-11 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 5e-08 | |
| TIGR02732 | 474 | TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot | 1e-06 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 2e-05 | |
| PLN02487 | 569 | PLN02487, PLN02487, zeta-carotene desaturase | 6e-05 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 0.003 |
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Score = 224 bits (574), Expect = 1e-68
Identities = 88/409 (21%), Positives = 145/409 (35%), Gaps = 17/409 (4%)
Query: 2 KSAQYSEEGLEVEFPIFQDLNQLPTPLGTLFYTQFSRLPLVDRLTSLPLMAAVIDFDN-T 60
+ + G + P T F RLP + R + + + D
Sbjct: 80 REHTKTFVGSGTRPGAIGRFARPDAPQPTNGLKAFLRLPQLPRREKIRFVLRLGDAPIGA 139
Query: 61 DVAWRKYDSITARELFKQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFIILA 120
D + R+ D I+ + K+ G E Y+ P+ F E CSA L IL ++
Sbjct: 140 DRSLRELDKISFADWLKEKGAREGAYKAAFAPIALALTFIDPEGCSARFFLTILNLFLIV 199
Query: 121 HQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCIS--DVVCGK 178
+ L RG+ E + +PW + + RG + V + D R
Sbjct: 200 TLEASILRNLRGSPDEVLLQPWTEYIPERGRKVHADYPVKELDLDGARGLAKVTGGDVTG 259
Query: 179 ETYSAGAVVLAVGISTLQELIKN--SILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPN 236
A + V +Q ++ S F + L + V+++ L FD VT
Sbjct: 260 PEQEQQAALAVVDAFAVQRFKRDLPSEWPKWSNFDGLYGLRLVPVITLHLRFDGWVTELT 319
Query: 237 VSNACSGFGDSLAWTFFDLNKIY--------DEHKDDSATVIQADFYHANELMPLKDDQV 288
N G D+L W+ L + D + + ++ + D+ +
Sbjct: 320 DRNQQFGI-DNLLWSDDTLGGVVADLALTSPDYVEPGAGCYLEKVLAPGWPFLFESDEAI 378
Query: 289 VAKAVSYLSKCIKDFSTATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWI 348
VA L + + + A + + +SL PGSY Y T PNL +AGD+
Sbjct: 379 VATFEKELYELVPSLAEAKLKSSVLVN-QQSLYGLAPGSYHYRPEQKTPIPNLLLAGDYT 437
Query: 349 TTRHGSWSQERSYVTGLEAANRVVDYLGDGSFSKIIPVEEDEPHIEALR 397
S E + ++GL AAN ++D LG + D LR
Sbjct: 438 KQP-YLGSMEGATLSGLLAANAILDNLGHHAPL-DRRDLSDPAPFGVLR 484
|
Length = 485 |
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 418 | |||
| PLN02487 | 569 | zeta-carotene desaturase | 100.0 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 100.0 | |
| PLN02612 | 567 | phytoene desaturase | 100.0 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 100.0 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 100.0 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 100.0 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.96 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.96 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.96 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.96 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.95 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.94 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 99.94 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.9 | |
| PLN02268 | 435 | probable polyamine oxidase | 99.89 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 99.87 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.86 | |
| PLN02568 | 539 | polyamine oxidase | 99.86 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 99.85 | |
| PLN02676 | 487 | polyamine oxidase | 99.85 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.85 | |
| PLN03000 | 881 | amine oxidase | 99.85 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.84 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 99.83 | |
| PLN02976 | 1713 | amine oxidase | 99.83 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 99.82 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.69 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.64 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 99.59 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.57 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.53 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 99.53 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 99.4 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 99.33 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 98.81 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 98.73 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 98.53 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 98.31 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 98.22 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 98.18 | |
| KOG1439 | 440 | consensus RAB proteins geranylgeranyltransferase c | 98.16 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 97.92 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 97.91 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 97.79 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 97.77 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 97.74 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 97.57 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 97.49 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 97.47 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 97.46 | |
| KOG4405 | 547 | consensus GDP dissociation inhibitor [Signal trans | 97.44 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 97.43 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 97.38 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 97.38 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 97.37 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 97.11 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 97.08 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 97.03 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 96.98 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 96.96 | |
| COG4716 | 587 | Myosin-crossreactive antigen [Function unknown] | 96.95 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 96.9 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 96.89 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 96.87 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 96.8 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 96.75 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 96.74 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 96.63 | |
| TIGR03377 | 516 | glycerol3P_GlpA glycerol-3-phosphate dehydrogenase | 96.63 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 96.57 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 96.55 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 96.51 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 96.5 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 96.49 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 96.47 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 96.45 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 96.43 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 96.34 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 96.3 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.29 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 96.2 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 96.13 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 96.1 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 96.04 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 95.89 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 95.87 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 95.86 | |
| PLN02463 | 447 | lycopene beta cyclase | 95.85 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 95.83 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 95.82 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 95.81 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 95.78 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 95.75 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 95.68 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 95.67 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 95.62 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 95.53 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 95.51 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 95.44 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 95.44 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 95.32 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 95.3 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 95.3 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 95.29 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 95.28 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 95.23 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 95.21 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 95.01 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 94.99 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 94.71 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 94.7 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 94.63 | |
| TIGR01816 | 565 | sdhA_forward succinate dehydrogenase, flavoprotein | 94.6 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 94.6 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 94.59 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 94.46 | |
| PRK07121 | 492 | hypothetical protein; Validated | 94.44 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 94.38 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 94.37 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 94.37 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 94.36 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 94.2 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 94.2 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 94.02 | |
| PLN02985 | 514 | squalene monooxygenase | 93.98 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 93.93 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 93.89 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 93.85 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 93.79 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 93.79 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 93.68 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 93.52 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 93.48 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 93.25 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 93.17 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 93.16 | |
| PRK06116 | 450 | glutathione reductase; Validated | 93.14 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 93.14 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 93.09 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.93 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 92.89 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 92.87 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.86 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 92.83 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 92.76 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 92.71 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 92.7 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.65 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 92.28 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 92.28 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 92.21 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 92.14 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 92.11 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.08 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 91.94 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 91.93 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 91.92 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 91.92 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 91.87 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 91.85 | |
| PLN02507 | 499 | glutathione reductase | 91.82 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 91.82 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 91.8 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 91.73 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 91.73 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 91.52 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 91.51 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 91.4 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 91.39 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 91.33 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 91.3 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 91.29 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 91.07 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 91.04 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 90.99 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 90.97 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 90.95 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 90.89 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 90.82 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 90.81 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 90.59 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 90.57 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 90.54 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 90.48 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 90.22 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 90.02 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 89.7 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 89.68 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 89.25 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 89.18 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 88.85 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 88.8 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 88.71 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 88.69 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 88.61 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 88.57 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 88.56 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 88.38 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 88.35 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 88.25 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 88.16 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 88.15 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 87.72 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 87.69 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 87.44 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 87.39 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 87.33 | |
| PRK06370 | 463 | mercuric reductase; Validated | 87.21 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 86.8 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 86.8 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 86.69 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 86.65 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 86.54 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 86.22 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 86.21 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 85.9 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 85.8 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 85.54 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 85.52 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 85.2 | |
| PLN02815 | 594 | L-aspartate oxidase | 85.2 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 85.01 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 84.68 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 84.66 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 84.56 | |
| PLN02546 | 558 | glutathione reductase | 84.42 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 84.27 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 83.99 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 83.67 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 83.1 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 83.05 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 82.98 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 82.96 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 82.67 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 82.28 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 81.86 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 81.68 | |
| PLN02661 | 357 | Putative thiazole synthesis | 81.13 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 81.09 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 81.06 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 80.58 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 80.54 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 80.41 |
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-41 Score=339.38 Aligned_cols=350 Identities=20% Similarity=0.256 Sum_probs=275.4
Q ss_pred CCCCccccc-ccCCCCCChhhhhhhchhH------HHHhhcCCChhHHhhcCCccHHHHHHHhCCCHHHHHHHHHHHHHh
Q 014807 24 LPTPLGTLF-YTQFSRLPLVDRLTSLPLM------AAVIDFDNTDVAWRKYDSITARELFKQFGCSERLYRNVIGPLVQV 96 (418)
Q Consensus 24 ~p~p~~~~~-~l~~~~ls~~dk~~~~~l~------~~~~~~~~~~~~~~~~d~~s~~e~l~~~~~~~~~~~~~~~p~~~~ 96 (418)
++.|++.+. +++++.+++.||++++..+ ..++..+...+.+..++++|+.+|+++++.+++++++||+|++.+
T Consensus 177 ~~~pl~~~~~~l~~~~Ls~~dklr~~~~l~~~~~~~al~~~~~~~~~~~~~d~~sv~~~l~r~~g~~~~~~~l~dPll~~ 256 (569)
T PLN02487 177 VGAPLHGIKAFLTTNQLEPYDKARNALALATSPVVRALVDPDGAMRDIRDLDDISFSDWFTSHGGTRMSIKRMWDPIAYA 256 (569)
T ss_pred CCchhhhHHHHHcCCCCCHHHHHhhcccccccchhhhccCccccccccccccCCcHHHHHHHhCCCHHHHHHHHHHHHHH
Confidence 788888777 9999999999999985321 111111111334556789999999999988888999999999999
Q ss_pred hhcCChhhhHHHHHHHHHHHHHhhcCCCcceeeecCCcchhhHHHHHHHHHhcCcEEEcCceeeEEEecCC-CC--eEEE
Q 014807 97 GLFAPAEQCSAAATLGILYFIILAHQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEE-RC--CISD 173 (418)
Q Consensus 97 ~~~~~~~~~Sa~~~~~~l~~~~~~~~~~~~~~~~~gG~~~~l~~~l~~~l~~~G~~I~l~t~V~~I~~~~~-~g--~v~~ 173 (418)
+++++++++|+..++.+|..+. .....+++.|++||+++.|++++++.|+++|++|+++++|++|..+++ +| ++++
T Consensus 257 ~~~~~~d~~SA~~~~~vl~~~~-~~~~~~~l~~~~Gg~~~~l~~pl~~~L~~~Gg~V~l~~~V~~I~~~~~~~g~~~v~g 335 (569)
T PLN02487 257 LGFIDCDNISARCMLTIFSLFA-TKTEASLLRMLKGSPDVRLSGPIAKYITDRGGRFHLRWGCREILYDKSPDGETYVTG 335 (569)
T ss_pred hhCCCHHHHHHHHHHHHHHHHh-hcCCcceeeecCCCchHHHHHHHHHHHHHcCCEEEeCCceEEEEEecCCCCceeEEE
Confidence 9999999999999999886532 234456788999999767999999999999999999999999998742 13 4778
Q ss_pred EEE--C--CeEEecCEEEEccChhhHHHhhcccccCChHHHHHhcCCCCccEEEEEEEeccCCCCCCCCc------ceec
Q 014807 174 VVC--G--KETYSAGAVVLAVGISTLQELIKNSILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSN------ACSG 243 (418)
Q Consensus 174 v~~--~--g~~~~ad~VV~A~p~~~~~~Ll~~~~~~~~~~~~~l~~l~~~~~~~v~l~~~~~~~~~~~~~------~~~~ 243 (418)
|++ + ++++.+|+||+|+|++.+.+|+++.. +..+.++.+..+.+.++++++|+||+++..+.+.+ .+.|
T Consensus 336 v~~~~~~~~~~~~aD~VV~A~p~~~~~~Llp~~~-~~~~~~~~l~~L~~~pi~tv~L~~d~~v~~~~~~~~~r~l~~~~g 414 (569)
T PLN02487 336 LKVSKATEKEIVKADAYVAACDVPGIKRLLPEQW-REYEFFDNIYKLVGVPVVTVQLRYNGWVTEMQDLELSRQLRRAAG 414 (569)
T ss_pred EEEecCCCceEEECCEEEECCCHHHHHHhCCchh-hccHHHhHHhcCCCeeEEEEEEEeccccccccccccccccccccc
Confidence 887 3 34689999999999999999998762 22345678889988999999999998876432110 1222
Q ss_pred cCC-----Ccccee-eecccccc-cc-CCCCCeEEEEEeecCCCCCCCCHHHHHHHHHHHHhhhhcCCCCceeeeeeEEE
Q 014807 244 FGD-----SLAWTF-FDLNKIYD-EH-KDDSATVIQADFYHANELMPLKDDQVVAKAVSYLSKCIKDFSTATVMDHKIRR 315 (418)
Q Consensus 244 ~~~-----~~~~~~-~d~s~~~~-~~-~~~~~~~l~~~~~~~~~~~~~~~~el~~~~~~~L~~~~p~~~~~~~~~~~v~r 315 (418)
++. ...|.+ +|..-..+ .| .+.+++++++++++++++..+++++|++.++++|.++||...+..+.+..+.+
T Consensus 415 ~~~~~~~~~~~~~f~~di~l~~~~~~~~~~~g~~l~~vis~a~~~~~~~~~ei~~~~~~~L~~~~p~~~~~~v~~~~vv~ 494 (569)
T PLN02487 415 LDNLLYSADADFSCFADLALTSPEDYYKEGEGSLIQAVLTPGDPYMPLSNDKIVEKVHKQVLELFPSSRGLEVTWSSVVK 494 (569)
T ss_pred ccccccccCCCcceEeeeecCCHHHHcccCCceEEEEEEcCCccccCCCHHHHHHHHHHHHHHhCcccccCceEEEEEEE
Confidence 221 222322 24221111 12 22346788888888888999999999999999999999997655678888999
Q ss_pred cCCCccccCCCCCCCCCCCCCCCCCEEEeccccccCCCccchHHHHHHHHHHHHHHHHHhC
Q 014807 316 FPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVVDYLG 376 (418)
Q Consensus 316 ~~~a~~~~~pg~~~~r~~~~~~~~~l~laGd~~~~~~g~~~~egAi~SG~~aA~~Il~~~~ 376 (418)
.+++++.+.||+...||.++|+++|||+||||+.++++ .+||||++||..||+.|++..+
T Consensus 495 ~~~at~~~~pg~~~~RP~~~T~~~nl~LAGD~t~~~yP-at~EgAv~SG~~AA~~i~~~~~ 554 (569)
T PLN02487 495 IGQSLYREAPGMDPFRPDQKTPISNFFLAGSYTKQDYI-DSMEGATLSGRQAAAYICEAGE 554 (569)
T ss_pred ccCceeccCCCccccCCCCCCCCCCEEEeCcccccCCc-chHHHHHHHHHHHHHHHHHHhh
Confidence 99999999999988889999999999999999887777 6999999999999999988754
|
|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >COG4716 Myosin-crossreactive antigen [Function unknown] | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
Score = 67.3 bits (164), Expect = 2e-12
Identities = 61/390 (15%), Positives = 129/390 (33%), Gaps = 59/390 (15%)
Query: 21 LNQLPTPLGTLFYTQFSRLPLVDRLTSLPLMAAVIDFDNTDVAWRKYDSITARELFK-QF 79
L+ +P T+ + + A +DF A + D + E F+ +
Sbjct: 103 LHPMPKGAVMGIPTKIAPFVSTGLFSLSGKARAAMDFI--LPASKTKDDQSLGEFFRRRV 160
Query: 80 GCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILY-------FIILAHQKNFDLVWCRG 132
G + + N+I PL+ ++ S +T Y +IL +K +
Sbjct: 161 G--DEVVENLIEPLLSGIYAGDIDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQ 218
Query: 133 TLREKI-----FEPWMDSMRTRGCEFLD------GRRVTDFIYDEERCCISDVVCGKETY 181
+K + ++ + L G +VT + + + T
Sbjct: 219 LTAKKQGQFQTLSTGLQTLVEEIEKQLKLTKVYKGTKVTKLSHSGSCYSL--ELDNGVTL 276
Query: 182 SAGAVVLAVGISTLQELIKNSILCNREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNAC 241
A +V++ ++ LK ++ S+ V+ L F + +V
Sbjct: 277 DADSVIVTAPHKAAAGMLSELPA---ISHLKNMHSTSVANVA--LGFPE----GSVQMEH 327
Query: 242 SGFGDS---------LAWTFFDLNKIYDEHKDDSATVIQADFYHAN--ELMPLKDDQVVA 290
G G A T+ NK + + T+++A A ++ L D+ ++
Sbjct: 328 EGTGFVISRNSDFAITACTWT--NKKWPHAAPEGKTLLRAYVGKAGDESIVDLSDNDIIN 385
Query: 291 KAVSYLSKCIKDFSTATVMDHKIRRFPKSLTHFFPGSYKYMMRGF-----TSFPNLFMAG 345
+ L K + + R+ +S+ + G +K ++ +++P ++M G
Sbjct: 386 IVLEDLKKVMNI--NGEPEMTCVTRWHESMPQYHVG-HKQRIKELREALASAYPGVYMTG 442
Query: 346 DWITTRHGSWSQERSYVTGLEAANRVVDYL 375
G G A + + YL
Sbjct: 443 AS---FEGV-GIPDCIDQGKAAVSDALTYL 468
|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 418 | |||
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 100.0 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.96 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.95 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 99.95 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.94 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.94 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.93 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 99.93 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 99.93 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 99.92 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.91 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.88 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 99.88 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.87 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.87 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 99.83 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 99.82 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 99.79 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.79 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 99.78 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 99.71 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.69 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 99.69 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 99.67 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.62 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 99.5 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 99.47 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 99.47 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 99.42 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 99.36 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 99.35 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 99.32 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 98.9 | |
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 98.8 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.17 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 98.11 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.05 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 98.04 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 98.02 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 97.99 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 97.87 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 97.76 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 97.72 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 97.66 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 97.66 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 97.62 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 97.6 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 97.55 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 97.54 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 97.29 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 97.25 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 97.22 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 97.21 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 97.16 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 97.13 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 97.12 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 97.09 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 96.9 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 96.76 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 96.65 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 96.53 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 96.53 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 96.4 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 96.39 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 96.26 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 96.24 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 96.17 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 96.16 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 96.07 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 96.0 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 95.84 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 95.77 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 95.77 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 95.74 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 95.72 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 95.46 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 95.4 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 95.38 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 95.18 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 95.12 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 95.07 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 95.03 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 94.96 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 94.6 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 94.53 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 94.52 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 94.47 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 94.44 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 94.39 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 94.37 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 94.36 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 94.3 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 94.27 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 94.11 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 94.09 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 94.08 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 94.06 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 94.0 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 93.98 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 93.9 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 93.89 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 93.87 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 93.86 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 93.81 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 93.8 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 93.75 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 93.74 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 93.68 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 93.67 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 93.64 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 93.58 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 93.23 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 93.13 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 93.11 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 92.93 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 92.91 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 92.9 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 92.81 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 92.73 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 92.7 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 92.69 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 92.6 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 92.55 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 92.55 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 92.44 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 92.39 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 92.33 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 92.3 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 92.28 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 92.28 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 91.99 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 91.96 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 91.93 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 91.9 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 91.88 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 91.77 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 91.7 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 91.69 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 91.65 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 91.49 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 91.41 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 91.1 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 91.08 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 91.08 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 91.05 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 90.89 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 90.83 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 90.69 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 90.37 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 90.35 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 90.3 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 90.15 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 90.07 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 89.95 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 89.78 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 89.69 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 89.51 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 89.5 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 89.25 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 89.24 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 89.14 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 88.98 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 88.82 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 88.69 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 88.63 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 88.59 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 88.58 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 88.44 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 88.41 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 88.14 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 88.13 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 87.83 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 87.76 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 87.73 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 87.72 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 87.53 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 87.25 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 87.13 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 86.75 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 86.53 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 86.02 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 86.02 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 85.93 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 85.92 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 85.9 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 85.64 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 85.6 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 85.42 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 84.85 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 84.84 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 84.21 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 84.21 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 84.09 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 84.0 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 83.75 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 83.69 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 83.66 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 83.59 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 83.38 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 83.07 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 82.84 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 82.83 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 82.62 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 82.24 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 82.17 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 82.1 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 81.3 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 81.29 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 81.13 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 80.88 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 80.78 |
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.6e-30 Score=253.01 Aligned_cols=312 Identities=12% Similarity=0.078 Sum_probs=231.7
Q ss_pred CCChhhhhhhchhHHHHhhcCCChhHHhhcCCccHHHHHHHhCCCHHHHHHHHHHHHHhhhcCChhhhHHHHHHHHHHHH
Q 014807 38 RLPLVDRLTSLPLMAAVIDFDNTDVAWRKYDSITARELFKQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAATLGILYFI 117 (418)
Q Consensus 38 ~ls~~dk~~~~~l~~~~~~~~~~~~~~~~~d~~s~~e~l~~~~~~~~~~~~~~~p~~~~~~~~~~~~~Sa~~~~~~l~~~ 117 (418)
.+++.+|.++...+..+.. ...+++|+.+|++++ ++++.++.++++++.+.++.+++++|+..++..+...
T Consensus 112 ~~~~~~~~~~~~~~~~~~~--------~~~~~~s~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~ 182 (425)
T 3ka7_A 112 LLSYKDRMKIALLIVSTRK--------NRPSGSSLQAWIKSQ-VSDEWLIKFADSFCGWALSLKSDEVPVEEVFEIIENM 182 (425)
T ss_dssp GSCHHHHHHHHHHHHHTTT--------SCCCSSBHHHHHHHH-CCCHHHHHHHHHHHHHHHSSCGGGSBHHHHHHHHHHH
T ss_pred hCCHHHHHHHHHHHHhhhh--------cCCCCCCHHHHHHHh-cCCHHHHHHHHHHHHHHhCCCcccchHHHHHHHHHHH
Confidence 4678888777664433110 124689999999997 5566688999999999999999999999888877764
Q ss_pred HhhcCCCcceeeecCCcchhhHHHHHHHHHhcCcEEEcCceeeEEEecCCCCeEEEEEECCeEEecCEEEEccChhhHHH
Q 014807 118 ILAHQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSAGAVVLAVGISTLQE 197 (418)
Q Consensus 118 ~~~~~~~~~~~~~~gG~~~~l~~~l~~~l~~~G~~I~l~t~V~~I~~~~~~g~v~~v~~~g~~~~ad~VV~A~p~~~~~~ 197 (418)
.... ...++.||+ +.|+++|++.++++|++|++|++|++|..++ +++++|+++|+++.||.||+|+|++.+.+
T Consensus 183 ~~~~----~~~~~~gG~-~~l~~~l~~~~~~~G~~i~~~~~V~~i~~~~--~~~~gv~~~g~~~~ad~VV~a~~~~~~~~ 255 (425)
T 3ka7_A 183 YRFG----GTGIPEGGC-KGIIDALETVISANGGKIHTGQEVSKILIEN--GKAAGIIADDRIHDADLVISNLGHAATAV 255 (425)
T ss_dssp HHHC----SCEEETTSH-HHHHHHHHHHHHHTTCEEECSCCEEEEEEET--TEEEEEEETTEEEECSEEEECSCHHHHHH
T ss_pred HhcC----CccccCCCH-HHHHHHHHHHHHHcCCEEEECCceeEEEEEC--CEEEEEEECCEEEECCEEEECCCHHHHHH
Confidence 3221 136789997 5699999999999999999999999999887 67878888999999999999999999999
Q ss_pred hhcccccC--ChHHHHHhcCCCCccEEEEEEEeccCCCCCCCCcceeccCCCccceeeeccccccccCCCCCeEEEEEee
Q 014807 198 LIKNSILC--NREEFLKVLNLASIDVVSVKLWFDKKVTVPNVSNACSGFGDSLAWTFFDLNKIYDEHKDDSATVIQADFY 275 (418)
Q Consensus 198 Ll~~~~~~--~~~~~~~l~~l~~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~~~~~~d~s~~~~~~~~~~~~~l~~~~~ 275 (418)
|+++.... +..+.+.++.+++.+.++++++++++.. . .++.+++.+......+...|...+...+++++++.+.++
T Consensus 256 ll~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~-~-~~~~~~~~~~~~~~~~~~~s~~~p~~ap~G~~~l~~~~~ 333 (425)
T 3ka7_A 256 LCSEALSKEADAAYFKMVGTLQPSAGIKICLAADEPLV-G-HTGVLLTPYTRRINGVNEVTQADPELAPPGKHLTMCHQY 333 (425)
T ss_dssp HTTTTCCTTTTHHHHHHHHHCCCBEEEEEEEEESSCSS-C-SSSEEECCSSSSEEEEECGGGTCGGGSCTTCEEEEEEEE
T ss_pred hcCCcccccCCHHHHHHhhCcCCCceEEEEeecCCCcc-C-cCEEEECCChhhcceEEeccCCCCCcCCCCCeEEEEEec
Confidence 98753211 2456677888888888899999998764 2 233343322211111334455566677677888776555
Q ss_pred cCCCCCCCCHHHHHHHHHHHHhhhhcCCCCceeeeeeEEEcCCCccccCCCCCCCCCCCCCCCCCEEEeccccccCCCcc
Q 014807 276 HANELMPLKDDQVVAKAVSYLSKCIKDFSTATVMDHKIRRFPKSLTHFFPGSYKYMMRGFTSFPNLFMAGDWITTRHGSW 355 (418)
Q Consensus 276 ~~~~~~~~~~~el~~~~~~~L~~~~p~~~~~~~~~~~v~r~~~a~~~~~pg~~~~r~~~~~~~~~l~laGd~~~~~~g~~ 355 (418)
...+..+. ++++++.++++|++++|+.. .....+.+|+.++|++.+|+. .++...+|++|||+||||+.+..| .
T Consensus 334 ~~~~~~~~-~~~~~~~~~~~l~~~~p~~~---~~~~~v~~~~~~~P~~~~~~~-~~~~~~~p~~gL~laG~~~~~~gg-~ 407 (425)
T 3ka7_A 334 VAPENVKN-LESEIEMGLEDLKEIFPGKR---YEVLLIQSYHDEWPVNRAASG-TDPGNETPFSGLYVVGDGAKGKGG-I 407 (425)
T ss_dssp ECGGGGGG-HHHHHHHHHHHHHHHSTTCC---EEEEEEEEEBTTBCSBSSCTT-CCCCSBCSSBTEEECSTTSCCTTC-C
T ss_pred cccccccc-hHHHHHHHHHHHHHhCCCCc---eEEEEEEEECCCccccccccC-CCCCCCCCcCCeEEeCCccCCCCC-C
Confidence 33222222 34567999999999999843 333477889999999999864 457777899999999999754445 5
Q ss_pred chHHHHHHHHHHHHHHHH
Q 014807 356 SQERSYVTGLEAANRVVD 373 (418)
Q Consensus 356 ~~egAi~SG~~aA~~Il~ 373 (418)
+|++|+.||++||++|+.
T Consensus 408 gv~~~~~s~~~~~~~i~~ 425 (425)
T 3ka7_A 408 EVEGVALGVMSVMEKVLG 425 (425)
T ss_dssp HHHHHHHHHHHHHHC---
T ss_pred ccHHHHHHHHHHHHHhhC
Confidence 899999999999999873
|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 418 | ||||
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 1e-04 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 0.001 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.5 bits (95), Expect = 1e-04
Identities = 12/53 (22%), Positives = 21/53 (39%), Gaps = 2/53 (3%)
Query: 325 PGSYKYMMRGFTSFPNLFMAGDWITTRHGSWSQERSYVTGLEAANRVVD-YLG 376
+ P LF AG+ + + + ++GL A R+ D +LG
Sbjct: 398 ITPGPSIPGAPQPIPRLFFAGEHTIRNYPAT-VHGALLSGLREAGRIADQFLG 449
|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 418 | |||
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.22 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.01 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 98.94 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.53 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 98.52 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.17 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.15 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 98.05 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 97.88 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 97.7 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.67 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.55 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.54 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.48 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 97.41 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 97.36 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 97.3 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 97.22 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 97.21 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 97.16 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 97.09 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 97.08 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 96.88 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 96.75 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 96.73 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 96.71 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 96.44 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 96.43 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 96.41 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 96.33 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 96.27 | |
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 96.23 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 96.21 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 96.21 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 96.04 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 95.93 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 95.9 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 95.85 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 95.8 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 95.61 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 95.35 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 94.28 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 93.5 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 93.32 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 93.21 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 93.16 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 92.59 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 92.37 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 92.29 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 92.25 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 92.0 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 90.22 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 88.84 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 88.09 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 87.53 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 87.37 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 87.33 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.81 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 85.95 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 84.37 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 82.39 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 81.87 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 81.3 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 80.86 |
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: GDI-like N domain domain: Guanine nucleotide dissociation inhibitor, GDI species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.22 E-value=7.3e-11 Score=104.52 Aligned_cols=155 Identities=11% Similarity=0.120 Sum_probs=99.8
Q ss_pred ccCCCCCChhhhhhhchhHHHHhhcCCC---hhHHhhcCCccHHHHHHHhCCCHHHHHHHHHHHHHhhhcCChhhhHHHH
Q 014807 33 YTQFSRLPLVDRLTSLPLMAAVIDFDNT---DVAWRKYDSITARELFKQFGCSERLYRNVIGPLVQVGLFAPAEQCSAAA 109 (418)
Q Consensus 33 ~l~~~~ls~~dk~~~~~l~~~~~~~~~~---~~~~~~~d~~s~~e~l~~~~~~~~~~~~~~~p~~~~~~~~~~~~~Sa~~ 109 (418)
++.....+..+|..+..+......+... ......++..++.+++++++.++.. +.++...+......+..+.++..
T Consensus 130 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~ 208 (297)
T d2bcgg1 130 AISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVYYKFGLGNST-KEFIGHAMALWTNDDYLQQPARP 208 (297)
T ss_dssp HHHCTTSCHHHHHHHHHHHHHHHHCBTTBGGGSTTCCTTTSBHHHHHHHTTCCHHH-HHHHHHHTSCCSSSGGGGSBHHH
T ss_pred hhhccccccccchhhhhhhhhhhhhhhccccchhhhcccchhhhhhhhhhccCHHH-HHHHHHHHhhhccccccchhhhh
Confidence 4455666666666554433222222111 1112345678999999999888874 44544434333333344445443
Q ss_pred HHHHHHHHHh--hcCCCcceeeecCCcchhhHHHHHHHHHhcCcEEEcCceeeEEEecCCCCeEEEEEECCeEEecCEEE
Q 014807 110 TLGILYFIIL--AHQKNFDLVWCRGTLREKIFEPWMDSMRTRGCEFLDGRRVTDFIYDEERCCISDVVCGKETYSAGAVV 187 (418)
Q Consensus 110 ~~~~l~~~~~--~~~~~~~~~~~~gG~~~~l~~~l~~~l~~~G~~I~l~t~V~~I~~~~~~g~v~~v~~~g~~~~ad~VV 187 (418)
.+..+..+.. .......+.+|+||++ .|+++|++.++++|++|++|++|++|..++++++|++|+.+|+++.||+||
T Consensus 209 ~~~~~~~~~~~~~~~~~~~~~~~~gG~~-~l~~~l~~~~~~~G~~i~~~~~V~~I~~~~~~~~v~~v~~~g~~~~ad~VI 287 (297)
T d2bcgg1 209 SFERILLYCQSVARYGKSPYLYPMYGLG-ELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVI 287 (297)
T ss_dssp HHHHHHHHHHHHHHHSSCSEEEETTCTT-HHHHHHHHHHHHTTCEEECSCCCCEEEEETTTTEEEEEEETTEEEECSCEE
T ss_pred hhhhhhhhhhcccccccCcceeccCcHH-HHHHHHHHHHHhcCCEEEeCCEeeEEEEECCCCEEEEEEcCCEEEECCEEE
Confidence 3333222211 1111234578999975 699999999999999999999999998876547788888899999999999
Q ss_pred Ec
Q 014807 188 LA 189 (418)
Q Consensus 188 ~A 189 (418)
++
T Consensus 288 ~~ 289 (297)
T d2bcgg1 288 AD 289 (297)
T ss_dssp EC
T ss_pred EC
Confidence 87
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|