Citrus Sinensis ID: 014883


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MTGNESESELPVPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM
cccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHcccccccccccccccccEEEEcccccccccccccEEEcccccEEEEcccHHHHHHHHcccccEEEEEEcccEEEEcccccEEEccccHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHcccEEEccccEEEEEEccccccEEEEEEccccEEEEcEEEEccccccccccccccHHHHHHHccccccccccEEEEEEEEEccccccccccEEEEEccccccccccccEEEEEEccccccccccc
cccccccEccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEcccccccccccEEcHHHHHHHHcccccccHHHHHHHHccccccccccHHHcccccccEEEccccHHHHccccHHHEEEEcccEEEEEEEEEcEEEEEEcccEEEEccccHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHccccHHccccccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHccEEEccccccEEEEEccccEEEEEEEccccEEEEEEEEEccccccccccccccccccccccccccEEEccEEEEEEEEEccccccccccEEEEEccHHccccccccEEEEEEEcccccccccc
mtgneseselpvppyppieptafDLIVIGTGLPESVISAAAsasgksvlhldpnpfygshfsslSIADLTHflnshstpssvcpdplysdveiSNYASRLLsqhprnfnldvsgprvlFCADHAVDLMLKSGASHYlefksidatfmldadaklcsvpdsraaifkdkslglmEKNQLMRFFKLVQGhlsldeseennvriseedldspFAEFLtkmklphkIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGAliypiygqgelpqaFCRRAAVKGCLYVLRMPvislltdqnsgsykgvrlasgqdilshklvldpsftvpgslasSHQQLQESFQAfslsdnkgkvargicitrsslkpdlsnflvifpprslfpeqvTSIRVLQlggnlavcplgm
mtgneseselpvppyppIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISlltdqnsgsYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAfslsdnkgKVARGICItrsslkpdlsnFLVIFPPRSLFPEQVTSIRVLQlggnlavcplgm
MTGNeseselpvppyppiepTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM
******************EPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHS***SVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLS******************PFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTV************************GKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCP***
***************PPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYA**LLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSL****************SDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLG*
***********VPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM
******ESELPVPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASR**SQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPG***************FSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVC****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGNESESELPVPPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query416 2.2.26 [Sep-21-2011]
Q9V8W3 511 Rab proteins geranylgeran yes no 0.721 0.587 0.340 3e-41
Q9QZD5 621 Rab proteins geranylgeran yes no 0.668 0.447 0.312 3e-30
P32864 603 Rab proteins geranylgeran yes no 0.862 0.595 0.278 4e-30
O93831 640 Rab proteins geranylgeran N/A no 0.848 0.551 0.285 6e-30
Q10305440 Probable secretory pathwa yes no 0.817 0.772 0.267 2e-29
P50396447 Rab GDP dissociation inhi no no 0.754 0.702 0.270 1e-28
P21856447 Rab GDP dissociation inhi no no 0.754 0.702 0.270 1e-28
P24386 653 Rab proteins geranylgeran yes no 0.665 0.424 0.302 3e-28
Q6Q7J2445 Rab GDP dissociation inhi no no 0.670 0.626 0.287 3e-28
O97555447 Rab GDP dissociation inhi yes no 0.754 0.702 0.267 4e-28
>sp|Q9V8W3|RABEP_DROME Rab proteins geranylgeranyltransferase component A OS=Drosophila melanogaster GN=Rep PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 165/326 (50%), Gaps = 26/326 (7%)

Query: 20  PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTP 79
           P  FDL+VIGTG  ES I+AA S  GKSVLHLD N +YG  +SS S+  L   L+    P
Sbjct: 6   PEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFSMDALCARLDQEVEP 65

Query: 80  SSVCPDPLY--------SDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKS 131
            S   +  Y        S+ +  ++    +    R F+LD+  PR+L+ A   V L++KS
Sbjct: 66  HSALRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLC-PRILYAAGELVQLLIKS 124

Query: 132 GASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSL 191
               Y EF+++D   M   + ++ SVP SR+ +F  K+L ++EK  LM+F          
Sbjct: 125 NICRYAEFRAVDHVCMRH-NGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACN----- 178

Query: 192 DESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGI 251
           D  E+     S E     F E+L   ++  KI S V+ AIAM        E       G+
Sbjct: 179 DYGEDKCNEDSLEFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFEE-------GM 231

Query: 252 NRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNS 311
            R   +  S+GR+ N     ++P+YG GELPQ FCR  AV G +Y L+  V  +  D NS
Sbjct: 232 QRTQRFLGSLGRYGNT--PFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNS 289

Query: 312 GSYKGVRLASGQDILSHKLVLDPSFT 337
             +  +  ++G+ + +  +V  P +T
Sbjct: 290 NEF--LLSSAGKTLRAKNVVSAPGYT 313




Binds unprenylated Rab proteins, presents it to the catalytic component B, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab to a protein acceptor.
Drosophila melanogaster (taxid: 7227)
>sp|Q9QZD5|RAE2_MOUSE Rab proteins geranylgeranyltransferase component A 2 OS=Mus musculus GN=Chml PE=2 SV=2 Back     alignment and function description
>sp|P32864|RAEP_YEAST Rab proteins geranylgeranyltransferase component A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS6 PE=1 SV=2 Back     alignment and function description
>sp|O93831|RAEP_CANAX Rab proteins geranylgeranyltransferase component A OS=Candida albicans GN=MRS6 PE=3 SV=1 Back     alignment and function description
>sp|Q10305|GDI1_SCHPO Probable secretory pathway GDP dissociation inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdi1 PE=3 SV=1 Back     alignment and function description
>sp|P50396|GDIA_MOUSE Rab GDP dissociation inhibitor alpha OS=Mus musculus GN=Gdi1 PE=1 SV=3 Back     alignment and function description
>sp|P21856|GDIA_BOVIN Rab GDP dissociation inhibitor alpha OS=Bos taurus GN=GDI1 PE=1 SV=1 Back     alignment and function description
>sp|P24386|RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens GN=CHM PE=1 SV=3 Back     alignment and function description
>sp|Q6Q7J2|GDIB_PIG Rab GDP dissociation inhibitor beta OS=Sus scrofa GN=GDI2 PE=2 SV=1 Back     alignment and function description
>sp|O97555|GDIA_CANFA Rab GDP dissociation inhibitor alpha OS=Canis familiaris GN=GDI1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query416
224113201 553 predicted protein [Populus trichocarpa] 0.971 0.730 0.667 1e-157
359476981 556 PREDICTED: rab proteins geranylgeranyltr 0.971 0.726 0.661 1e-154
255561411 551 protein with unknown function [Ricinus c 0.963 0.727 0.647 1e-148
147798203 812 hypothetical protein VITISV_019372 [Viti 0.971 0.497 0.571 1e-142
356496561 553 PREDICTED: rab proteins geranylgeranyltr 0.954 0.717 0.624 1e-140
449456881 543 PREDICTED: rab proteins geranylgeranyltr 0.949 0.727 0.608 1e-140
20453227 563 AT3g06540/F5E6_13 [Arabidopsis thaliana] 0.978 0.722 0.6 1e-140
22330883 563 Rab escort protein [Arabidopsis thaliana 0.978 0.722 0.6 1e-139
356538383 551 PREDICTED: rab proteins geranylgeranyltr 0.954 0.720 0.617 1e-139
357484143 552 Rab proteins geranylgeranyltransferase c 0.947 0.713 0.598 1e-139
>gi|224113201|ref|XP_002332635.1| predicted protein [Populus trichocarpa] gi|222832862|gb|EEE71339.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 285/427 (66%), Positives = 339/427 (79%), Gaps = 23/427 (5%)

Query: 13  PPYPPIEPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHF 72
           PPYP IEPT FDLI +GTGL E +++AAASASGK+VLHLD NPFYGSH+SSLS+ +LT F
Sbjct: 5   PPYPQIEPTTFDLIAVGTGLAECIVAAAASASGKTVLHLDTNPFYGSHYSSLSVPELTSF 64

Query: 73  LNSHSTPSSV---------CPD---------PLYSDVEISNYASRLLSQHPRNFNLDVSG 114
           L S+ST SS           PD         P+YSDVEIS +   L+ ++ R FNLD+ G
Sbjct: 65  LISNSTASSPPSSTSTTTDIPDYSIVNLITQPVYSDVEISCFYPELIEENLRKFNLDLCG 124

Query: 115 PRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLME 174
           PRVLFCAD ++DLMLKSGAS+Y+EFKSIDA+F+ D + KL +VPDSRAAIFKDKSL LME
Sbjct: 125 PRVLFCADKSIDLMLKSGASNYVEFKSIDASFVGDGNGKLWNVPDSRAAIFKDKSLTLME 184

Query: 175 KNQLMRFFKLVQGHL--SLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIA 232
           KNQLMRFFKLVQGHL  ++       ++IS+EDL  PF E+L+KM+LP KI+SI+LYAIA
Sbjct: 185 KNQLMRFFKLVQGHLVATVGAGTSGKMKISDEDLQRPFVEYLSKMRLPPKIRSIILYAIA 244

Query: 233 MADYDQE---VSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRA 289
           MADYDQ+   V + +LKT+DGI+RLALY SS+GRF NA GALIYPIYGQGELPQAF RR+
Sbjct: 245 MADYDQDDMGVCQNLLKTKDGIDRLALYQSSVGRFTNASGALIYPIYGQGELPQAFSRRS 304

Query: 290 AVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQL 349
           AVKGC++VLRMPV +LL +++SGSYKGVRLASGQDI S KLVLDPSFT+    AS    L
Sbjct: 305 AVKGCIHVLRMPVTALLMEKDSGSYKGVRLASGQDIFSQKLVLDPSFTLASPSASPSDLL 364

Query: 350 QESFQAFSLSDNKGKVARGICITRSSLKPDLSNFLVIFPPRSLFPEQVTSIRVLQLGGNL 409
            ESF   S  D KGKVARGICITR+SLKPD+SN LV++PPRSL+PEQ+TSIR LQ+ GNL
Sbjct: 365 HESFNFLSTRDVKGKVARGICITRNSLKPDMSNLLVVYPPRSLYPEQITSIRALQISGNL 424

Query: 410 AVCPLGM 416
           AVCPLGM
Sbjct: 425 AVCPLGM 431




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359476981|ref|XP_002273131.2| PREDICTED: rab proteins geranylgeranyltransferase component A 2-like [Vitis vinifera] gi|296088658|emb|CBI37649.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561411|ref|XP_002521716.1| protein with unknown function [Ricinus communis] gi|223539107|gb|EEF40703.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|147798203|emb|CAN62777.1| hypothetical protein VITISV_019372 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496561|ref|XP_003517135.1| PREDICTED: rab proteins geranylgeranyltransferase component A-like [Glycine max] Back     alignment and taxonomy information
>gi|449456881|ref|XP_004146177.1| PREDICTED: rab proteins geranylgeranyltransferase component A 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|20453227|gb|AAM19852.1| AT3g06540/F5E6_13 [Arabidopsis thaliana] gi|23463085|gb|AAN33212.1| At3g06540/F5E6_13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22330883|ref|NP_187306.2| Rab escort protein [Arabidopsis thaliana] gi|51317418|gb|AAN03631.2|AF409086_1 Rab escort protein [Arabidopsis thaliana] gi|332640889|gb|AEE74410.1| Rab escort protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356538383|ref|XP_003537683.1| PREDICTED: rab proteins geranylgeranyltransferase component A-like [Glycine max] Back     alignment and taxonomy information
>gi|357484143|ref|XP_003612358.1| Rab proteins geranylgeranyltransferase component A [Medicago truncatula] gi|355513693|gb|AES95316.1| Rab proteins geranylgeranyltransferase component A [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query416
TAIR|locus:2084289 563 REP "AT3G06540" [Arabidopsis t 0.793 0.586 0.633 2e-132
MGI|MGI:101913 621 Chml "choroideremia-like" [Mus 0.627 0.420 0.312 1.5e-39
FB|FBgn0026378 511 Rep "Rab escort protein" [Dros 0.713 0.581 0.337 1.6e-38
UNIPROTKB|P24386 653 CHM "Rab proteins geranylgeran 0.644 0.410 0.305 5.6e-38
UNIPROTKB|E2RKG1 652 CHM "Uncharacterized protein" 0.641 0.409 0.314 1.2e-37
DICTYBASE|DDB_G0280143 661 DDB_G0280143 "Rab escort prote 0.716 0.450 0.283 3.1e-37
UNIPROTKB|K7GR66 653 CHM "Uncharacterized protein" 0.492 0.313 0.330 3.5e-36
MGI|MGI:892979 665 Chm "choroidermia" [Mus muscul 0.641 0.401 0.304 3.9e-36
UNIPROTKB|P26374 656 CHML "Rab proteins geranylgera 0.632 0.400 0.3 1.1e-34
UNIPROTKB|F1S9E9 649 CHML "Uncharacterized protein" 0.639 0.409 0.296 1.3e-34
TAIR|locus:2084289 REP "AT3G06540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1095 (390.5 bits), Expect = 2.0e-132, Sum P(2) = 2.0e-132
 Identities = 214/338 (63%), Positives = 274/338 (81%)

Query:    87 LYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATF 146
             LYS VEIS++ S +L +H R FN+D++GPRV+FCAD +++LMLKSGA++Y+EFKSIDA+F
Sbjct:    99 LYSSVEISSFESEILEEHSRRFNVDLAGPRVVFCADESINLMLKSGANNYVEFKSIDASF 158

Query:   147 MLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHL--SLDESEENNVRISEE 204
             + D+  +L +VPDSRAAIFKDKSL L+EKNQLM+FFKLVQ HL  S ++ +   V+ISEE
Sbjct:   159 VGDSSGELRNVPDSRAAIFKDKSLTLLEKNQLMKFFKLVQSHLASSTEKDDSTTVKISEE 218

Query:   205 DLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSE---YVLKTRDGINRLALYNSSI 261
             D++SPF +FL+KM+LP KIKSI+LYAIAM DYDQ+ +E   ++LKT++GI+RLALY +S+
Sbjct:   219 DMESPFVDFLSKMRLPPKIKSIILYAIAMLDYDQDNTETCRHLLKTKEGIDRLALYITSM 278

Query:   262 GRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLAS 321
             GRF NALGALIYPIYGQGELPQAFCRRAAVKGC+YVLRMP+ +LL D+ +G YKGVRLAS
Sbjct:   279 GRFSNALGALIYPIYGQGELPQAFCRRAAVKGCIYVLRMPITALLLDKETGGYKGVRLAS 338

Query:   322 GQDILSHKLVLDPSFTVP-GSLASSHQQLQESFQAFSLSD--NKGKVARGICITRSSLKP 378
             GQ+I S KL+LDP  TV   SL+S   Q  E+          NK K+ARG+C+ R S+K 
Sbjct:   339 GQEIFSQKLILDPCVTVGLESLSSLTDQQNETLSVLVPKSMINKEKIARGVCVIRGSVKA 398

Query:   379 DLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM 416
             ++SN LV++PP+SLFPEQ+T+IRVLQLG  LAVCP  M
Sbjct:   399 NVSNALVVYPPKSLFPEQLTAIRVLQLGSGLAVCPADM 436


GO:0005093 "Rab GDP-dissociation inhibitor activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0015031 "protein transport" evidence=ISS
GO:0017137 "Rab GTPase binding" evidence=IDA
GO:2000541 "positive regulation of protein geranylgeranylation" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
MGI|MGI:101913 Chml "choroideremia-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0026378 Rep "Rab escort protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P24386 CHM "Rab proteins geranylgeranyltransferase component A 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKG1 CHM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280143 DDB_G0280143 "Rab escort protein (REP)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|K7GR66 CHM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:892979 Chm "choroidermia" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P26374 CHML "Rab proteins geranylgeranyltransferase component A 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9E9 CHML "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.256.25.1
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query416
pfam00996439 pfam00996, GDI, GDP dissociation inhibitor 2e-56
COG5044434 COG5044, MRS6, RAB proteins geranylgeranyltransfer 1e-51
PTZ00363443 PTZ00363, PTZ00363, rab-GDP dissociation inhibitor 9e-49
>gnl|CDD|216232 pfam00996, GDI, GDP dissociation inhibitor Back     alignment and domain information
 Score =  191 bits (488), Expect = 2e-56
 Identities = 98/354 (27%), Positives = 158/354 (44%), Gaps = 59/354 (16%)

Query: 23  FDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADL-THFLNSHSTPSS 81
           +D+IV+GTGL E ++S   S  GK VLH+D N +YG   +SLS+  L   F      P S
Sbjct: 5   YDVIVLGTGLKECILSGLLSVDGKKVLHIDRNDYYGGESASLSLEQLYARFRGGEEKPPS 64

Query: 82  VCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKS 141
                                   R++N+D+  P+ L      V L++ +  + YLEFK+
Sbjct: 65  K-------------LGRS------RDWNVDLI-PKFLMANGELVKLLIHTDVTRYLEFKA 104

Query: 142 IDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRI 201
           ++ +++     K+  VP +         +G+ EK +  +F   VQ     DE +      
Sbjct: 105 VEGSYVYK-GGKIHKVPANEMEALSSPLMGIFEKRRFRKFLTYVQ---DYDEDDPK---- 156

Query: 202 SEEDLD---SPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYN 258
           + + LD       E   K  L       + +A+A+   D  +++        + R+ LY+
Sbjct: 157 THDGLDPRKRTMLEVYKKFGLDENTIDFIGHALALYRDDDYLNQ---PALPTVERIKLYS 213

Query: 259 SSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVR 318
            S+ R+       +YP+YG GELPQ F R +A+ G  Y+L  PV  ++ D+N G   GV+
Sbjct: 214 ESLARYGK--SPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDEIVYDEN-GKVVGVK 270

Query: 319 LASGQDILSHKLVL-DPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICI 371
             SG ++   K V+ DPS+  P  +                    G+V R ICI
Sbjct: 271 --SGGEVARAKQVICDPSYF-PDKVRK-----------------VGQVIRAICI 304


Length = 439

>gnl|CDD|227377 COG5044, MRS6, RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185577 PTZ00363, PTZ00363, rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 416
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 100.0
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 100.0
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 100.0
KOG4405 547 consensus GDP dissociation inhibitor [Signal trans 100.0
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 100.0
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 99.97
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 99.96
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.96
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.95
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 99.95
PRK12416 463 protoporphyrinogen oxidase; Provisional 99.94
PLN02576 496 protoporphyrinogen oxidase 99.94
PRK07233 434 hypothetical protein; Provisional 99.94
PRK07208 479 hypothetical protein; Provisional 99.94
PRK11883 451 protoporphyrinogen oxidase; Reviewed 99.94
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.93
PLN02612 567 phytoene desaturase 99.93
PLN02268 435 probable polyamine oxidase 99.92
PLN02676 487 polyamine oxidase 99.91
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.91
PLN02487 569 zeta-carotene desaturase 99.91
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 99.91
PLN02529 738 lysine-specific histone demethylase 1 99.91
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.91
PLN02568 539 polyamine oxidase 99.88
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.88
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.88
PLN03000 881 amine oxidase 99.87
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 99.82
PLN02976 1713 amine oxidase 99.82
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 99.81
PRK13977 576 myosin-cross-reactive antigen; Provisional 99.78
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.72
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 99.7
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 99.7
KOG1276 491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.67
COG3349 485 Uncharacterized conserved protein [Function unknow 99.57
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.43
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.42
COG2081 408 Predicted flavoproteins [General function predicti 99.38
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.33
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.26
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 99.17
COG0579 429 Predicted dehydrogenase [General function predicti 99.17
PRK11728 393 hydroxyglutarate oxidase; Provisional 99.17
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.13
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.06
PRK08274 466 tricarballylate dehydrogenase; Validated 99.03
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.0
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.99
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.98
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.97
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.97
KOG2820 399 consensus FAD-dependent oxidoreductase [General fu 98.95
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.95
PTZ00383 497 malate:quinone oxidoreductase; Provisional 98.92
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.92
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.9
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.87
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.79
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.79
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.76
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.74
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.72
PRK10157428 putative oxidoreductase FixC; Provisional 98.66
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.65
PRK10015429 oxidoreductase; Provisional 98.62
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.61
PRK07121492 hypothetical protein; Validated 98.61
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.59
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.58
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.58
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.55
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.55
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.54
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.54
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.54
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.52
PRK06370463 mercuric reductase; Validated 98.52
PTZ00058 561 glutathione reductase; Provisional 98.52
PRK06116450 glutathione reductase; Validated 98.52
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.51
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.51
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.5
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.5
PLN02463447 lycopene beta cyclase 98.49
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.49
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.49
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.48
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.47
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.47
PRK08013400 oxidoreductase; Provisional 98.47
PRK09126392 hypothetical protein; Provisional 98.46
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.46
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.45
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.45
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 98.44
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.44
PRK07045388 putative monooxygenase; Reviewed 98.43
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.43
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.43
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.43
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.43
PLN02661357 Putative thiazole synthesis 98.42
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 98.41
PRK12831464 putative oxidoreductase; Provisional 98.41
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.41
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.41
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.41
PRK07236386 hypothetical protein; Provisional 98.4
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.39
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.39
PRK06184 502 hypothetical protein; Provisional 98.39
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.39
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.39
PRK08163396 salicylate hydroxylase; Provisional 98.38
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.38
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.37
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.36
PRK14694468 putative mercuric reductase; Provisional 98.36
PRK13748561 putative mercuric reductase; Provisional 98.36
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 98.36
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.35
PRK12839 572 hypothetical protein; Provisional 98.35
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.35
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.35
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.34
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.34
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.34
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.34
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.34
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.33
PLN02697529 lycopene epsilon cyclase 98.33
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.32
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.32
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.32
PRK06185407 hypothetical protein; Provisional 98.31
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.31
TIGR02053463 MerA mercuric reductase. This model represents the 98.31
PRK06834488 hypothetical protein; Provisional 98.31
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.3
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.3
PLN02985514 squalene monooxygenase 98.3
PRK14727479 putative mercuric reductase; Provisional 98.3
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.29
PRK06847375 hypothetical protein; Provisional 98.29
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.29
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.29
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.29
COG3573 552 Predicted oxidoreductase [General function predict 98.27
PRK07190487 hypothetical protein; Provisional 98.27
PTZ00052 499 thioredoxin reductase; Provisional 98.27
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.27
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.26
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.26
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.26
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.26
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.25
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.25
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.25
PRK06753373 hypothetical protein; Provisional 98.24
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.24
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.22
PTZ00367 567 squalene epoxidase; Provisional 98.22
PLN02507499 glutathione reductase 98.22
PRK11445351 putative oxidoreductase; Provisional 98.22
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.22
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.22
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.22
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.22
PRK08132 547 FAD-dependent oxidoreductase; Provisional 98.22
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.22
PRK06126 545 hypothetical protein; Provisional 98.22
PRK08244493 hypothetical protein; Provisional 98.22
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.21
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.21
PRK07804 541 L-aspartate oxidase; Provisional 98.2
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.2
PRK07538413 hypothetical protein; Provisional 98.2
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.19
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.19
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.19
KOG1298509 consensus Squalene monooxygenase [Lipid transport 98.18
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.18
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.18
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.18
PRK06175433 L-aspartate oxidase; Provisional 98.17
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.17
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.16
PLN02546558 glutathione reductase 98.16
PRK07588391 hypothetical protein; Provisional 98.16
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.15
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.15
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 98.15
PRK05257494 malate:quinone oxidoreductase; Validated 98.14
PRK07395 553 L-aspartate oxidase; Provisional 98.14
PRK10262321 thioredoxin reductase; Provisional 98.14
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.14
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.14
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.14
PRK02106 560 choline dehydrogenase; Validated 98.13
PLN02852491 ferredoxin-NADP+ reductase 98.13
PRK05868372 hypothetical protein; Validated 98.13
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.12
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.12
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.11
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.1
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.09
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 98.09
PRK08294 634 phenol 2-monooxygenase; Provisional 98.09
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.08
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.08
PRK12814652 putative NADPH-dependent glutamate synthase small 98.08
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.08
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.08
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.07
PRK06475400 salicylate hydroxylase; Provisional 98.07
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.07
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.07
PTZ00153 659 lipoamide dehydrogenase; Provisional 98.06
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.06
PLN02815 594 L-aspartate oxidase 98.05
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.04
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.03
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.03
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.03
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.02
PRK08071 510 L-aspartate oxidase; Provisional 98.01
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.01
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.01
KOG03992142 consensus Glutamate synthase [Amino acid transport 98.01
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.01
PRK06996398 hypothetical protein; Provisional 98.0
PRK08401 466 L-aspartate oxidase; Provisional 97.99
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.98
TIGR00275 400 flavoprotein, HI0933 family. The model when search 97.97
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.97
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.97
PRK08275 554 putative oxidoreductase; Provisional 97.97
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.97
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.96
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.95
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.95
PRK09077 536 L-aspartate oxidase; Provisional 97.95
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.95
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.94
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.93
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.87
PRK12771564 putative glutamate synthase (NADPH) small subunit; 97.85
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.84
PTZ00188506 adrenodoxin reductase; Provisional 97.83
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 97.83
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.78
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.78
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.76
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.76
PRK13984604 putative oxidoreductase; Provisional 97.74
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.73
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.72
PRK07512 513 L-aspartate oxidase; Provisional 97.72
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.72
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 97.7
KOG2853509 consensus Possible oxidoreductase [General functio 97.69
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.69
PRK07846451 mycothione reductase; Reviewed 97.69
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.68
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.67
PLN02785 587 Protein HOTHEAD 97.59
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.58
COG4716 587 Myosin-crossreactive antigen [Function unknown] 97.52
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.46
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.42
PRK09897 534 hypothetical protein; Provisional 97.39
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.29
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 97.23
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.22
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.21
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 97.19
PRK09564 444 coenzyme A disulfide reductase; Reviewed 97.11
KOG2960328 consensus Protein involved in thiamine biosynthesi 97.11
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.01
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.0
PRK13512 438 coenzyme A disulfide reductase; Provisional 96.98
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 96.96
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.96
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.95
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.83
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.58
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 96.57
KOG2852380 consensus Possible oxidoreductase [General functio 96.47
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 96.44
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.38
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.33
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.31
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.26
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 96.2
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.05
TIGR03197 381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 95.93
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.9
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.9
COG4529474 Uncharacterized protein conserved in bacteria [Fun 95.9
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.88
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 95.84
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.83
PF07156 368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 95.78
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.72
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.66
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 95.6
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.59
PRK14989 847 nitrite reductase subunit NirD; Provisional 95.47
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 95.45
PRK05976472 dihydrolipoamide dehydrogenase; Validated 95.37
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.33
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 95.24
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.18
TIGR02053463 MerA mercuric reductase. This model represents the 95.14
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.14
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.1
PRK06370463 mercuric reductase; Validated 95.01
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 94.98
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 94.97
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 94.92
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.92
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 94.9
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 94.9
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.88
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 94.87
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 94.86
PRK07846451 mycothione reductase; Reviewed 94.85
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.84
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 94.81
PRK13512438 coenzyme A disulfide reductase; Provisional 94.8
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 94.75
PRK06292460 dihydrolipoamide dehydrogenase; Validated 94.74
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.72
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.69
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 94.65
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 94.64
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.62
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 94.55
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 94.54
PRK06327475 dihydrolipoamide dehydrogenase; Validated 94.44
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.36
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.33
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 94.21
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.18
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 94.14
PRK04148134 hypothetical protein; Provisional 94.14
PRK09564444 coenzyme A disulfide reductase; Reviewed 94.01
PRK07845466 flavoprotein disulfide reductase; Reviewed 93.98
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 93.93
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 93.9
PRK14989 847 nitrite reductase subunit NirD; Provisional 93.9
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 93.85
PTZ00153659 lipoamide dehydrogenase; Provisional 93.85
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 93.81
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 93.8
PTZ00058561 glutathione reductase; Provisional 93.77
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 93.76
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 93.71
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 93.7
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 93.69
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 93.68
PRK10262321 thioredoxin reductase; Provisional 93.67
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 93.65
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.64
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 93.62
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.58
PRK12770352 putative glutamate synthase subunit beta; Provisio 93.56
PLN02507499 glutathione reductase 93.54
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 93.5
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.39
PRK08229341 2-dehydropantoate 2-reductase; Provisional 93.31
PRK06116450 glutathione reductase; Validated 93.3
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 93.29
PRK05257 494 malate:quinone oxidoreductase; Validated 93.29
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 93.28
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 93.26
PRK12831464 putative oxidoreductase; Provisional 93.26
PRK12921305 2-dehydropantoate 2-reductase; Provisional 93.17
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.1
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.1
PLN02353473 probable UDP-glucose 6-dehydrogenase 93.01
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 92.97
PLN02546558 glutathione reductase 92.96
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 92.89
KOG0404322 consensus Thioredoxin reductase [Posttranslational 92.89
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.87
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 92.79
PRK13748561 putative mercuric reductase; Provisional 92.78
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 92.76
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 92.74
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 92.72
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 92.71
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.71
PRK14694468 putative mercuric reductase; Provisional 92.68
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 92.59
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 92.58
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.5
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.5
PLN02695370 GDP-D-mannose-3',5'-epimerase 92.48
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 92.44
PRK07121 492 hypothetical protein; Validated 92.41
PRK14727479 putative mercuric reductase; Provisional 92.38
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 92.23
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.22
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 92.21
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 92.18
PRK06719157 precorrin-2 dehydrogenase; Validated 92.17
PRK07417279 arogenate dehydrogenase; Reviewed 92.15
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 92.13
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.07
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 92.03
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 91.98
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.96
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 91.94
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 91.88
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 91.86
PTZ00052499 thioredoxin reductase; Provisional 91.84
PRK10157 428 putative oxidoreductase FixC; Provisional 91.82
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.8
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 91.79
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 91.74
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.7
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.7
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.64
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 91.64
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 91.62
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 91.55
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.52
PTZ00318424 NADH dehydrogenase-like protein; Provisional 91.36
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 91.34
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 91.29
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 91.27
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 91.21
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 91.17
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.16
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 91.08
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 91.06
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 90.95
PRK06847 375 hypothetical protein; Provisional 90.93
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 90.85
PRK11730715 fadB multifunctional fatty acid oxidation complex 90.84
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 90.84
PRK13339 497 malate:quinone oxidoreductase; Reviewed 90.82
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 90.53
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 90.5
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 90.49
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 90.41
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 90.37
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 90.32
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 90.27
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 90.25
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 90.19
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 90.11
PRK06223307 malate dehydrogenase; Reviewed 90.07
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.07
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 89.98
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 89.86
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 89.83
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.81
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 89.76
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.72
TIGR00275400 flavoprotein, HI0933 family. The model when search 89.71
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 89.64
PRK10015 429 oxidoreductase; Provisional 89.61
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 89.59
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 89.58
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 89.57
PRK08306296 dipicolinate synthase subunit A; Reviewed 89.45
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 89.44
PRK15116268 sulfur acceptor protein CsdL; Provisional 89.42
PRK12842 574 putative succinate dehydrogenase; Reviewed 89.38
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 89.36
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 89.33
PLN02464 627 glycerol-3-phosphate dehydrogenase 89.32
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 89.21
PRK06834 488 hypothetical protein; Provisional 89.15
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 89.12
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 89.08
PTZ00082321 L-lactate dehydrogenase; Provisional 89.06
COG2085211 Predicted dinucleotide-binding enzymes [General fu 89.01
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 88.98
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 88.9
PRK07045 388 putative monooxygenase; Reviewed 88.87
PRK06175 433 L-aspartate oxidase; Provisional 88.87
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 88.78
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 88.77
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 88.71
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 88.63
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 88.52
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 88.48
PRK12779 944 putative bifunctional glutamate synthase subunit b 88.41
PRK12839 572 hypothetical protein; Provisional 88.39
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 88.33
PRK12549284 shikimate 5-dehydrogenase; Reviewed 88.32
PRK07190 487 hypothetical protein; Provisional 88.28
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 88.21
PRK07831262 short chain dehydrogenase; Provisional 88.15
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 88.06
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
Probab=100.00  E-value=1.8e-58  Score=447.79  Aligned_cols=347  Identities=36%  Similarity=0.659  Sum_probs=268.5

Q ss_pred             CCCcccEEEECCChhHHHHHHHHhhCCCeEEEEccCCCCCCcccccChhhhHhhhhcCCCCCCCCCCCcccccccccccc
Q 014883           19 EPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYAS   98 (416)
Q Consensus        19 ~~~~~DViIIGaGl~GL~aA~~La~~G~~V~vlE~~~~~GG~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (416)
                      |+++|||||+|+|+.+++.|++|+++|++|+|+|+|++|||.++|+++.++..|.......                 ..
T Consensus         1 m~~~yDviI~GTGl~esila~als~~GkkVLhiD~n~yYGg~~asl~l~~l~~~~~~~~~~-----------------~~   63 (438)
T PF00996_consen    1 MDEEYDVIILGTGLTESILAAALSRSGKKVLHIDRNDYYGGEWASLNLDQLYEWFRPKQWT-----------------PP   63 (438)
T ss_dssp             --SBESEEEE--SHHHHHHHHHHHHTT--EEEE-SSSSSCGGG-EE-HHHHHHHHCCTCCH-----------------HH
T ss_pred             CCccceEEEECCCcHHHHHHHHHHhcCCEEEecCCCCCcCCchhcccHHHHHHHhhccccc-----------------cc
Confidence            4678999999999999999999999999999999999999999999999887786543110                 01


Q ss_pred             ccccCCCCceEeeCCCCeEEeeCchHHHHHHhcCcccccccccccceeeeccCCceeecCCChhhhhhcCCCChHHHHHH
Q 014883           99 RLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQL  178 (416)
Q Consensus        99 ~~~~~~~~~~~~dl~Gp~~~~~~~~~~~~l~~~g~~~~~~f~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~l~~~~k~~l  178 (416)
                      +.+ +..|+|++||. |+++++++.++++|.++++.+|++|+.++..|++. +|++.++|+++.++|+++.+++.+||++
T Consensus        64 ~~~-~~sR~ynIDL~-PKll~a~g~LV~lLi~S~V~rYLEFk~V~~~~v~~-~~~l~kVP~sr~dvf~s~~lsl~eKR~l  140 (438)
T PF00996_consen   64 ESL-GRSRDYNIDLI-PKLLYARGPLVKLLISSGVTRYLEFKAVDGSYVYK-NGKLHKVPCSREDVFKSKLLSLFEKRRL  140 (438)
T ss_dssp             HHH-HTGGGC-EESS---BEETTSHHHHHHHHCTGGGGSEEEEESEEEEEE-TTEEEE--SSHHHHHC-TTS-HHHHHHH
T ss_pred             ccc-ccccceeEecc-hHhhhccCHHHHHHHhCCcccceEEEEcceeEEEe-CCEEeeCCCCHHHhhcCCCccHHHHHHH
Confidence            112 45789999997 99999999999999999999999999999999886 8899999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCCccccccccccccccCCcHHHHHHhcCCChhHHHHHHHHHHhccCCchhhhhhhchhhHHHHHHHHH
Q 014883          179 MRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYN  258 (416)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~  258 (416)
                      |||+.++.++.+..+..+.    ..+....|+.+++++|++++.+++++.|++++..-+..   ..-++.+++.++..|+
T Consensus       141 mkFl~~v~~~~~~~~~~~~----~~~~~~~~~~e~~~~f~L~~~~~~~i~haiaL~~~~~~---~~~p~~~~l~ri~~yl  213 (438)
T PF00996_consen  141 MKFLKFVANYEEDDPSTHK----GLDPEKKTFQELLKKFGLSENLIDFIGHAIALSLDDSY---LTEPAREGLERIKLYL  213 (438)
T ss_dssp             HHHHHHHHHGCTTBGGGST----TG-TTTSBHHHHHHHTTS-HHHHHHHHHHTS-SSSSGG---GGSBSHHHHHHHHHHH
T ss_pred             HHHHHHHhhcccCCcchhh----ccccccccHHHHHHhcCCCHHHHHHHHHhhhhccCccc---ccccHHHHHHHHHHHH
Confidence            9999999887543222111    11344689999999999999999999998887642211   1225678899999999


Q ss_pred             hhhccccCCCccEEeecCCcchHHHHHHHHHHhcCcEEEcCCceeEEEEecCCCcEEEEEeCCCcEEEcCEEEECCCCCC
Q 014883          259 SSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTV  338 (416)
Q Consensus       259 ~s~~~~g~~~~~~~~p~gG~~~l~~al~r~~~~~Gg~i~l~~~V~~I~~~~~~g~~~gV~l~~G~~i~Ad~VI~~p~~~~  338 (416)
                      .|+++||.+  +|+||.||.++|+|+|||+++..||.++||++|++|..+ ++|++++|. .+|++++|++||++|+|. 
T Consensus       214 ~SlgryG~s--PfLyP~YG~GELpQ~FcRl~AV~GG~Y~L~~~i~~i~~~-~~g~~~gV~-s~ge~v~~k~vI~dpsy~-  288 (438)
T PF00996_consen  214 SSLGRYGKS--PFLYPLYGLGELPQAFCRLSAVYGGTYMLNRPIDEIVVD-EDGKVIGVK-SEGEVVKAKKVIGDPSYL-  288 (438)
T ss_dssp             HHHCCCSSS--SEEEETT-TTHHHHHHHHHHHHTT-EEESS--EEEEEEE-TTTEEEEEE-ETTEEEEESEEEEEGGGB-
T ss_pred             HHHhccCCC--CEEEEccCCccHHHHHHHHhhhcCcEEEeCCccceeeee-cCCeEEEEe-cCCEEEEcCEEEECCccC-
Confidence            999999964  699999999999999999999999999999999999997 378888998 599999999999999886 


Q ss_pred             CCCCCCchhhhhhhhhhccccCCcceEEEEEEEecCCCCCC--CCceEEEeCCCCCCCCCCCeEEEEEecCCCccCCCCC
Q 014883          339 PGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKPD--LSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM  416 (416)
Q Consensus       339 ~~l~~~~~~~l~~~~~~~~~~~~~~~~~k~i~i~~~p~~~~--~~~~~~~~pp~~~~~~~~~~v~~~~~~~~~~~~p~G~  416 (416)
                      |.-                 ....++|+|+|+|+++|+.+.  ..+++++|||.+.+.  .++|||+++|+++++||+|+
T Consensus       289 p~~-----------------v~~~~~V~RaI~Il~~pi~~t~~~~s~~IiiP~~~~~~--~~dIyv~~~ss~~~~CP~G~  349 (438)
T PF00996_consen  289 PEK-----------------VKKTGQVSRAICILDHPIPNTEDASSVQIIIPQSQVGR--KSDIYVLQLSSSTGVCPKGQ  349 (438)
T ss_dssp             GCG-----------------EEEEEEEEEEEEEESS-STTSTT-SSEEEEE-GGGCTS--SS-EEEEEEEGGGTSS-TT-
T ss_pred             ccc-----------------ccccceEEEEEEEEcCCCCCCCCCceEEEecCCcccCC--CCCeEEEEECCCccccCCCc
Confidence            321                 113578999999999999864  356778899876553  46799999999999999996



This post-translational modification is catalysed by Rab geranylgeranyl transferase (Rab-GGTase), a multi-subunit enzyme that contains a catalytic heterodimer and an accessory component, termed Rab escort protein (REP)-1 []. REP-1 presents newly- synthesised Rab proteins to the catalytic component, and forms a stable complex with the prenylated proteins following the transfer reaction. The mechanism of REP-1-mediated membrane association of Rab5 is similar to that mediated by Rab GDP dissociation inhibitor (GDI). REP-1 and Rab GDI also share other functional properties, including the ability to inhibit the release of GDP and to remove Rab proteins from membranes. The crystal structure of the bovine alpha-isoform of Rab GDI has been determined to a resolution of 1.81A []. The protein is composed of two main structural units: a large complex multi-sheet domain I, and a smaller alpha-helical domain II. The structural organisation of domain I is closely related to FAD-containing monooxygenases and oxidases []. Conserved regions common to GDI and the choroideraemia gene product, which delivers Rab to catalytic subunits of Rab geranylgeranyltransferase II, are clustered on one face of the domain []. The two most conserved regions form a compact structure at the apex of the molecule; site-directed mutagenesis has shown these regions to play a critical role in the binding of Rab proteins [].; PDB: 1VG9_C 1VG0_A 1LTX_R 3P1W_A 3CPH_H 3CPJ_G 3CPI_H 1UKV_G 2BCG_G 1GND_A ....

>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query416
1d5t_A433 Guanine Nucleotide Dissociation Inhibitor, Alpha-Is 7e-30
1gnd_A447 Guanine Nucleotide Dissociation Inhibitor, Alpha-Is 7e-30
1lv0_A449 Crystal Structure Of The Rab Effector Guanine Nucle 8e-30
1ukv_G453 Structure Of Rabgdp-Dissociation Inhibitor In Compl 6e-29
3cph_G451 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 6e-29
1ltx_R 650 Structure Of Rab Escort Protein-1 In Complex With R 2e-27
1vg0_A 650 The Crystal Structures Of The Rep-1 Protein In Comp 2e-27
3p1w_A475 Crystal Structure Of Rab Gdi From Plasmodium Falcip 9e-23
>pdb|1D5T|A Chain A, Guanine Nucleotide Dissociation Inhibitor, Alpha-Isoform Length = 433 Back     alignment and structure

Iteration: 1

Score = 128 bits (321), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 100/370 (27%), Positives = 175/370 (47%), Gaps = 56/370 (15%) Query: 23 FDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSV 82 +D+IV+GTGL E ++S S +GK VLH+D NP+YG SS+ TP Sbjct: 7 YDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSI-------------TPL-- 51 Query: 83 CPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSI 142 + LY ++ + + R++N+D+ P+ L V ++L + + YL+FK + Sbjct: 52 --EELYKRFQLLEGPPETMGRG-RDWNVDLI-PKFLMANGQLVKMLLYTEVTRYLDFKVV 107 Query: 143 DATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRIS 202 + +F+ K+ VP + +G+ EK + +F V +EN+ + Sbjct: 108 EGSFVYKG-GKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANF------DENDPKTF 160 Query: 203 E--EDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSS 260 E + ++ + K L + +A+A+ D + + L+T INR+ LY+ S Sbjct: 161 EGVDPQNTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET---INRIKLYSES 217 Query: 261 IGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLA 320 + R+ + +YP+YG GELPQ F R +A+ G Y+L PV ++ + +G GV+ + Sbjct: 218 LARYGKS--PYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIME--NGKVVGVK-S 272 Query: 321 SGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLK--P 378 G+ +L+ DPS+ VP + + G+V R ICI +K Sbjct: 273 EGEVARCKQLICDPSY-VPDRVRKA-----------------GQVIRIICILSHPIKNTN 314 Query: 379 DLSNFLVIFP 388 D ++ +I P Sbjct: 315 DANSCQIIIP 324
>pdb|1GND|A Chain A, Guanine Nucleotide Dissociation Inhibitor, Alpha-Isoform Length = 447 Back     alignment and structure
>pdb|1LV0|A Chain A, Crystal Structure Of The Rab Effector Guanine Nucleotide Dissociation Inhibitor (Gdi) In Complex With A Geranylgeranyl (Gg) Peptide Length = 449 Back     alignment and structure
>pdb|1UKV|G Chain G, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 453 Back     alignment and structure
>pdb|3CPH|G Chain G, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 451 Back     alignment and structure
>pdb|1LTX|R Chain R, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 650 Back     alignment and structure
>pdb|1VG0|A Chain A, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 650 Back     alignment and structure
>pdb|3P1W|A Chain A, Crystal Structure Of Rab Gdi From Plasmodium Falciparum, Pfl2060c Length = 475 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query416
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 3e-77
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 3e-72
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 2e-65
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 4e-65
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 Back     alignment and structure
 Score =  245 bits (627), Expect = 3e-77
 Identities = 88/399 (22%), Positives = 167/399 (41%), Gaps = 48/399 (12%)

Query: 20  PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTP 79
            T +D+IV+GTG+ E ++S   S  GK VLH+D    YG   +S++++ L      +   
Sbjct: 9   DTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKFKQNPIS 68

Query: 80  SSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEF 139
                                     R++N+D+  P+ L       ++++ +  + Y++F
Sbjct: 69  KEERESKFG---------------KDRDWNVDL-IPKFLMANGELTNILIHTDVTRYVDF 112

Query: 140 KSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNV 199
           K +  +++     K+  VP +         +G+ EK ++ +F + +  +   D S    +
Sbjct: 113 KQVSGSYVFK-QGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGL 171

Query: 200 RISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNS 259
            + +        E   K  L +  K  + +A+A+   D  + +     R    R+ LY  
Sbjct: 172 DLDKN----TMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQ---PARPSFERILLYCQ 224

Query: 260 SIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRL 319
           S+ R+       +YP+YG GELPQ F R +A+ G  Y+L  P+  +L  +++G ++GV+ 
Sbjct: 225 SVARYGK--SPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVK- 281

Query: 320 ASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKP- 378
                  +  ++ DP++  P    S+ Q                +V R ICI    +   
Sbjct: 282 TKLGTFKAPLVIADPTY-FPEKCKSTGQ----------------RVIRAICILNHPVPNT 324

Query: 379 -DLSNFLVIFPPRSLFPEQVTSIRVLQLGGNLAVCPLGM 416
            +  +  +I P   L  +    I V  +     VC  G 
Sbjct: 325 SNADSLQIIIPQSQLGRKS--DIYVAIVSDAHNVCSKGH 361


>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Length = 650 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Length = 650 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query416
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 100.0
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 100.0
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 100.0
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 100.0
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 100.0
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 99.95
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.94
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.94
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.93
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.93
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 99.93
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 99.92
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 99.92
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.92
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.92
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 99.91
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.9
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.87
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 99.87
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 99.87
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.86
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.84
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 99.84
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 99.76
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.76
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 99.73
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.72
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.72
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 99.72
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.7
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.67
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.67
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.64
3dme_A369 Conserved exported protein; structural genomics, P 99.37
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.36
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.33
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.27
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.26
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.2
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.19
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 99.18
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.18
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.17
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.17
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.16
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.11
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 99.11
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 99.1
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.07
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 99.02
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.95
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.94
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.81
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.75
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.74
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.71
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.67
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.64
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.63
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.62
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.61
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.6
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.6
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.6
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.59
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 98.59
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.59
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.58
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.58
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.57
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.57
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.57
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.56
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.53
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.53
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.52
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.52
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.52
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.52
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.52
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.51
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.51
4dna_A463 Probable glutathione reductase; structural genomic 98.49
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.49
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.49
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.49
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.48
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.48
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.48
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.47
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.47
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.47
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.46
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.46
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.46
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.45
2cul_A232 Glucose-inhibited division protein A-related PROT 98.43
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.43
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.43
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.43
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.42
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.42
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.42
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.41
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.4
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.39
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.39
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.39
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.39
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.38
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.38
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.38
3atr_A453 Conserved archaeal protein; saturating double bond 98.38
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.37
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.37
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.37
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.37
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.36
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.36
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.36
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.36
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.36
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.36
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.36
2bry_A497 NEDD9 interacting protein with calponin homology a 98.36
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.36
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.36
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.35
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.35
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.34
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.34
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.34
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.34
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.34
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.34
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.33
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.32
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.32
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.31
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.29
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.29
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.29
1fec_A 490 Trypanothione reductase; redox-active center, oxid 98.29
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.29
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.29
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 98.29
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.28
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.27
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.26
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.26
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.25
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.24
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.24
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.24
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.23
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.22
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.22
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.22
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.21
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.21
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.21
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 98.2
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.2
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.19
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.19
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.17
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.16
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.15
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.15
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.14
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.13
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.12
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 98.11
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.11
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.09
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.08
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 98.06
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 98.06
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.04
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.04
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.03
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.03
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.03
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.02
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 98.01
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.97
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.97
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.97
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.92
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.92
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 97.91
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.89
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 97.89
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.88
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.87
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.87
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.85
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.85
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.82
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.8
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 97.8
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.78
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.77
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.75
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.7
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.68
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.67
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.52
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.47
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.45
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.38
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.32
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.26
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.71
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.39
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.36
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.25
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.22
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.14
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.0
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.98
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.96
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.92
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.92
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.9
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 95.85
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 95.84
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.83
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.8
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 95.78
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 95.65
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.58
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.58
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.57
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 95.54
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.48
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 95.37
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.29
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.22
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 95.2
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 95.18
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.15
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 95.14
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.13
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 95.1
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.09
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 95.08
1ojt_A482 Surface protein; redox-active center, glycolysis, 95.07
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 95.04
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.01
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 94.99
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 94.94
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.87
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.87
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 94.86
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.86
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 94.85
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 94.81
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 94.79
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 94.73
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.72
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.69
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 94.67
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 94.65
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 94.59
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 94.59
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 94.57
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 94.53
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 94.53
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 94.48
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 94.45
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 94.42
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 94.4
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 94.37
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.36
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 94.35
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 94.34
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 94.32
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.31
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 94.29
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 94.28
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 94.27
2cul_A232 Glucose-inhibited division protein A-related PROT 94.25
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 94.23
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 94.23
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 94.22
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.2
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 94.18
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 94.16
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 94.16
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 94.08
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.07
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.07
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 94.06
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 94.04
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.02
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 94.02
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.02
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 93.99
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 93.97
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 93.95
3qha_A296 Putative oxidoreductase; seattle structural genomi 93.92
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 93.9
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 93.9
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.85
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 93.81
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 93.8
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.79
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 93.78
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 93.76
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 93.74
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.66
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.64
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 93.63
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 93.58
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 93.53
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 93.51
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 93.43
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 93.42
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 93.4
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 93.38
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.37
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 93.31
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 93.29
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 93.27
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 93.25
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 93.24
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.22
4g65_A461 TRK system potassium uptake protein TRKA; structur 93.2
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 93.14
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 93.14
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 93.12
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 93.12
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 93.12
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 93.08
3atr_A 453 Conserved archaeal protein; saturating double bond 93.03
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 93.02
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.01
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 93.0
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 92.93
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 92.9
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.87
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 92.86
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 92.85
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 92.85
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 92.84
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 92.82
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 92.8
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 92.76
1fec_A490 Trypanothione reductase; redox-active center, oxid 92.74
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.71
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.71
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.7
3r9u_A315 Thioredoxin reductase; structural genomics, center 92.7
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.68
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 92.67
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 92.65
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 92.6
3l6d_A306 Putative oxidoreductase; structural genomics, prot 92.57
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 92.56
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 92.55
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.51
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 92.48
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 92.46
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 92.34
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.32
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 92.29
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 92.29
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.24
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 92.23
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 92.23
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 92.22
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 92.2
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 92.16
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 92.16
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 92.07
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 92.07
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 92.06
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 92.06
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 92.04
2ywl_A180 Thioredoxin reductase related protein; uncharacter 92.01
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 92.0
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 91.96
4dna_A 463 Probable glutathione reductase; structural genomic 91.93
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 91.93
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 91.89
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 91.76
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 91.73
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 91.73
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 91.73
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.72
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 91.68
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 91.66
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 91.57
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 91.53
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 91.5
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.45
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 91.41
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 91.39
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 91.37
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 91.35
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 91.32
4ezb_A317 Uncharacterized conserved protein; structural geno 91.29
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.22
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.18
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 91.12
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.07
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 91.06
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 91.05
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 91.0
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 90.93
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.87
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 90.84
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 90.84
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 90.78
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 90.74
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 90.73
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 90.67
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 90.66
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 90.66
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 90.64
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 90.64
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 90.62
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 90.54
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 90.53
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 90.5
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 90.49
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 90.48
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 90.45
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 90.44
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 90.43
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 90.42
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 90.42
1vpd_A299 Tartronate semialdehyde reductase; structural geno 90.36
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 90.32
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 90.3
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 90.25
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 90.23
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 90.2
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.12
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 90.12
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 90.06
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 90.03
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 90.02
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 89.95
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 89.9
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 89.89
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 89.88
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 89.84
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 89.84
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 89.83
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 89.75
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 89.71
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 89.7
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 89.7
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 89.66
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 89.63
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 89.6
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.53
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.48
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 89.47
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 89.45
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 89.44
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 89.32
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 89.25
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 89.23
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 89.18
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 89.15
1yb4_A295 Tartronic semialdehyde reductase; structural genom 89.1
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 89.03
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 88.98
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 88.89
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 88.79
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 88.7
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 88.6
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 88.6
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 88.56
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 88.52
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 88.41
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 88.31
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 88.22
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 88.18
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 88.18
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 88.16
2rir_A300 Dipicolinate synthase, A chain; structural genomic 88.06
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 87.94
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 87.73
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 87.69
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 87.67
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 87.63
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 87.61
4gx0_A565 TRKA domain protein; membrane protein, ION channel 87.6
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 87.54
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 87.54
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 87.52
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 87.51
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 87.45
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 87.39
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 87.35
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
Probab=100.00  E-value=2.5e-50  Score=399.77  Aligned_cols=351  Identities=24%  Similarity=0.442  Sum_probs=283.1

Q ss_pred             CCCcccEEEECCChhHHHHHHHHhhCCCeEEEEccCCCCCCcccccChhhhHhhhhcCCCCCCCCCCCcccccccccccc
Q 014883           19 EPTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYAS   98 (416)
Q Consensus        19 ~~~~~DViIIGaGl~GL~aA~~La~~G~~V~vlE~~~~~GG~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (416)
                      ++..|||||||||++||++|+.|+++|++|+|+|+++++||++.+++..++..+... +.+.                 .
T Consensus        17 ~~~~~dv~iiG~G~~g~~~a~~l~~~g~~v~~~e~~~~~Gg~~~s~~~~~l~~~~~~-g~~~-----------------~   78 (475)
T 3p1w_A           17 QGEHYDVIILGTGLKECILSGLLSHYGKKILVLDRNPYYGGETASLNLTNLYNTFKP-KENI-----------------P   78 (475)
T ss_dssp             CCCEEEEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEECHHHHHHHHCT-TSCC-----------------C
T ss_pred             ccccCCEEEECCCHHHHHHHHHHHHCCCcEEEEeccCCCCCCccccchhhhhhhccc-CCCc-----------------c
Confidence            456799999999999999999999999999999999999999999998765444432 1110                 0


Q ss_pred             ccccCCCCceEeeCCCCeEEeeCchHHHHHHhcCcccccccccccceeeec--------cCCceeecCCChhhhhhcCCC
Q 014883           99 RLLSQHPRNFNLDVSGPRVLFCADHAVDLMLKSGASHYLEFKSIDATFMLD--------ADAKLCSVPDSRAAIFKDKSL  170 (416)
Q Consensus        99 ~~~~~~~~~~~~dl~Gp~~~~~~~~~~~~l~~~g~~~~~~f~~~~~~~~~~--------~~g~~~~~p~~~~~~~~~~~l  170 (416)
                      ..+ +..++|++|+. |+++++.+.++++|.++++.+|++|+.+++.|++.        ++|+.+++|.++.++|+++.+
T Consensus        79 ~~~-g~~R~y~iDL~-P~~l~~~g~L~~lL~~~gv~~ylef~~~~~~y~~~~~~~~~~~~~g~~~~VPss~~e~~~~~lL  156 (475)
T 3p1w_A           79 SKY-GENRHWNVDLI-PKFILVGGNLVKILKKTRVTNYLEWLVVEGSYVYQHQKKGFLTSEKFIHKVPATDMEALVSPLL  156 (475)
T ss_dssp             GGG-CCGGGCCEESS-CCBEETTSHHHHHHHHTTCGGGSCEEECSEEEEEEEECCCSSSCCEEEEECCCSHHHHHTCTTS
T ss_pred             ccc-ccccceEEeec-CeEeecCcHHHHHHHHCCchheeEEEecCcceEEecCccccccCCCceEeCCCCHHHHhhccCC
Confidence            112 35689999995 99999999999999999999999999999988763        256799999999999999999


Q ss_pred             ChHHHHHHHHHHHHHHhhcCCCccccccccccccccCCcHHHHHHhcCCChhHHHHHHHHHHhccCCchhhhhhhchhhH
Q 014883          171 GLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDG  250 (416)
Q Consensus       171 ~~~~k~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~  250 (416)
                      ++.+|+++++|+..++++....+...   + ..+....|+.+|++++++++.+++++.+++++.... +.  ...++..+
T Consensus       157 s~~eK~~l~kFL~~l~~~~~~~~~~~---~-~~~l~~~s~~e~l~~~gls~~l~~fl~~alaL~~~~-~~--~~~~a~~~  229 (475)
T 3p1w_A          157 SLMEKNRCKNFYQYVSEWDANKRNTW---D-NLDPYKLTMLEIYKHFNLCQLTIDFLGHAVALYLND-DY--LKQPAYLT  229 (475)
T ss_dssp             CHHHHHHHHHHHHHHHHCCTTCGGGS---T-TCCTTTSBHHHHHHHTTCCHHHHHHHHHHTSCCSSS-GG--GGSBHHHH
T ss_pred             CHHHHHHHHHHHHHHHhhhhccchhh---h-cccccCCCHHHHHHHcCCCHHHHHHHHHHHHhhcCC-Cc--ccCCHHHH
Confidence            99999999999998876643222100   0 112346899999999999999999887776654321 11  13467778


Q ss_pred             HHHHHHHHhhhccccCCCccEEeecCCcchHHHHHHHHHHhcCcEEEcCCceeEEEEecCCCcEEEEEeCCCcEEEcCEE
Q 014883          251 INRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKL  330 (416)
Q Consensus       251 ~~~~~~~~~s~~~~g~~~~~~~~p~gG~~~l~~al~r~~~~~Gg~i~l~~~V~~I~~~~~~g~~~gV~l~~G~~i~Ad~V  330 (416)
                      +.++..|+.|+++||.  +++.||+||+++|+++|++.+++.|++|+++++|++|..+ ++|++++|++.+|++++||+|
T Consensus       230 l~ri~~y~~Sl~~yg~--s~~~yp~gG~~~L~~aL~r~~~~~Gg~i~l~t~V~~I~~d-~~g~v~gV~~~~G~~i~Ad~V  306 (475)
T 3p1w_A          230 LERIKLYMQSISAFGK--SPFIYPLYGLGGIPEGFSRMCAINGGTFMLNKNVVDFVFD-DDNKVCGIKSSDGEIAYCDKV  306 (475)
T ss_dssp             HHHHHHHHHHHHHHSS--CSEEEETTCTTHHHHHHHHHHHHC--CEESSCCEEEEEEC-TTSCEEEEEETTSCEEEEEEE
T ss_pred             HHHHHHHHHHHhhcCC--CceEEECCCHHHHHHHHHHHHHHcCCEEEeCCeEEEEEEe-cCCeEEEEEECCCcEEECCEE
Confidence            8888999988888874  3589999999999999999999999999999999999984 278889999989999999999


Q ss_pred             EECCCCCCCCCCCCchhhhhhhhhhccccCCcceEEEEEEEecCCCCC--CCCceEEEeCCCCCCCCCCCeEEEEEecCC
Q 014883          331 VLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGICITRSSLKP--DLSNFLVIFPPRSLFPEQVTSIRVLQLGGN  408 (416)
Q Consensus       331 I~~p~~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~k~i~i~~~p~~~--~~~~~~~~~pp~~~~~~~~~~v~~~~~~~~  408 (416)
                      |+++.+.. .        +|..   .   ...+.++|+++|.++|+.+  ++++++++|||.+.+.  .++|||.+++++
T Consensus       307 I~a~~~~~-~--------~p~~---~---~~~~~v~R~i~I~~~pi~~~~~~~~~~i~~P~~~~~~--~~~iy~~~~s~~  369 (475)
T 3p1w_A          307 ICDPSYVM-H--------LKNK---I---KKIGQVIRCICILSNPIPETNQTNSCQIIIPQNQLNR--KSDIYINLVSFQ  369 (475)
T ss_dssp             EECGGGCT-T--------STTS---E---EEEEEEEEEEEEESSCCTTSTTCSSEEEEECGGGGTS--SSCEEEEEEEGG
T ss_pred             EECCCccc-c--------Cccc---c---cccceEEEEEEEEeccCcccCCCceEEEEeCCcccCC--CCCEEEEEECCC
Confidence            99887641 1        1110   0   1257899999999999965  5678899999987654  578999999999


Q ss_pred             CccCCCCC
Q 014883          409 LAVCPLGM  416 (416)
Q Consensus       409 ~~~~p~G~  416 (416)
                      +++||+|+
T Consensus       370 ~~~cp~G~  377 (475)
T 3p1w_A          370 HGVTLKGK  377 (475)
T ss_dssp             GTSSCTTC
T ss_pred             cCcCCCCc
Confidence            99999996



>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 416
d1vg0a1491 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 { 3e-68
d1vg0a1491 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 { 1e-20
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 2e-28
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 6e-19
d1vg0a2113 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Ra 3e-10
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 3e-04
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Rab escort protein 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  222 bits (566), Expect = 3e-68
 Identities = 90/356 (25%), Positives = 141/356 (39%), Gaps = 48/356 (13%)

Query: 62  SSLSIADLTHFLNSHSTPSSVCPDPLYSDVEISNYASRLLSQHPRNFNLDVSGPRVLFCA 121
                +D        S       D   +  +     S+++ +  R FN+D+   ++L+  
Sbjct: 177 GKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEG-RRFNIDLV-SKLLYSR 234

Query: 122 DHAVDLMLKSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRF 181
              +DL++KS  S Y EFK+I        +  +  VP SRA +F  K L ++EK  LM+F
Sbjct: 235 GLLIDLLIKSNVSRYAEFKNITRILAFR-EGTVEQVPCSRADVFNSKQLTMVEKRMLMKF 293

Query: 182 FKLVQGHLSLDESEENNVRISEEDLDSPFAEFLTKMKLPHKIKSIVLYAIAMADYDQEVS 241
                 +       E +         + F+E+L   KL   ++  VL++IAM        
Sbjct: 294 LTFCVEY-------EEHPDEYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAMTSETTS-- 344

Query: 242 EYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRAAVKGCLYVLRMP 301
                T DG+     +   +GR+ N     ++P+YGQGELPQ FCR  AV G +Y LR  
Sbjct: 345 ----CTVDGLKATKKFLQCLGRYGNT--PFLFPLYGQGELPQCFCRMCAVFGGIYCLRHS 398

Query: 302 VISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDN 361
           V  L+ D+ S   K V    GQ I+S   +++ S+    +                    
Sbjct: 399 VQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENTC------------------- 439

Query: 362 KGKVARGICITRSSLKPDLSNFLVIFPPRSLFPE----QVTSIRVLQLGGNLAVCP 413
             +V+R  C          SN  V   P S        +       Q+  N   CP
Sbjct: 440 -SRVSR-DCYNDLP-----SNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFCP 488


>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 491 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1vg0a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 113 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query416
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 100.0
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 100.0
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.97
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.91
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.85
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.83
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.72
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.63
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.54
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.52
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.5
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.49
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.48
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.4
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.38
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.36
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.29
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.16
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.02
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.96
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.95
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.93
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.9
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.9
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.87
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.84
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.83
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.81
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.81
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.79
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.79
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.72
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.72
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.71
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.7
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.69
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.68
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.66
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.66
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.65
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.65
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.64
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.63
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.63
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.62
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.62
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.59
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.59
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.58
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.58
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.55
d1vg0a2113 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 98.54
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.51
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.51
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.5
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.48
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.46
d1d5ta297 Guanine nucleotide dissociation inhibitor, GDI {Co 98.46
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.46
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.42
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.4
d2bcgg398 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.4
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.29
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.29
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.29
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.18
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.94
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.92
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.9
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.84
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.82
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.81
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.81
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.81
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.78
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.72
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.66
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.6
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.57
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.56
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.52
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.44
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.31
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.3
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.27
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.25
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.23
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.16
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.14
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.13
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.11
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.04
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.94
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.89
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.87
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.86
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.84
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.81
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.75
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.73
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.72
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.68
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.66
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.58
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.47
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.36
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.31
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.28
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.25
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.17
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.11
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.09
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 96.07
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.97
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.95
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.86
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.76
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.66
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.36
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.33
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.33
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 95.2
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.13
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.85
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.82
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.81
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.69
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.56
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.54
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.48
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.48
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.19
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.11
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 94.06
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.99
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.92
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.83
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.6
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 93.59
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.38
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.33
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 93.13
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.93
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.85
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 92.81
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.8
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.79
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.59
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.3
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.29
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.18
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 92.01
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.58
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 91.54
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.43
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.41
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 91.3
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.3
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 91.2
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.05
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.02
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.82
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.77
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.7
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 90.59
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.18
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 90.17
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.11
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.1
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 90.09
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 89.89
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 89.71
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 89.67
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.44
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.32
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.27
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 88.95
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 88.89
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.86
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 88.58
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.18
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.88
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.62
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 87.54
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 87.52
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.36
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 87.26
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 87.26
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.24
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 87.21
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.76
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 86.54
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.01
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.0
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 85.9
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 85.36
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 85.25
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 84.83
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 84.58
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 84.22
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 83.91
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.41
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 83.36
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 83.28
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 83.02
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 82.8
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 82.69
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 82.38
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 81.9
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.42
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 81.42
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 81.4
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 81.13
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 80.51
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Rab escort protein 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=2.6e-51  Score=399.55  Aligned_cols=352  Identities=34%  Similarity=0.551  Sum_probs=274.6

Q ss_pred             CCcccEEEECCChhHHHHHHHHhhCCCeEEEEccCCCCCCcccccChhhhHhhhhcCCCCCCCC--C-------------
Q 014883           20 PTAFDLIVIGTGLPESVISAAASASGKSVLHLDPNPFYGSHFSSLSIADLTHFLNSHSTPSSVC--P-------------   84 (416)
Q Consensus        20 ~~~~DViIIGaGl~GL~aA~~La~~G~~V~vlE~~~~~GG~~~s~~~~~~~~~~~~~~~~~~~~--~-------------   84 (416)
                      +++|||||+|+||..++.|++|++.|+||+|+|+|++|||.++|+++.++..|+..........  .             
T Consensus         4 P~e~DVII~GTGL~ESILAaAlSr~GkkVLHiD~N~yYGg~~aSl~~~~L~~w~~~~~~~~~~~~~~~~~~~~~~e~e~~   83 (491)
T d1vg0a1           4 PSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENNDVVTENSMWQEQILENEEA   83 (491)
T ss_dssp             CSBCSEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCGGGCEECHHHHHHHHHHTC----------CGGGGCCTTEEE
T ss_pred             CCccCEEEECCChHHHHHHHHHHhcCCEEEEecCCCcCCCcccceeHHHHHHHHHhhhcccccccccccccccccccchh
Confidence            6789999999999999999999999999999999999999999999999999987654321100  0             


Q ss_pred             ------CCccccccccc---------------------------------------------------------------
Q 014883           85 ------DPLYSDVEISN---------------------------------------------------------------   95 (416)
Q Consensus        85 ------~~~~~~~~~~~---------------------------------------------------------------   95 (416)
                            .....+++..+                                                               
T Consensus        84 ~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~  163 (491)
T d1vg0a1          84 IPLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNHASVTSAQSAEAAEAAETSCLPTAVEPLSMGSCEIPAEQSQCPG  163 (491)
T ss_dssp             EEBCSSCCCEEEEEEEECSCC-----------------------------------------------------------
T ss_pred             cccccccccccccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccC
Confidence                  00000000000                                                               


Q ss_pred             ----------------------------------------------cccccccCCCCceEeeCCCCeEEeeCchHHHHHH
Q 014883           96 ----------------------------------------------YASRLLSQHPRNFNLDVSGPRVLFCADHAVDLML  129 (416)
Q Consensus        96 ----------------------------------------------~~~~~~~~~~~~~~~dl~Gp~~~~~~~~~~~~l~  129 (416)
                                                                    .....+.+..|+|+|||. |+++++++.++++|.
T Consensus       164 ~e~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~r~~niDL~-Pk~l~a~g~lv~~Li  242 (491)
T d1vg0a1         164 PESSPEVNDAEATGKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEGRRFNIDLV-SKLLYSRGLLIDLLI  242 (491)
T ss_dssp             ---------------------------------------------CCCHHHHHHTGGGCCEESS-CCCEESSSHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccc-chheecccHHHHHHH
Confidence                                                          000011234689999997 999999999999999


Q ss_pred             hcCcccccccccccceeeeccCCceeecCCChhhhhhcCCCChHHHHHHHHHHHHHHhhcCCCccccccccccccccCCc
Q 014883          130 KSGASHYLEFKSIDATFMLDADAKLCSVPDSRAAIFKDKSLGLMEKNQLMRFFKLVQGHLSLDESEENNVRISEEDLDSP  209 (416)
Q Consensus       130 ~~g~~~~~~f~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~l~~~~k~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t  209 (416)
                      ++++.+|++|+.++..|++. +|++.++|+++.++|+++.+++.+||++|+|+.++.++... +.      ....+.+.|
T Consensus       243 ~S~v~rYlEFk~v~~~~v~~-~g~~~~VP~sr~eif~s~~l~l~eKR~lmkFl~~v~~~~~~-~~------~~~~~~~~~  314 (491)
T d1vg0a1         243 KSNVSRYAEFKNITRILAFR-EGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEYEEH-PD------EYRAYEGTT  314 (491)
T ss_dssp             HHTGGGGCCEEECCEEEEES-SSSEEECCCSHHHHHHCSSSCHHHHHHHHHHHHHHHTGGGC-HH------HHHTTTTSB
T ss_pred             HcChhhheeEEEeceEEEec-CCeEEECCCCHHHHhcCCCCCHHHHHHHHHHHHHHhhccCC-cc------ccccccCCc
Confidence            99999999999999999886 88999999999999999999999999999999999876432 21      123456789


Q ss_pred             HHHHHHhcCCChhHHHHHHHHHHhccCCchhhhhhhchhhHHHHHHHHHhhhccccCCCccEEeecCCcchHHHHHHHHH
Q 014883          210 FAEFLTKMKLPHKIKSIVLYAIAMADYDQEVSEYVLKTRDGINRLALYNSSIGRFQNALGALIYPIYGQGELPQAFCRRA  289 (416)
Q Consensus       210 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~s~~~~g~~~~~~~~p~gG~~~l~~al~r~~  289 (416)
                      |.+||+++++++.+++++.|++++....      ..++.+++.++..|+.|+++||.  .+|+||.||.++|+|+|||++
T Consensus       315 ~~e~l~~~~l~~~~~~~i~~aial~~~~------~~~~~~~l~ri~~yl~Slg~yG~--spflyp~YG~gEipQ~FcR~~  386 (491)
T d1vg0a1         315 FSEYLKTQKLTPNLQYFVLHSIAMTSET------TSCTVDGLKATKKFLQCLGRYGN--TPFLFPLYGQGELPQCFCRMC  386 (491)
T ss_dssp             HHHHHTTSSSCHHHHHHHHHHTTC--CC------SCBHHHHHHHHHHHHHHTTSSSS--SSEEEETTCTTHHHHHHHHHH
T ss_pred             HHHHHHHcCCChHHHHHHHhheeccCCC------CccHHHHHHHHHHHHHHHHhhCC--CCeEeecCCcchHHHHHHHHH
Confidence            9999999999999999999998875322      24577889999999999999985  569999999999999999999


Q ss_pred             HhcCcEEEcCCceeEEEEecCCCcEEEEEeCCCcEEEcCEEEECCCCCCCCCCCCchhhhhhhhhhccccCCcceEEEEE
Q 014883          290 AVKGCLYVLRMPVISLLTDQNSGSYKGVRLASGQDILSHKLVLDPSFTVPGSLASSHQQLQESFQAFSLSDNKGKVARGI  369 (416)
Q Consensus       290 ~~~Gg~i~l~~~V~~I~~~~~~g~~~gV~l~~G~~i~Ad~VI~~p~~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~k~i  369 (416)
                      +..||+++||++|++|..+.+++++.+|.+++|++++|++||++|.+...+.                    .+.+.|. 
T Consensus       387 AV~Gg~Y~L~~~i~~i~~d~e~~~~~~v~~~~g~~i~~k~vI~~psy~p~~~--------------------~~~v~r~-  445 (491)
T d1vg0a1         387 AVFGGIYCLRHSVQCLVVDKESRKCKAVIDQFGQRIISKHFIIEDSYLSENT--------------------CSRVSRD-  445 (491)
T ss_dssp             HHTTCEEESSCCEEEEEEETTTCCEEEEEETTSCEEECSEEEEEGGGBCTTT--------------------TTTCCGG-
T ss_pred             HhcCcEEEcCCccceEEEecCCCeEEEEEccCCcEEecCeEEECHHhCCccc--------------------cceeeeh-
Confidence            9999999999999999997668888899989999999999999998863221                    2223331 


Q ss_pred             EEecCCCCCCCCceEEEeCCCCCCCCCCCeEE----EEEecCCCccCCC
Q 014883          370 CITRSSLKPDLSNFLVIFPPRSLFPEQVTSIR----VLQLGGNLAVCPL  414 (416)
Q Consensus       370 ~i~~~p~~~~~~~~~~~~pp~~~~~~~~~~v~----~~~~~~~~~~~p~  414 (416)
                      +     +...++..+|+.||....++.....+    +.+++.++++||.
T Consensus       446 c-----~~~~~s~~~i~~~p~~~~~~d~~v~~a~~~~~~~~p~~~~cP~  489 (491)
T d1vg0a1         446 C-----YNDLPSNVYVCSGPDSGLGNDNAVKQAETLFQQICPNEDFCPA  489 (491)
T ss_dssp             G-----SSSCCTTEEEECCCCSSSSSHHHHHHHHHHHHHHSTTCCSSCC
T ss_pred             h-----hcCCCceEEEECCCCcCCccchhhhhHhhhhhhcCCCCCcCCC
Confidence            2     23344666666667654432211122    2466999999996



>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vg0a2 d.16.1.6 (A:445-557) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d5ta2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure