Citrus Sinensis ID: 015062

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----
MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
cEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHcccccccccccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHcccccEEccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccEEccccccccccEEEEEccccEEEEEcccccEEEEEccccccEEEEEcEEccccccccccccEEEEEEccccccccccccccccccccccccccccccccc
cEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccEEEcccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEcccEEEEcccccccccccEEcccccccccHHHHHHHHHHHccccccccccccccEEEEccccccEEEEccccccEEEcccccccccEEccccEEEEEcccEEEEEcccccccEEccccccccccEEEEEcccEEEEEEcccccEEEEEccccccEEEcccEEccccccccccccEEEEEEccccccccccHHccccccccccHHHHHHHHccc
mvildnhiskpgwccsnsdgngffgdqyfnpdlwiKGLTKMATIFNGVRNVVGMSLrnelrgpkqnvKDWYRYMQLGAEAVHAANPEVLVILSglnfdkdlSFVRNQAVNLTFTGKLVFEAHwygftdgqawvdgnpnqvcgrvVDNVMRLSGFlleqgwplfvsefgadlrgnnvndnrylnCFFGVAAELDWDWALWTLVGSYYLREGVIGLNeyyglfdwnwcdirnSSFLERISslqspfrgpgvfetglhkviyhpatglcvqrksfldpltlgpcteseawsytphktislkGAYFCLqakhvgkpaklgiictdcgstweIISDskmhlsskadngttvcldvdssntivtntckclsrdktcdpasqwfklvdstrsstttksffqfnpildlpgkdFIWKFFGLF
mvildnhiskpgwcCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGmslrnelrgpkqnVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNtckclsrdktcdpasQWFKLVDstrsstttksffqfnpildlpgkDFIWKFFGLF
MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDstrsstttksFFQFNPILDLPGKDFIWKFFGLF
***LDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGL*
MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQ***************VIYHPATGLCVQ*****************AWSYTPHKTISLKGAYFCLQAKHVGKPAK***********WEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDS***************ILDLPGKDFIWKFFGLF
MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
255547996 566 hydrolase, hydrolyzing O-glycosyl compou 0.997 0.729 0.785 0.0
224102379 544 predicted protein [Populus trichocarpa] 0.995 0.757 0.767 0.0
224110842513 predicted protein [Populus trichocarpa] 0.942 0.760 0.784 0.0
225424600 552 PREDICTED: uncharacterized protein LOC10 0.973 0.730 0.735 1e-180
356511061 557 PREDICTED: uncharacterized protein LOC10 0.944 0.701 0.726 1e-177
449435438 549 PREDICTED: uncharacterized protein LOC10 0.954 0.719 0.714 1e-171
449527929421 PREDICTED: uncharacterized LOC101217177, 0.954 0.938 0.714 1e-170
356541382 544 PREDICTED: endoglucanase-like [Glycine m 0.932 0.709 0.695 1e-166
356528434 574 PREDICTED: uncharacterized protein LOC10 0.975 0.703 0.665 1e-165
356511059 571 PREDICTED: endoglucanase E1-like [Glycin 0.975 0.707 0.652 1e-162
>gi|255547996|ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223546106|gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/414 (78%), Positives = 364/414 (87%), Gaps = 1/414 (0%)

Query: 1   MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNEL 60
           MVILDNHISKPGWCCSN DGNGFFGD YFNPDLWIKGLT+MAT+FNGV NV+GMSLRNEL
Sbjct: 152 MVILDNHISKPGWCCSNFDGNGFFGDTYFNPDLWIKGLTQMATLFNGVTNVIGMSLRNEL 211

Query: 61  RGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFE 120
           RG KQNV DWYRYM+ GAEAVH+ANP+VLVILSGLN+DKD SF+RN+ VNL+FTGK+VFE
Sbjct: 212 RGQKQNVNDWYRYMEKGAEAVHSANPDVLVILSGLNYDKDFSFLRNRPVNLSFTGKVVFE 271

Query: 121 AHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNR 180
            HWYGF+DGQAW  GNPNQVCGRVVDN+MR+SGFLLEQGWP+FVSEFG D RG NVNDNR
Sbjct: 272 VHWYGFSDGQAWRSGNPNQVCGRVVDNLMRISGFLLEQGWPMFVSEFGVDQRGTNVNDNR 331

Query: 181 YLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSL 240
           YL CF GVAAELDWDWALWTLVGSYYLR+GVIGLNEYYG+ +WNWCD+RNSSFL++IS+L
Sbjct: 332 YLGCFIGVAAELDWDWALWTLVGSYYLRQGVIGLNEYYGVLNWNWCDVRNSSFLQQISAL 391

Query: 241 QSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGA 300
           QSPF+GPG+ ET  HKVI+HP+TGLCVQRKS L+PL LG CT+SEAW YT   T++L+G 
Sbjct: 392 QSPFQGPGLSETNPHKVIFHPSTGLCVQRKSMLEPLRLGSCTDSEAWRYTSENTLTLRGT 451

Query: 301 YFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNT 360
           YFCLQA  +GKPAKLGIICTD  S W++ISDSKMHLSSK  NGT VCLDVDS+NTIV +T
Sbjct: 452 YFCLQADELGKPAKLGIICTDSTSKWDVISDSKMHLSSKITNGTAVCLDVDSNNTIVIST 511

Query: 361 CKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPI-LDLPGKDFIWKFFGL 413
           CKCLSRD TCDP SQWFKLV+STRSS T K   + N I LDLP K+F WKF GL
Sbjct: 512 CKCLSRDNTCDPESQWFKLVNSTRSSATAKPSLRINSILLDLPAKEFFWKFLGL 565

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102379|ref|XP_002312657.1| predicted protein [Populus trichocarpa] gi|222852477|gb|EEE90024.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110842|ref|XP_002315653.1| predicted protein [Populus trichocarpa] gi|222864693|gb|EEF01824.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424600|ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511061|ref|XP_003524250.1| PREDICTED: uncharacterized protein LOC100790415 [Glycine max] Back     alignment and taxonomy information
>gi|449435438|ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449527929|ref|XP_004170960.1| PREDICTED: uncharacterized LOC101217177, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356541382|ref|XP_003539156.1| PREDICTED: endoglucanase-like [Glycine max] Back     alignment and taxonomy information
>gi|356528434|ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max] Back     alignment and taxonomy information
>gi|356511059|ref|XP_003524249.1| PREDICTED: endoglucanase E1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query414
TAIR|locus:2031850552 AT1G13130 [Arabidopsis thalian 0.910 0.682 0.603 4.4e-132
TAIR|locus:2093551551 AT3G26130 [Arabidopsis thalian 0.963 0.724 0.550 4e-122
TAIR|locus:2093571508 AT3G26140 [Arabidopsis thalian 0.908 0.740 0.561 1.8e-119
TAIR|locus:2157482526 AT5G17500 [Arabidopsis thalian 0.903 0.711 0.559 2.8e-114
TAIR|locus:2149005488 AT5G16700 [Arabidopsis thalian 0.507 0.430 0.549 6.2e-91
UNIPROTKB|G4N8V8423 MGG_03374 "Beta-1,6-galactanas 0.557 0.546 0.347 1.8e-32
ASPGD|ASPL0000037062412 AN9166 [Emericella nidulans (t 0.557 0.560 0.325 3.9e-28
UNIPROTKB|G4MKY3480 MGG_05381 "Beta-1,6-galactanas 0.241 0.208 0.433 2.1e-22
UNIPROTKB|G4NBI5411 MGG_00530 "Endoglucanase E1" [ 0.475 0.479 0.253 4.2e-08
TAIR|locus:2031850 AT1G13130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1295 (460.9 bits), Expect = 4.4e-132, P = 4.4e-132
 Identities = 231/383 (60%), Positives = 288/383 (75%)

Query:     1 MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNEL 60
             MVILDNH++KPGWCC+N DGNGFFGDQ+F+P +W+  L KMA  FNGV NVVGMSLRNEL
Sbjct:   154 MVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLRNEL 213

Query:    61 RGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFE 120
             RGPKQNV DW++YMQ GAEAVH+AN +VLVILSGL+FD DLSFVR++ V L+FTGKLVFE
Sbjct:   214 RGPKQNVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFVRSRPVKLSFTGKLVFE 273

Query:   121 AHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNR 180
              HWY F+DG +W   NPN +CGRV++ +    G+LL QG+PLF+SEFG D RG N NDNR
Sbjct:   274 LHWYSFSDGNSWAANNPNDICGRVLNRIGNGGGYLLNQGFPLFLSEFGIDERGVNTNDNR 333

Query:   181 YLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSL 240
             Y  C  G AAE D DW+LW L GSYYLR+G +G+NEYYG+ D +W  +RNSSFL++IS L
Sbjct:   334 YFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFL 393

Query:   241 QSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDP--LTLGPCTESEAWSYTPHKTISLK 298
             QSP +GPG   T  + +++HP TGLC+ R S  DP  LTLGPC  SE WSYT  K + +K
Sbjct:   394 QSPLQGPGP-RTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIK 450

Query:   299 GAYFCLQAKHVGKPAKLG-IICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIV 357
                 CLQ+     P  +    C+  GS W+ IS S+MHL+S   N T++CLDVD++N +V
Sbjct:   451 DQQLCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTANNVV 510

Query:   358 TNTCKCLSRDKTCDPASQWFKLV 380
              N CKCLS+DK+C+P SQWFK++
Sbjct:   511 ANACKCLSKDKSCEPMSQWFKII 533
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0043169 "cation binding" evidence=IEA
TAIR|locus:2093551 AT3G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093571 AT3G26140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157482 AT5G17500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149005 AT5G16700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8V8 MGG_03374 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037062 AN9166 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKY3 MGG_05381 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBI5 MGG_00530 "Endoglucanase E1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 1e-06
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 0.001
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 0.001
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information 
 Score = 49.7 bits (119), Expect = 1e-06
 Identities = 43/204 (21%), Positives = 75/204 (36%), Gaps = 21/204 (10%)

Query: 2   VILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELR 61
           VI+D H         + +GN      +F   LW    T++AT +      V   L NE  
Sbjct: 79  VIIDWHHD---TWPGDPNGNIDTAKAFFK-KLW----TQIATRYG-NNPNVIFELMNEPH 129

Query: 62  GPKQN--VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVF 119
           G        D   Y Q   +A+ AA P  L+I+ G ++ ++         +      L++
Sbjct: 130 GVDPATWDDDVKDYAQEAIDAIRAAGPNNLIIVGGPSWSQNPDGAALN--DPNDDDNLIY 187

Query: 120 EAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVND- 178
             H+Y  +       G  ++        +   + + L+ G P+F+ EFG         D 
Sbjct: 188 SVHFYAPSHFSGTWFGCEDKTNLA--QRLRAAANYALDNGIPVFIGEFGGGNADGPCRDE 245

Query: 179 -NRYLNCFFGVAAELDWDWALWTL 201
             ++L+       E    W  W+ 
Sbjct: 246 AEKWLDY----LKENGISWTGWSN 265

Length = 269
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information
>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 414
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.93
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.58
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 98.69
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.6
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.49
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 98.33
PRK10150604 beta-D-glucuronidase; Provisional 98.16
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 98.06
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 97.74
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 97.59
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 97.55
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 97.48
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 97.4
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 97.37
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 97.32
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.26
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 97.18
COG3934587 Endo-beta-mannanase [Carbohydrate transport and me 97.01
PF01229486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 96.72
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 96.13
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 95.63
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 95.26
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 94.97
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 94.08
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 92.49
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 91.99
KOG3738559 consensus Predicted polypeptide N-acetylgalactosam 91.65
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 90.7
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 87.28
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 85.26
TIGR03356427 BGL beta-galactosidase. 84.58
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 84.26
KOG2233666 consensus Alpha-N-acetylglucosaminidase [Intracell 81.84
PF03662319 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-t 80.74
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=99.93  E-value=7.9e-26  Score=218.12  Aligned_cols=194  Identities=24%  Similarity=0.415  Sum_probs=142.7

Q ss_pred             CEEEecCCCCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCceEEEEeccCCCCCCCC-------ChhhHHHH
Q 015062            1 MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQ-------NVKDWYRY   73 (414)
Q Consensus         1 ~VILD~H~~~p~wcc~~~dgn~~w~d~~~~~d~~~~~W~~iA~ryk~~pnViG~dL~NEP~~~~~-------n~~dW~~~   73 (414)
                      +||||+|.. |+|+...   +. +....-..+.+.++|+.||+|||+++.|++|||+|||+....       +..+|.++
T Consensus        77 ~vild~h~~-~~w~~~~---~~-~~~~~~~~~~~~~~~~~la~~y~~~~~v~~~el~NEP~~~~~~~~w~~~~~~~~~~~  151 (281)
T PF00150_consen   77 YVILDLHNA-PGWANGG---DG-YGNNDTAQAWFKSFWRALAKRYKDNPPVVGWELWNEPNGGNDDANWNAQNPADWQDW  151 (281)
T ss_dssp             EEEEEEEES-TTCSSST---ST-TTTHHHHHHHHHHHHHHHHHHHTTTTTTEEEESSSSGCSTTSTTTTSHHHTHHHHHH
T ss_pred             eEEEEeccC-ccccccc---cc-cccchhhHHHHHhhhhhhccccCCCCcEEEEEecCCccccCCccccccccchhhhhH
Confidence            599999977 6774332   11 111112346677899999999999999999999999998521       12678999


Q ss_pred             HHHHHHHHHhcCCCcEEEEcCccCCCcchh-hhcccccccCCCcEEEEEeecCCCCC-CCccCCCCCcchhhHHHHHHHH
Q 015062           74 MQLGAEAVHAANPEVLVILSGLNFDKDLSF-VRNQAVNLTFTGKLVFEAHWYGFTDG-QAWVDGNPNQVCGRVVDNVMRL  151 (414)
Q Consensus        74 ~~~~~~aIr~~dP~~LIiVeG~~~~~dLs~-v~~~Pv~l~~~~klVYs~H~Y~p~~~-~~W~~~~~~~~~~~~~~~~~~~  151 (414)
                      +++++++||+++|+++|+|+|..|+.++.. ....|.  ...+++||++|.|.+... ..+... .......+...+...
T Consensus       152 ~~~~~~~Ir~~~~~~~i~~~~~~~~~~~~~~~~~~P~--~~~~~~~~~~H~Y~~~~~~~~~~~~-~~~~~~~~~~~~~~~  228 (281)
T PF00150_consen  152 YQRAIDAIRAADPNHLIIVGGGGWGADPDGAAADNPN--DADNNDVYSFHFYDPYDFSDQWNPG-NWGDASALESSFRAA  228 (281)
T ss_dssp             HHHHHHHHHHTTSSSEEEEEEHHHHTBHHHHHHHSTT--TTTTSEEEEEEEETTTCHHTTTSTC-SHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCcceeecCCCccccccchhhhcCcc--cccCceeEEeeEeCCCCcCCccccc-cchhhhHHHHHHHHH
Confidence            999999999999999999999999887766 444552  135789999999997652 222110 001122334455556


Q ss_pred             HHHHHhcCCCEEEeccCcCCCCCCccchHHHHHHHHHHHHCCCcEEEeccCc
Q 015062          152 SGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVG  203 (414)
Q Consensus       152 ~gfl~~~g~Pv~lGEFG~~~~~~~~~~~~~~~~~l~~l~e~~i~Wa~Wa~~G  203 (414)
                      ..++.+.|.||+|||||....+.. ....++..++++++++++||++|++++
T Consensus       229 ~~~~~~~g~pv~~gE~G~~~~~~~-~~~~~~~~~~~~~~~~~~g~~~W~~~~  279 (281)
T PF00150_consen  229 LNWAKKNGKPVVVGEFGWSNNDGN-GSTDYADAWLDYLEQNGIGWIYWSWKP  279 (281)
T ss_dssp             HHHHHHTTSEEEEEEEESSTTTSC-HHHHHHHHHHHHHHHTTCEEEECEESS
T ss_pred             HHHHHHcCCeEEEeCcCCcCCCCC-cCHHHHHHHHHHHHHCCCeEEEEecCC
Confidence            666677899999999999854332 346788888999999999999999974

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>KOG3738 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03662 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-terminal domain ; InterPro: IPR005199 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1vrx_A358 Endocellulase E1 From Acidothermus Cellulolyticus M 2e-04
>pdb|1VRX|A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g Length = 358 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 62/156 (39%), Gaps = 21/156 (13%)
Query: 34  WIKGLTKMATIFNGVRNVVGMSLRNELRGPK-----QNVKDWYRYMQLGAEAVHAANPEV 88
           WI  L  +A  + G   VVG  L NE   P          DW    +    AV + NP +
Sbjct: 137 WISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNL 196
Query: 89  LVILSGLN--------FDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDG-QAWVDGN--P 137
           L+ + G+         +  +L       V L    +LV+ AH Y  + G Q W      P
Sbjct: 197 LIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVGPQTWFSDPTFP 256
Query: 138 NQVCGRVVDNVMRLSGFLLEQG-WPLFVSEFGADLR 172
           N + G    N     G+L  Q   P+++ EFG  L+
Sbjct: 257 NNMPGIWNKNW----GYLFNQNIAPVWLGEFGTTLQ 288

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query414
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 2e-42
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 7e-33
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 7e-17
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 6e-16
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 2e-15
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 2e-15
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 2e-13
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 3e-13
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 1e-12
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 1e-12
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 4e-12
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 6e-12
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 6e-12
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 1e-11
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 2e-11
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 2e-11
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 7e-11
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 9e-11
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 4e-10
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 7e-10
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 3e-09
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 1e-08
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 1e-07
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 1e-07
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 6e-04
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
 Score =  152 bits (384), Expect = 2e-42
 Identities = 49/267 (18%), Positives = 85/267 (31%), Gaps = 39/267 (14%)

Query: 1   MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNEL 60
            +ILD H             +  +     +   WI  L  +A  + G   VVG  L NE 
Sbjct: 110 RIILDRHRPDCSG------QSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEP 163

Query: 61  RGP-----KQNVKDWYRYMQLGAEAVHAANPEVLVILSGLN--------FDKDLSFVRNQ 107
             P          DW    +    AV + NP +L+ + G+         +  +L      
Sbjct: 164 HDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQY 223

Query: 108 AVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQ-GWPLFVSE 166
            V L    +LV+ AH Y  +        +P      +     +  G+L  Q   P+++ E
Sbjct: 224 PVVLNVPNRLVYSAHDYATSVYPQTWFSDPTF-PNNMPGIWNKNWGYLFNQNIAPVWLGE 282

Query: 167 FGADLRGNNVNDNRYLNCF------FGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGL 220
           FG  L+     D  +L                 + W  W+               +  G+
Sbjct: 283 FGTTLQST--TDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGI 331

Query: 221 FDWNWCDIRNSSFLERISSLQSPFRGP 247
              +W  +        ++ ++S    P
Sbjct: 332 LKDDWQTVDT-VKDGYLAPIKSSIFDP 357
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Length = 364 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 100.0
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 100.0
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.97
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.97
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.97
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.97
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.96
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.96
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.96
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.96
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.96
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.96
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.96
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.96
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.95
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.95
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.95
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.95
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.95
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.95
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.95
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.94
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.94
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.93
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.92
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.92
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 99.9
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.87
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 99.86
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.77
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.76
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.67
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.66
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.64
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.57
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.56
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.47
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 99.29
3a07_A118 Actinohivin; carbohydrate-binding module family 13 99.2
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 98.99
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.97
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 98.96
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 98.79
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 98.76
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 98.72
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.72
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.68
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 98.65
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 98.65
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.62
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.61
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 98.57
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.56
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 98.54
4ekj_A500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 98.54
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 98.53
2w61_A555 GAS2P, glycolipid-anchored surface protein 2; glyc 98.51
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 98.5
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 98.49
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 98.49
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 98.49
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 98.44
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.43
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 98.43
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.41
3cmg_A667 Putative beta-galactosidase; structural genomics, 98.41
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 98.4
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.38
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 98.37
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 98.34
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 98.3
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 98.27
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 98.26
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.24
3fn9_A692 Putative beta-galactosidase; structural genomics, 98.18
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 98.14
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 98.12
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 98.12
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 98.1
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 98.09
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 98.06
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 98.04
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 97.97
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 97.96
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 97.95
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 97.9
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 97.89
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 97.89
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 97.86
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 97.86
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 97.81
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 97.79
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 97.72
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 97.7
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 97.69
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 97.68
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 97.68
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 97.67
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 97.59
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 97.53
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 97.53
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 97.52
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 97.51
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 97.5
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 97.48
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 97.42
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 97.4
4aw7_A591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 97.37
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 97.34
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 97.32
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 97.3
3phz_A286 Ricin B-related lectin; beta trefoil, saccharide b 97.27
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 97.1
3ef2_A293 Agglutinin, lectin; beta-trefoil, calcium-binding, 97.09
3vny_A488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 97.02
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 96.99
1qw9_A502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 96.96
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 96.9
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 96.81
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 96.78
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 96.71
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 96.69
2c7f_A513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 96.67
2je8_A848 Beta-mannosidase; glycoside hydrolase, hydrolase; 96.62
3ik2_A517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 96.15
3clw_A507 Conserved exported protein; structural genomics, u 96.05
3gm8_A801 Glycoside hydrolase family 2, candidate beta-GLYC; 95.94
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 95.62
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 95.62
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 95.54
2y2w_A574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 95.42
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 95.38
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 94.98
3ug3_A504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 94.62
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 94.34
3tp4_A475 Computational design of enzyme; structural genomic 94.24
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 94.2
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 93.67
2vrq_A496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 93.61
1odz_A386 Mannanase A; hydrolase, family 26, glycoside-hydro 93.42
2yih_A524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 93.39
3kzs_A463 Glycosyl hydrolase family 5; structural genomics, 92.82
2vx5_A396 Cellvibrio japonicus mannanase cjman26C; hydrolase 92.79
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 92.07
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 92.06
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 91.73
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 91.69
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 91.14
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 90.73
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 90.3
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 87.36
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 86.86
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 86.7
1xez_A721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 86.02
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 85.83
3d3a_A612 Beta-galactosidase; protein structure initiative I 84.98
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 84.51
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 84.29
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 83.13
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 81.64
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 80.86
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
Probab=100.00  E-value=1e-42  Score=361.26  Aligned_cols=225  Identities=22%  Similarity=0.362  Sum_probs=193.1

Q ss_pred             CEEEecCCCCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCceEEEEeccCCCCCCC----------------
Q 015062            1 MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPK----------------   64 (414)
Q Consensus         1 ~VILD~H~~~p~wcc~~~dgn~~w~d~~~~~d~~~~~W~~iA~ryk~~pnViG~dL~NEP~~~~----------------   64 (414)
                      |||||+|...+.    .  ..+.|.+..+++++|+++|++||+|||++|+|++|||+|||++..                
T Consensus       149 ~VIldlH~~~~~----~--~~~~W~~~~~~~~~~~~~w~~lA~ryk~~p~Vi~~eL~NEP~~~~~~~~~~~~~~~~~W~~  222 (458)
T 3qho_A          149 FVLLDYHRIGCT----H--IEPLWYTEDFSEEDFINTWIEVAKRFGKYWNVIGADLKNEPHSVTSPPAAYTDGTGATWGM  222 (458)
T ss_dssp             EEEEEEEESSSS----S--CCSSSCBTTBCHHHHHHHHHHHHHHHTTSTTEEEEECSSCCCCSSCTTGGGTSSSSCBSSS
T ss_pred             EEEEecccCCCc----c--CCCccCCchhhHHHHHHHHHHHHHHhCCCCCEEEEEccCCCCcccccccccccccccccCC
Confidence            699999987531    1  234565555789999999999999999999999999999999731                


Q ss_pred             -CChhhHHHHHHHHHHHHHhcCCCcEEEEcCccCCC-----------------cchhhhcccccccCCCcEEEEEeecCC
Q 015062           65 -QNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDK-----------------DLSFVRNQAVNLTFTGKLVFEAHWYGF  126 (414)
Q Consensus        65 -~n~~dW~~~~~~~~~aIr~~dP~~LIiVeG~~~~~-----------------dLs~v~~~Pv~l~~~~klVYs~H~Y~p  126 (414)
                       .+..+|+.++++++++||++||+++|||+|..|++                 +|+++++.|+.++ .+|+||++|+|++
T Consensus       223 ~~~~~~w~~~~~~ai~aIRa~dp~~lIiv~G~~w~~~~~~~~~~~~~~~wwg~~l~~v~~~Pi~l~-~~nlvYs~H~Y~~  301 (458)
T 3qho_A          223 GNPATDWNLAAERIGKAILKVAPHWLIFVEGTQFTNPKTDSSYKWGYNAWWGGNLMAVKDYPVNLP-RNKLVYSPHVFGP  301 (458)
T ss_dssp             SCTTTBHHHHHHHHHHHHHHHCTTCEEEECCBSCCCHHHHHTSTTTTCCCTTCBCGGGTTSCCCSC-TTTEEECCBCCCT
T ss_pred             CCcHHHHHHHHHHHHHHHHHhCCCCEEEEcCCcccCccccccccccccCcCCCCchhhhcCCCcCC-CCCEEEEEEECCC
Confidence             12468999999999999999999999999999876                 9999999999876 6899999999999


Q ss_pred             CCC-CCccCCCCCcchhhHHHHHHHHHHHHH-hcCCCEEEeccCcCCC-CCCccchHHHHHHHHHHHHCCC-cEEEeccC
Q 015062          127 TDG-QAWVDGNPNQVCGRVVDNVMRLSGFLL-EQGWPLFVSEFGADLR-GNNVNDNRYLNCFFGVAAELDW-DWALWTLV  202 (414)
Q Consensus       127 ~~~-~~W~~~~~~~~~~~~~~~~~~~~gfl~-~~g~Pv~lGEFG~~~~-~~~~~~~~~~~~~l~~l~e~~i-~Wa~Wa~~  202 (414)
                      +++ ++|+.. .+.+|.++.+.|+++++|++ ++++||||||||+.+. +.+..+.+|++++++||++++| +|++|+++
T Consensus       302 ~~~~~~~~~~-~~~~~~~~~~~w~~~~g~l~~~~~~Pl~igEfG~~~~~g~~~~~~~w~~~~~~yl~~~~i~~w~~W~~n  380 (458)
T 3qho_A          302 DVYNQPYFGP-AKGFPDNLPDIWYHHFGYVKLELGYSVVIGEFGGKYGHGGDPRDVIWQNKLVDWMIENKFCDFFYWSWN  380 (458)
T ss_dssp             TTCCCGGGSG-GGTTTTTHHHHHHHHTTHHHHTTCCCBCBCBCCCCTTSSSCTHHHHHHHHHHHHHHHTTCCCEEESCSS
T ss_pred             CCCCCccccC-ccchHHHHHHHHHhhhhhHhhcCCCcEEEEecCCCcCCCCCcchHHHHHHHHHHHHhcCCCCEEEEecC
Confidence            985 678742 23577889999999999997 5999999999999885 3444568999999999999998 89999999


Q ss_pred             ccccccccccCCCceeecccCCCCCCCchhHHHHhhcccCCCCC
Q 015062          203 GSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRG  246 (414)
Q Consensus       203 Gsyy~r~g~~~~~et~Gll~~dW~t~~~~~~l~~l~~l~~~~~~  246 (414)
                               ++++||+|||++||++++++    ++++|++.+..
T Consensus       381 ---------p~s~dt~Gll~~dW~t~~~~----k~~~l~~~~~~  411 (458)
T 3qho_A          381 ---------PDSGDTGGILQDDWTTIWED----KYNNLKRLMDS  411 (458)
T ss_dssp             ---------SCCTTTCCSBCTTSSSBCHH----HHHHHGGGGC-
T ss_pred             ---------CCCCCCCcccccccCCcChH----HHHHHHHHhcc
Confidence                     78899999999999999998    77888877753
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3tp4_A Computational design of enzyme; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.98A {Synthetic construct} PDB: 2x2y_A 2bvy_A 2bvt_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>1odz_A Mannanase A; hydrolase, family 26, glycoside-hydrolase, glycosynthase, manno-oligosaccharide; HET: MAN BMA; 1.4A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1r7o_A* 2whm_A* 1j9y_A 1gvy_A* 1gw1_A* Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vx5_A Cellvibrio japonicus mannanase cjman26C; hydrolase; HET: BMA; 1.47A {Cellvibrio japonicus} PDB: 2vx4_A* 2vx6_A* 2vx7_A* Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 414
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 5e-21
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 4e-15
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 1e-13
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 3e-13
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 8e-13
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 2e-10
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 3e-10
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 2e-08
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 2e-08
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 5e-08
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 1e-05
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 2e-05
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 43/254 (16%), Positives = 77/254 (30%), Gaps = 31/254 (12%)

Query: 13  WCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPK-----QNV 67
                S  +  +     +   WI  L  +A  + G   VVG  L NE   P         
Sbjct: 116 HRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPS 175

Query: 68  KDWYRYMQLGAEAVHAANPEVLVILSGLNF--------DKDLSFVRNQAVNLTFTGKLVF 119
            DW    +    AV + NP +L+ + G+            +L       V L    +LV+
Sbjct: 176 IDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVY 235

Query: 120 EAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDN 179
            AH Y  +        +P                   +   P+++ EFG  L+     D 
Sbjct: 236 SAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQST--TDQ 293

Query: 180 RYLNCF------FGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSF 233
            +L                 + W  W+               +  G+   +W  + ++  
Sbjct: 294 TWLKTLVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGILKDDWQTV-DTVK 343

Query: 234 LERISSLQSPFRGP 247
              ++ ++S    P
Sbjct: 344 DGYLAPIKSSIFDP 357
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query414
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 99.97
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.97
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 99.96
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 99.96
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 99.96
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.95
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.95
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.94
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.94
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.94
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.94
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 99.83
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.78
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 99.68
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.64
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.5
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.23
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.13
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 99.07
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.0
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 98.98
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.94
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.88
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.87
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 98.87
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 98.86
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 98.86
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 98.79
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 98.72
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.68
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.65
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.65
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.63
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.6
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 98.59
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.56
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.55
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 98.53
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.48
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.48
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 98.44
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 98.33
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.29
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.29
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 98.24
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 98.22
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.2
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.07
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.89
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 97.88
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 97.84
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 97.84
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.82
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 97.81
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.75
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.69
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.65
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 97.62
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.58
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 97.48
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 97.48
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 97.47
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 97.45
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 97.37
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.37
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 97.26
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 97.26
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 97.15
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 97.12
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.12
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.12
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.03
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 96.92
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 96.9
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 96.67
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 96.57
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 96.21
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 96.15
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 94.93
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 94.89
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 93.76
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 93.65
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 92.99
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 91.79
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 88.77
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 88.35
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 84.54
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 83.38
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 82.27
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 80.86
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

Probab=99.97  E-value=2.8e-31  Score=259.47  Aligned_cols=227  Identities=21%  Similarity=0.398  Sum_probs=171.3

Q ss_pred             CEEEecCCCCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCceEEEEeccCCCCCCC-----CChhhHHHHHH
Q 015062            1 MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPK-----QNVKDWYRYMQ   75 (414)
Q Consensus         1 ~VILD~H~~~p~wcc~~~dgn~~w~d~~~~~d~~~~~W~~iA~ryk~~pnViG~dL~NEP~~~~-----~n~~dW~~~~~   75 (414)
                      +||||+|...+.      ..+.+|.+.....+.|+++|+.||+||+++|+|++|||+|||+.+.     .....|+++++
T Consensus       110 ~Vildlh~~~~~------~~~~~~~~~~~~~~~~~~~~~~ia~~~~~~~~v~~~el~NEP~~~~~~~~~~~~~~~~~~~~  183 (358)
T d1ecea_         110 RIILDRHRPDCS------GQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAE  183 (358)
T ss_dssp             EEEEEEEESBTT------BCCSSSCCSSSCHHHHHHHHHHHHHHTTTCTTEEEEECSSCCCTTCBSSCCCTTTBHHHHHH
T ss_pred             ceeeeccccccc------CCCccccCChHHHHHHHHHHHHHHHhhcCccceEeeeeccccccCCcCCccchhhhHHHHHH
Confidence            599999966532      2345555555779999999999999999999999999999998762     13467999999


Q ss_pred             HHHHHHHhcCCCcEEEEcCccC--------CCcchhhhcccccccCCCcEEEEEeecCCCCCC-CccCCCCCcchhhHHH
Q 015062           76 LGAEAVHAANPEVLVILSGLNF--------DKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQ-AWVDGNPNQVCGRVVD  146 (414)
Q Consensus        76 ~~~~aIr~~dP~~LIiVeG~~~--------~~dLs~v~~~Pv~l~~~~klVYs~H~Y~p~~~~-~W~~~~~~~~~~~~~~  146 (414)
                      +++++||++||+++|+|+|..+        +.++......++.+...+++||++|.|.+.... .+...  ...+..+..
T Consensus       184 ~~~~~Ir~~d~~~~v~v~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~H~Y~~~~~~~~~~~~--~~~~~~~~~  261 (358)
T d1ecea_         184 RAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSD--PTFPNNMPG  261 (358)
T ss_dssp             HHHHHHHHHCTTSEEEEECBSEETTEECSTTTBCTTTTTSCCCCSSSSCEEEEEECCCTTTCCCGGGSC--TTTTTTHHH
T ss_pred             HHHHHHHhhCCCcEEEEeccccCccccccccccccchhhCCccCCccCceEEEeeecCCCcCCcccccc--chhhhhHHH
Confidence            9999999999999999998764        345566666666666678999999999887642 22111  123445556


Q ss_pred             HHHHHHHHHHh-cCCCEEEeccCcCCCCCCccchHHHHHHHHHHH------HCCCcEEEeccCccccccccccCCCceee
Q 015062          147 NVMRLSGFLLE-QGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAA------ELDWDWALWTLVGSYYLREGVIGLNEYYG  219 (414)
Q Consensus       147 ~~~~~~gfl~~-~g~Pv~lGEFG~~~~~~~~~~~~~~~~~l~~l~------e~~i~Wa~Wa~~Gsyy~r~g~~~~~et~G  219 (414)
                      .+.+.++++.. .++||+|||||....++  ...+|++++.++++      +.+++|+||+++         ++.++++|
T Consensus       262 ~~~~~~~~~~~~~~~Pv~igEfG~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~gw~~W~~k---------~~~~~~~G  330 (358)
T d1ecea_         262 IWNKNWGYLFNQNIAPVWLGEFGTTLQST--TDQTWLKTLVQYLRPTAQYGADSFQWTFWSWN---------PDSGDTGG  330 (358)
T ss_dssp             HHHHHTHHHHHTTSSCEEEEECCCCCCSH--HHHHHHHHHHHHTCCHHHHTTSSCEEEESCSC---------SCCTTTCC
T ss_pred             HHHHHHHHHHHhcCCeEEEecCCCCCCCC--ChHHHHHHHHHHHHHHHHhcccCceEEEEcCC---------CCCCCCcc
Confidence            66666665544 78999999999987643  23566676666553      678999999998         66788999


Q ss_pred             cccCCCCCCCchhHHHHhhcccCCCCCC
Q 015062          220 LFDWNWCDIRNSSFLERISSLQSPFRGP  247 (414)
Q Consensus       220 ll~~dW~t~~~~~~l~~l~~l~~~~~~p  247 (414)
                      ++.+||.+++.+ -...|+.++..+-+|
T Consensus       331 ~~~~dw~~~~~~-~~~~i~~~~~~~~~~  357 (358)
T d1ecea_         331 ILKDDWQTVDTV-KDGYLAPIKSSIFDP  357 (358)
T ss_dssp             SBCTTSSSBCHH-HHHHHGGGCCCCCCC
T ss_pred             eecCCCCCCChh-hhhhccccccccCCC
Confidence            999999999885 455666666655544
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure