Citrus Sinensis ID: 015072
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| 224142069 | 411 | sarcosine oxidase [Populus trichocarpa] | 0.985 | 0.990 | 0.789 | 0.0 | |
| 255589834 | 411 | sarcosine oxidase, putative [Ricinus com | 0.983 | 0.987 | 0.723 | 1e-178 | |
| 224121148 | 401 | sarcosine oxidase [Populus trichocarpa] | 0.963 | 0.992 | 0.738 | 1e-175 | |
| 297825429 | 415 | sarcosine oxidase family protein [Arabid | 0.992 | 0.987 | 0.692 | 1e-170 | |
| 15224169 | 416 | putative sarcosine oxidase [Arabidopsis | 0.992 | 0.985 | 0.678 | 1e-167 | |
| 225464346 | 431 | PREDICTED: probable sarcosine oxidase-li | 0.985 | 0.944 | 0.670 | 1e-166 | |
| 449437334 | 409 | PREDICTED: probable sarcosine oxidase-li | 0.983 | 0.992 | 0.643 | 1e-155 | |
| 357466531 | 390 | Sarcosine oxidase [Medicago truncatula] | 0.929 | 0.984 | 0.640 | 1e-150 | |
| 357466535 | 391 | Sarcosine oxidase [Medicago truncatula] | 0.944 | 0.997 | 0.621 | 1e-147 | |
| 388495658 | 391 | unknown [Medicago truncatula] | 0.944 | 0.997 | 0.619 | 1e-146 |
| >gi|224142069|ref|XP_002324381.1| sarcosine oxidase [Populus trichocarpa] gi|222865815|gb|EEF02946.1| sarcosine oxidase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 679 bits (1751), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 323/409 (78%), Positives = 363/409 (88%), Gaps = 2/409 (0%)
Query: 1 MEFSGENFDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYP 60
ME+S +FDVIVVGAGIMGSS AYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYP
Sbjct: 1 MEYSSHHFDVIVVGAGIMGSSTAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYP 60
Query: 61 EDYYHPMVLESSLLWEQAQSEIGYKVYFKAHQFDMGPSENKSLRSVIASCRKNSVPHQVL 120
EDYY MV+ESS WEQAQSEIGYKVYFKA QFDMGPS+NKSL SVI+SC + S+PHQVL
Sbjct: 61 EDYYCDMVMESSQSWEQAQSEIGYKVYFKAQQFDMGPSDNKSLLSVISSCERKSLPHQVL 120
Query: 121 DCRQVLQKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAIKNGAVLRDNTEVKTVL 180
D +QV ++SGRI IPE+WVGV TE+GGVIKPTKAVSMFQ LA + GAVLRDN EVK +
Sbjct: 121 DGQQVADRFSGRINIPESWVGVLTEVGGVIKPTKAVSMFQALAFQKGAVLRDNMEVKNI- 179
Query: 181 KVKDDVRGGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRIK 240
VKD+ RGGV VV ++GEE+WGKKCVVTAGAW+GKLVK +SGLELPIQA+ET+VCYWRIK
Sbjct: 180 -VKDEARGGVNVVVANGEEYWGKKCVVTAGAWMGKLVKTVSGLELPIQALETTVCYWRIK 238
Query: 241 EGDEADYAVGGDFPSFASYGDPHVYGTPSLEYPGLIKIALHRGYLCDPDRRPWGPGPLLD 300
EG EA +A+G DFP+FASYG+P++YGTPSLE+PGLIKIA+H GY CDPD+RPWGPG D
Sbjct: 239 EGHEAKFAIGSDFPTFASYGEPYIYGTPSLEFPGLIKIAVHGGYTCDPDKRPWGPGISSD 298
Query: 301 SLKELIQGRFAGRVDSSGPAATQLCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGFK 360
S+KE I+GRF+G VD GP ATQLCMYSMTPD DFVIDFLGGE G+DVVV GGFSGHGFK
Sbjct: 299 SMKEWIEGRFSGLVDYGGPVATQLCMYSMTPDGDFVIDFLGGEFGKDVVVGGGFSGHGFK 358
Query: 361 MAPVVGRILADLVLSGEAQGVELRHFRIARFKENPKGNVKDYEEQVSFS 409
MAPVVGRILADL LSGEA+GV+L+HFRI RF+ENPKGNVKDYE+QVS S
Sbjct: 359 MAPVVGRILADLALSGEAKGVDLKHFRIQRFQENPKGNVKDYEDQVSKS 407
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255589834|ref|XP_002535101.1| sarcosine oxidase, putative [Ricinus communis] gi|223524032|gb|EEF27281.1| sarcosine oxidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224121148|ref|XP_002330755.1| sarcosine oxidase [Populus trichocarpa] gi|222872557|gb|EEF09688.1| sarcosine oxidase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297825429|ref|XP_002880597.1| sarcosine oxidase family protein [Arabidopsis lyrata subsp. lyrata] gi|297326436|gb|EFH56856.1| sarcosine oxidase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15224169|ref|NP_180034.1| putative sarcosine oxidase [Arabidopsis thaliana] gi|20139956|sp|Q9SJA7.1|SOX_ARATH RecName: Full=Probable sarcosine oxidase gi|4572673|gb|AAD23888.1| putative sarcosine oxidase [Arabidopsis thaliana] gi|17529040|gb|AAL38730.1| putative sarcosine oxidase [Arabidopsis thaliana] gi|21436151|gb|AAM51322.1| putative sarcosine oxidase [Arabidopsis thaliana] gi|46251338|gb|AAS84616.1| peroxisomal sarcosine/pipecolate oxidase [Arabidopsis thaliana] gi|110742357|dbj|BAE99101.1| putative sarcosine oxidase [Arabidopsis thaliana] gi|330252500|gb|AEC07594.1| putative sarcosine oxidase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225464346|ref|XP_002272090.1| PREDICTED: probable sarcosine oxidase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449437334|ref|XP_004136447.1| PREDICTED: probable sarcosine oxidase-like [Cucumis sativus] gi|449515559|ref|XP_004164816.1| PREDICTED: probable sarcosine oxidase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357466531|ref|XP_003603550.1| Sarcosine oxidase [Medicago truncatula] gi|355492598|gb|AES73801.1| Sarcosine oxidase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357466535|ref|XP_003603552.1| Sarcosine oxidase [Medicago truncatula] gi|355492600|gb|AES73803.1| Sarcosine oxidase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388495658|gb|AFK35895.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| TAIR|locus:2046643 | 416 | AT2G24580 [Arabidopsis thalian | 0.992 | 0.985 | 0.666 | 3.1e-154 | |
| UNIPROTKB|F1RN92 | 392 | PIPOX "Uncharacterized protein | 0.920 | 0.969 | 0.359 | 2.7e-61 | |
| ZFIN|ZDB-GENE-110627-2 | 415 | pipox "pipecolic acid oxidase" | 0.927 | 0.922 | 0.355 | 1.5e-60 | |
| UNIPROTKB|Q29RU9 | 392 | PIPOX "Peroxisomal sarcosine o | 0.920 | 0.969 | 0.356 | 3.5e-59 | |
| UNIPROTKB|Q9P0Z9 | 390 | PIPOX "Peroxisomal sarcosine o | 0.912 | 0.966 | 0.351 | 3.2e-58 | |
| UNIPROTKB|P79371 | 390 | PIPOX "Peroxisomal sarcosine o | 0.912 | 0.966 | 0.346 | 2.2e-57 | |
| RGD|1311347 | 390 | Pipox "pipecolic acid oxidase" | 0.912 | 0.966 | 0.331 | 1.6e-54 | |
| MGI|MGI:1197006 | 390 | Pipox "pipecolic acid oxidase" | 0.912 | 0.966 | 0.339 | 2.1e-54 | |
| UNIPROTKB|E2R6W0 | 392 | PIPOX "Uncharacterized protein | 0.893 | 0.941 | 0.335 | 8e-53 | |
| WB|WBGene00015788 | 385 | C15B12.8 [Caenorhabditis elega | 0.915 | 0.981 | 0.288 | 6.8e-40 |
| TAIR|locus:2046643 AT2G24580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1504 (534.5 bits), Expect = 3.1e-154, P = 3.1e-154
Identities = 276/414 (66%), Positives = 334/414 (80%)
Query: 1 MEFSGEN-FDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATY 59
ME+S + FDVIVVGAG+MGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATY
Sbjct: 1 MEYSDDGRFDVIVVGAGVMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATY 60
Query: 60 PEDYYHPMVLESSLLWEQAQSEIGYKVYFKAHQFDMGPSENKSLRSVIASCRKNSVPHQV 119
PEDYY+ MV ES+ LW AQSEIGYKV+F QFDMGP++ +SL SV+A+C+K+ + H+V
Sbjct: 61 PEDYYYSMVSESTRLWAAAQSEIGYKVHFPTQQFDMGPADQQSLLSVVATCQKHGLAHRV 120
Query: 120 LDCRQVLQKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAIKNGAVLRDNTEVKTV 179
+D V + +SGRI IPENW+GV+TELGG+IKPTKAVSMFQTLAI +GA+LRDNT+V +
Sbjct: 121 MDSHAVSEHFSGRISIPENWIGVSTELGGIIKPTKAVSMFQTLAIGHGAILRDNTKVANI 180
Query: 180 LXXXXXXXXXXXXXXXXGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRI 239
G++F+GKKC+VTAGAW+ KLVK ++G++ P++ +ET+VCYWRI
Sbjct: 181 -KRDGESGEGVIVCTVKGDKFYGKKCIVTAGAWISKLVKTVAGIDFPVEPLETTVCYWRI 239
Query: 240 KEGDEADYAVGGDFPSFASYGDPHVYGTPSLEYPGLIKIALHRGYLCDPDRRPWGPGPLL 299
KEG E + + G+FP+FASYG P+VYGTPSLEYPGLIK+A+H GY CDPD+RPWGPG L
Sbjct: 240 KEGHEEKFTIDGEFPTFASYGAPYVYGTPSLEYPGLIKVAVHGGYWCDPDKRPWGPGVKL 299
Query: 300 DSLKELIQGRFAGRVDSSGPAATQLCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGF 359
+ LKE I+ RF G VDS GP ATQLCMYSMTPD+DFVIDFLGGE G DVVV GGFSGHGF
Sbjct: 300 EELKEWIKERFGGMVDSEGPVATQLCMYSMTPDEDFVIDFLGGEFGRDVVVGGGFSGHGF 359
Query: 360 KMAPVVGRILADLVLSGEAQG--VELRHFRIARFKENPKGNVKDYEEQVSFSVP 411
KMAP VGRILAD+ + EA G VE++ F + RF++NPKGN K+Y +QV VP
Sbjct: 360 KMAPAVGRILADMAMEVEAGGGGVEMKQFSLRRFEDNPKGNAKEYPDQVILDVP 413
|
|
| UNIPROTKB|F1RN92 PIPOX "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-110627-2 pipox "pipecolic acid oxidase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29RU9 PIPOX "Peroxisomal sarcosine oxidase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P0Z9 PIPOX "Peroxisomal sarcosine oxidase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P79371 PIPOX "Peroxisomal sarcosine oxidase" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
| RGD|1311347 Pipox "pipecolic acid oxidase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1197006 Pipox "pipecolic acid oxidase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6W0 PIPOX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015788 C15B12.8 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| TIGR01377 | 380 | TIGR01377, soxA_mon, sarcosine oxidase, monomeric | 1e-169 | |
| PRK11259 | 376 | PRK11259, solA, N-methyltryptophan oxidase; Provis | 2e-89 | |
| COG0665 | 387 | COG0665, DadA, Glycine/D-amino acid oxidases (deam | 3e-37 | |
| pfam01266 | 234 | pfam01266, DAO, FAD dependent oxidoreductase | 3e-28 | |
| COG0579 | 429 | COG0579, COG0579, Predicted dehydrogenase [General | 5e-13 | |
| COG0578 | 532 | COG0578, GlpA, Glycerol-3-phosphate dehydrogenase | 2e-09 | |
| COG0644 | 396 | COG0644, FixC, Dehydrogenases (flavoproteins) [Ene | 9e-08 | |
| TIGR02032 | 295 | TIGR02032, GG-red-SF, geranylgeranyl reductase fam | 2e-06 | |
| pfam12831 | 415 | pfam12831, FAD_oxidored, FAD dependent oxidoreduct | 3e-06 | |
| pfam01134 | 391 | pfam01134, GIDA, Glucose inhibited division protei | 6e-06 | |
| COG0445 | 621 | COG0445, GidA, Flavin-dependent tRNA uridine 5-car | 1e-05 | |
| PRK12834 | 549 | PRK12834, PRK12834, putative FAD-binding dehydroge | 1e-05 | |
| pfam13450 | 66 | pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- | 4e-05 | |
| PRK05192 | 618 | PRK05192, PRK05192, tRNA uridine 5-carboxymethylam | 4e-05 | |
| PRK04176 | 257 | PRK04176, PRK04176, ribulose-1,5-biphosphate synth | 5e-05 | |
| COG1635 | 262 | COG1635, THI4, Ribulose 1,5-bisphosphate synthetas | 1e-04 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 1e-04 | |
| pfam00890 | 401 | pfam00890, FAD_binding_2, FAD binding domain | 1e-04 | |
| TIGR01373 | 407 | TIGR01373, soxB, sarcosine oxidase, beta subunit f | 1e-04 | |
| COG1233 | 487 | COG1233, COG1233, Phytoene dehydrogenase and relat | 2e-04 | |
| PTZ00367 | 567 | PTZ00367, PTZ00367, squalene epoxidase; Provisiona | 3e-04 | |
| PRK05335 | 436 | PRK05335, PRK05335, tRNA (uracil-5-)-methyltransfe | 3e-04 | |
| pfam01946 | 229 | pfam01946, Thi4, Thi4 family | 3e-04 | |
| COG1206 | 439 | COG1206, Gid, NAD(FAD)-utilizing enzyme possibly i | 3e-04 | |
| PRK07608 | 388 | PRK07608, PRK07608, ubiquinone biosynthesis hydrox | 4e-04 | |
| COG0562 | 374 | COG0562, Glf, UDP-galactopyranose mutase [Cell env | 5e-04 | |
| COG3573 | 552 | COG3573, COG3573, Predicted oxidoreductase [Genera | 7e-04 | |
| COG1053 | 562 | COG1053, SdhA, Succinate dehydrogenase/fumarate re | 8e-04 | |
| PRK10015 | 429 | PRK10015, PRK10015, oxidoreductase; Provisional | 8e-04 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 8e-04 | |
| TIGR02730 | 493 | TIGR02730, carot_isom, carotene isomerase | 0.001 | |
| COG1249 | 454 | COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas | 0.001 | |
| PRK01747 | 662 | PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- | 0.001 | |
| TIGR03378 | 419 | TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate d | 0.001 | |
| TIGR00292 | 254 | TIGR00292, TIGR00292, thiazole biosynthesis enzyme | 0.001 | |
| COG2303 | 542 | COG2303, BetA, Choline dehydrogenase and related f | 0.002 | |
| COG2081 | 408 | COG2081, COG2081, Predicted flavoproteins [General | 0.002 | |
| PLN02985 | 514 | PLN02985, PLN02985, squalene monooxygenase | 0.002 | |
| TIGR00136 | 617 | TIGR00136, gidA, glucose-inhibited division protei | 0.003 | |
| PRK10157 | 428 | PRK10157, PRK10157, putative oxidoreductase FixC; | 0.003 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 0.003 | |
| TIGR01350 | 460 | TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog | 0.003 | |
| PRK05329 | 422 | PRK05329, PRK05329, anaerobic glycerol-3-phosphate | 0.003 | |
| TIGR03364 | 365 | TIGR03364, HpnW_proposed, FAD dependent oxidoreduc | 0.004 |
| >gnl|CDD|130444 TIGR01377, soxA_mon, sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
Score = 477 bits (1230), Expect = e-169
Identities = 167/394 (42%), Positives = 233/394 (59%), Gaps = 18/394 (4%)
Query: 8 FDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPEDYYHPM 67
FDVIVVGAGIMG AAY LAK G+KTLLLEQFD H RGSSHG+SR IR YPED+Y PM
Sbjct: 1 FDVIVVGAGIMGCFAAYHLAKHGKKTLLLEQFDLPHSRGSSHGQSRIIRKAYPEDFYTPM 60
Query: 68 VLESSLLWEQAQSEIGYKVYFKAHQFDMGPSENKSLRSVIASCRKNSVPHQVLDCRQVLQ 127
+LE LW Q + E G K++ + +GP EN+ L+++ A+ ++ + H++L +Q+ Q
Sbjct: 61 MLECYQLWAQLEKEAGTKLHRQTGLLLLGPKENQFLKTIQATLSRHGLEHELLSSKQLKQ 120
Query: 128 KYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAIKNGAVLRDNTEVKTVLKVKDDVR 187
++ I +P N VG+ GGV+ KA+ Q LA +GA +RD T+V + +
Sbjct: 121 RFP-NIRVPRNEVGLLDPNGGVLYAEKALRALQELAEAHGATVRDGTKVVEI-----EPT 174
Query: 188 GGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRIKEGDEADY 247
+ V ++ + K VVTAGAW KL+ + G+E+P+Q + +VCYWR KE Y
Sbjct: 175 ELLVTVKTTKGSYQANKLVVTAGAWTSKLLSPL-GIEIPLQPLRINVCYWREKEPGS--Y 231
Query: 248 AVGGDFPSFASYG-DPHVYGTPSLEYPGLIKIALHRGYLCDPDRRPWGPGPL---LDSLK 303
V FP F G +PH+YG PS EYPGL+K+ H G DPD R G + L+
Sbjct: 232 GVSQAFPCFLVLGLNPHIYGLPSFEYPGLMKVYYHHGQQIDPDERDCPFGADIEDVQILR 291
Query: 304 ELIQGRFAGRVDSSGPAATQLCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGFKMAP 363
+ ++ G P ++CMY+ TPD+ FVID ++VV+ GFSGHGFK+AP
Sbjct: 292 KFVRDHLPGLN--GEPKKGEVCMYTNTPDEHFVIDLHPKY--DNVVIGAGFSGHGFKLAP 347
Query: 364 VVGRILADLVLSGEAQGVELRHFRIARFKENPKG 397
VVG+ILA+L + + +L F + RF K
Sbjct: 348 VVGKILAELAMKLKP-SYDLAIFSLNRFALKKKA 380
|
Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines]. Length = 380 |
| >gnl|CDD|236887 PRK11259, solA, N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A | Back alignment and domain information |
|---|
| >gnl|CDD|223522 COG0445, GidA, Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|235362 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233383 TIGR01373, soxB, sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235416 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|145231 pfam01946, Thi4, Thi4 family | Back alignment and domain information |
|---|
| >gnl|CDD|224127 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|182194 PRK10015, PRK10015, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213807 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178566 PLN02985, PLN02985, squalene monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|129242 TIGR00136, gidA, glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >gnl|CDD|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 100.0 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 100.0 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 100.0 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 100.0 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 100.0 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 100.0 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 100.0 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 100.0 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 100.0 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 100.0 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 100.0 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 100.0 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 100.0 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 100.0 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 100.0 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 100.0 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 100.0 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 99.97 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 99.97 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 99.97 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 99.97 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 99.97 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 99.95 | |
| TIGR03377 | 516 | glycerol3P_GlpA glycerol-3-phosphate dehydrogenase | 99.94 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 99.93 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 99.93 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 99.93 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 99.92 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 99.9 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 99.87 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 99.81 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 99.77 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 99.75 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.71 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 99.7 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 99.69 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 99.69 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 99.68 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 99.68 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 99.68 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 99.68 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 99.67 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 99.67 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.66 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 99.66 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 99.65 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 99.65 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 99.65 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.65 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 99.64 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 99.64 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 99.63 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 99.62 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.6 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 99.6 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 99.6 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 99.6 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 99.6 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 99.59 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.59 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 99.58 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 99.58 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 99.57 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 99.57 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 99.57 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 99.56 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 99.56 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 99.54 | |
| PLN02463 | 447 | lycopene beta cyclase | 99.54 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 99.53 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 99.53 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 99.52 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 99.51 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.51 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 99.51 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 99.51 | |
| PRK05868 | 372 | hypothetical protein; Validated | 99.5 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 99.5 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.5 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 99.49 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 99.48 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 99.48 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 99.47 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.45 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.45 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 99.43 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 99.43 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 99.42 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 99.41 | |
| PRK07121 | 492 | hypothetical protein; Validated | 99.39 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 99.39 | |
| PLN02985 | 514 | squalene monooxygenase | 99.38 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.38 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 99.38 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 99.38 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.38 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 99.37 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.35 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.35 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 99.35 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 99.34 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 99.34 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 99.34 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.34 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 99.34 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 99.34 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 99.33 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 99.33 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 99.32 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.31 | |
| PLN02612 | 567 | phytoene desaturase | 99.31 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 99.31 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 99.31 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 99.31 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.31 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.3 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 99.3 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 99.3 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 99.3 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.3 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.3 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 99.29 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 99.29 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 99.28 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 99.28 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 99.28 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.28 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.27 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 99.27 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.27 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 99.26 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.25 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 99.25 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.25 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 99.25 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 99.25 | |
| PLN02487 | 569 | zeta-carotene desaturase | 99.24 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.24 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.23 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 99.23 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 99.22 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.22 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 99.21 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 99.21 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 99.21 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 99.21 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 99.2 | |
| PLN02815 | 594 | L-aspartate oxidase | 99.2 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 99.2 | |
| PRK06116 | 450 | glutathione reductase; Validated | 99.2 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 99.19 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 99.19 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 99.18 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 99.18 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 99.17 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 99.17 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 99.17 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 99.16 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.15 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.15 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 99.15 | |
| PRK06370 | 463 | mercuric reductase; Validated | 99.15 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.14 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.14 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 99.14 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.13 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 99.13 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 99.13 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 99.12 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 99.12 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 99.12 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 99.12 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.1 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 99.09 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 99.09 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 99.09 | |
| PLN02268 | 435 | probable polyamine oxidase | 99.09 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 99.08 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 99.08 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 99.08 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 99.08 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.07 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 99.07 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 99.07 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 99.07 | |
| PLN02661 | 357 | Putative thiazole synthesis | 99.07 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 99.07 | |
| PLN02676 | 487 | polyamine oxidase | 99.07 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 99.06 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 99.06 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 99.06 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 99.05 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 99.05 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 99.03 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 99.02 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 99.02 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 99.02 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 99.02 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 99.02 | |
| PLN02507 | 499 | glutathione reductase | 99.01 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 99.01 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 99.0 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 99.0 | |
| PLN02568 | 539 | polyamine oxidase | 99.0 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 98.99 | |
| PLN02546 | 558 | glutathione reductase | 98.99 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.98 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 98.97 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 98.97 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 98.97 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 98.96 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 98.95 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 98.95 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.95 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 98.93 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 98.93 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 98.93 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 98.92 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 98.91 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 98.91 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 98.9 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 98.89 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 98.89 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 98.88 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 98.86 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 98.83 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 98.8 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 98.79 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 98.79 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 98.78 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 98.77 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 98.76 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 98.76 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 98.75 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 98.74 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 98.74 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 98.72 | |
| PLN03000 | 881 | amine oxidase | 98.71 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 98.7 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 98.66 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 98.65 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 98.63 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 98.6 | |
| PLN02785 | 587 | Protein HOTHEAD | 98.6 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 98.58 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 98.58 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 98.58 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 98.55 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 98.54 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 98.53 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 98.53 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 98.52 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 98.52 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 98.5 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 98.49 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 98.48 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 98.46 | |
| PLN02976 | 1713 | amine oxidase | 98.44 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 98.42 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 98.4 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 98.39 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 98.37 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 98.37 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 98.35 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 98.34 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 98.33 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 98.32 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 98.32 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 98.29 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 98.29 | |
| PLN02507 | 499 | glutathione reductase | 98.29 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 98.28 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 98.27 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 98.27 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 98.27 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 98.26 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 98.24 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 98.24 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 98.24 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 98.24 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 98.23 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 98.2 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 98.18 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 98.18 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 98.17 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.14 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 98.13 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 98.1 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 98.09 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 98.08 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 98.06 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.03 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 98.02 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 98.01 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 98.01 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.97 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 97.96 | |
| PLN02546 | 558 | glutathione reductase | 97.91 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 97.9 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 97.9 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 97.9 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 97.89 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 97.87 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 97.86 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 97.84 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 97.84 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.84 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 97.83 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 97.75 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 97.74 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 97.73 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 97.7 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 97.7 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 97.67 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 97.65 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.64 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 97.64 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 97.63 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 97.59 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 97.59 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 97.57 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.5 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 97.47 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 97.46 | |
| TIGR01816 | 565 | sdhA_forward succinate dehydrogenase, flavoprotein | 97.43 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.42 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 97.42 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 97.38 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 97.36 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.32 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 97.27 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 97.25 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 97.21 | |
| KOG3851 | 446 | consensus Sulfide:quinone oxidoreductase/flavo-bin | 97.21 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 97.2 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 97.07 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 97.06 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 97.02 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 96.9 | |
| KOG1439 | 440 | consensus RAB proteins geranylgeranyltransferase c | 96.89 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 96.66 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 96.63 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 96.52 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 96.48 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.48 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 96.44 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 96.44 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 96.41 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 96.3 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 96.3 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 96.24 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.19 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 96.15 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 96.13 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 96.07 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 96.04 | |
| COG1251 | 793 | NirB NAD(P)H-nitrite reductase [Energy production | 95.96 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.96 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 95.93 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 95.93 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 95.86 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 95.85 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 95.81 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.74 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.63 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 95.59 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 95.56 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.55 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.54 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 95.51 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 95.42 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 95.42 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 95.4 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 95.31 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 95.31 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.26 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 95.25 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 95.25 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 95.24 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 95.21 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 95.21 | |
| PRK06370 | 463 | mercuric reductase; Validated | 95.21 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.19 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.17 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 95.16 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 95.15 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 95.13 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.1 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 95.06 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 95.06 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.04 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 95.03 | |
| KOG2755 | 334 | consensus Oxidoreductase [General function predict | 95.0 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 94.96 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 94.94 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 94.91 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 94.9 | |
| KOG2304 | 298 | consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t | 94.9 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 94.86 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 94.85 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 94.68 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 94.68 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 94.62 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 94.61 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 94.53 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.52 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 94.5 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 94.49 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 94.47 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 94.44 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 94.41 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.4 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 94.36 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 94.36 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 94.36 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 94.35 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 94.35 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 94.24 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 94.2 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 94.15 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 94.14 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 94.13 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 94.13 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 94.1 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 94.06 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 94.06 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 93.99 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 93.94 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 93.92 | |
| PRK06116 | 450 | glutathione reductase; Validated | 93.91 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 93.89 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 93.88 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 93.87 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 93.87 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 93.81 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 93.81 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 93.75 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 93.73 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 93.73 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 93.71 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 93.7 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 93.69 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 93.67 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 93.67 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 93.65 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 93.61 | |
| KOG2403 | 642 | consensus Succinate dehydrogenase, flavoprotein su | 93.61 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 93.6 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 93.58 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 93.58 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 93.55 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 93.54 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 93.45 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 93.4 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 93.39 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 93.36 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 93.25 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 93.25 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 93.17 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 93.11 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 93.09 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 93.09 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 93.02 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 93.0 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 92.94 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.85 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 92.82 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.81 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 92.8 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 92.72 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 92.7 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 92.68 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 92.67 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.64 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 92.59 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 92.52 | |
| KOG4405 | 547 | consensus GDP dissociation inhibitor [Signal trans | 92.45 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 92.3 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 92.29 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 92.26 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.25 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 92.25 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 92.24 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 92.22 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.2 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 92.18 | |
| PRK08223 | 287 | hypothetical protein; Validated | 92.17 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 92.15 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 92.13 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 92.08 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 92.08 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 92.06 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 92.0 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 91.93 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 91.86 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 91.85 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 91.84 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.82 | |
| PLN02602 | 350 | lactate dehydrogenase | 91.8 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 91.78 |
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-48 Score=366.19 Aligned_cols=375 Identities=45% Similarity=0.776 Sum_probs=299.0
Q ss_pred ccEEEECCCHHHHHHHHHHHHcCCcEEEEcccCCCCCCCCCCCCCcceecccCCccccchHHHHHHHHHHHHHhcCCeeE
Q 015072 8 FDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPEDYYHPMVLESSLLWEQAQSEIGYKVY 87 (413)
Q Consensus 8 ~dvvIIGgG~aG~~~A~~L~~~g~~V~lvE~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 87 (413)
+||+|||||++|+++|++|+++|++|+|||+....++.+++....+.++..+....+.++..++.++|+++.+..+.+++
T Consensus 1 ~dvvIIGaGi~G~s~A~~La~~g~~V~l~e~~~~~~~~~ss~~~~~~~~~~~~~~~~~~l~~~s~~~~~~l~~~~~~~~~ 80 (380)
T TIGR01377 1 FDVIVVGAGIMGCFAAYHLAKHGKKTLLLEQFDLPHSRGSSHGQSRIIRKAYPEDFYTPMMLECYQLWAQLEKEAGTKLH 80 (380)
T ss_pred CcEEEECCCHHHHHHHHHHHHCCCeEEEEeccCCCCCCCCCCCCCeeeeeccCchhHhHHHHHHHHHHHHHHHHhCCeeE
Confidence 68999999999999999999999999999998765444555556666666666666678889999999999988887776
Q ss_pred eeeeeeeeCCCChHHHHHHHHHHHhCCCCccccCHHHHHHhcCCcccCCCCeEEEEecCCeeecHHHHHHHHHHHHHHcC
Q 015072 88 FKAHQFDMGPSENKSLRSVIASCRKNSVPHQVLDCRQVLQKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAIKNG 167 (413)
Q Consensus 88 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g 167 (413)
...+.+.+...+.+.++...+.++..+.+.++++.+++.+++|. ++......+++.+.+++++|..+++.|.+.+.+.|
T Consensus 81 ~~~G~l~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~e~~~~~P~-l~~~~~~~~~~~~~~g~i~p~~~~~~l~~~~~~~g 159 (380)
T TIGR01377 81 RQTGLLLLGPKENQFLKTIQATLSRHGLEHELLSSKQLKQRFPN-IRVPRNEVGLLDPNGGVLYAEKALRALQELAEAHG 159 (380)
T ss_pred eecCeEEEcCCCcHHHHHHHHHHHHcCCCeEEcCHHHHHHhCCC-CcCCCCceEEEcCCCcEEcHHHHHHHHHHHHHHcC
Confidence 67777776544445667777778888999999999999999998 66555667899999999999999999999999999
Q ss_pred CeEecCceEEEEEeeeccCCCcEEEEeCCccEEEeCeEEEcCCcChhhhhhhhcCCCcceeEEEEEEEEEEecCCCcccc
Q 015072 168 AVLRDNTEVKTVLKVKDDVRGGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRIKEGDEADY 247 (413)
Q Consensus 168 v~i~~~~~V~~i~~~~~~~~~~~~v~~~~g~~i~ad~vV~A~G~~~~~l~~~~~g~~~p~~~~~~~~~~~~~~~~~~~~~ 247 (413)
++++.+++|+++.. + ++.+.|.+++++ +.+|.||+|+|+|+..+.+.+ +..+|+.+.++++..++........+
T Consensus 160 ~~~~~~~~V~~i~~--~--~~~~~v~~~~~~-i~a~~vV~aaG~~~~~l~~~~-g~~~~~~~~~~~~~~~~~~~~~~~~~ 233 (380)
T TIGR01377 160 ATVRDGTKVVEIEP--T--ELLVTVKTTKGS-YQANKLVVTAGAWTSKLLSPL-GIEIPLQPLRINVCYWREKEPGSYGV 233 (380)
T ss_pred CEEECCCeEEEEEe--c--CCeEEEEeCCCE-EEeCEEEEecCcchHHHhhhc-ccCCCceEEEEEEEEEecCCccccCc
Confidence 99999999999988 6 455777777774 999999999999999888877 88899999999988887543221111
Q ss_pred ccCCCCceEEecCC-CeeEecCCCCCCCeEEEEeCCCCcCCCCCCCC---CCCcchHHHHHHHHhhcCCCCCCCCCceee
Q 015072 248 AVGGDFPSFASYGD-PHVYGTPSLEYPGLIKIALHRGYLCDPDRRPW---GPGPLLDSLKELIQGRFAGRVDSSGPAATQ 323 (413)
Q Consensus 248 ~~~~~~~~~~~~~~-~~~~~~p~~~~~g~~~~~~~~~~~~~~~~~~~---~~~~~~~~l~~~~~~~~p~~~~~~~~~~~~ 323 (413)
. ..+|.+...+. ..+|..|..+..+++.++...+...++....+ .....++.+.+.+.+++|.+.+. ....|
T Consensus 234 ~--~~~p~~~~~~~~~~~y~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~P~l~~~--~~~~~ 309 (380)
T TIGR01377 234 S--QAFPCFLVLGLNPHIYGLPSFEYPGLMKVYYHHGQQIDPDERDCPFGADIEDVQILRKFVRDHLPGLNGE--PKKGE 309 (380)
T ss_pred c--CCCCEEEEeCCCCceEecCCCCCCceEEEEeCCCCccCcccccCCCCCCHHHHHHHHHHHHHHCCCCCCC--cceee
Confidence 1 13566554432 35888888655566655543332223322222 11226888899999999999853 46779
Q ss_pred eeeeeccCCCCeEEecCCCCCCCCEEEEeCCCccccccchHHHHHHHHHHHcCCCCccccccccccccCCCCC
Q 015072 324 LCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGFKMAPVVGRILADLVLSGEAQGVELRHFRIARFKENPK 396 (413)
Q Consensus 324 ~g~~~~t~d~~p~ig~~~~~~~~~~~~~~G~~~~G~~~a~~~a~~~a~~i~~~~~~~~~~~~~~~~R~~~~~~ 396 (413)
.|++++|||+.|+||++|.. +|+|+++||+|+|+++||++|+++|++|.++++ ..++++|+|+||..+++
T Consensus 310 ~~~~~~t~D~~piIg~~p~~--~~l~va~G~~g~G~~~~p~~g~~la~li~~~~~-~~~~~~f~~~Rf~~~~~ 379 (380)
T TIGR01377 310 VCMYTNTPDEHFVIDLHPKY--DNVVIGAGFSGHGFKLAPVVGKILAELAMKLKP-SYDLAIFSLNRFALKKK 379 (380)
T ss_pred EEEeccCCCCCeeeecCCCC--CCEEEEecCCccceeccHHHHHHHHHHHhcCCC-CCCccccChhhcccCCC
Confidence 99999999999999999988 999999999999999999999999999996665 67899999999988764
|
Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms |
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >KOG2755 consensus Oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 413 | ||||
| 1zov_A | 386 | Crystal Structure Of Monomeric Sarcosine Oxidase Fr | 3e-43 | ||
| 1el5_A | 389 | Complex Of Monomeric Sarcosine Oxidase With The Inh | 3e-42 | ||
| 3m0o_A | 389 | Crystal Structure Of The Lys265met Mutant Of Monome | 5e-42 | ||
| 3m12_A | 389 | Crystal Structure Of The Lys265arg Phosphate-Crytsa | 5e-42 | ||
| 3bhf_A | 390 | Crystal Structure Of R49k Mutant Of Monomeric Sarco | 7e-42 | ||
| 1l9c_A | 389 | Role Of Histidine 269 In Catalysis By Monomeric Sar | 2e-41 | ||
| 1el9_A | 389 | Complex Of Monomeric Sarcosine Oxidase With The Inh | 9e-37 | ||
| 2uzz_A | 372 | X-Ray Structure Of N-Methyl-L-Tryptophan Oxidase (M | 1e-31 | ||
| 2oln_A | 397 | Nikd, An Unusual Amino Acid Oxidase Essential For N | 3e-09 | ||
| 3hzl_A | 397 | Tyr258phe Mutant Of Nikd, An Unusual Amino Acid Oxi | 3e-09 | ||
| 2q6u_A | 384 | Semet-Substituted Form Of Nikd Length = 384 | 2e-08 | ||
| 1y56_B | 382 | Crystal Structure Of L-Proline Dehydrogenase From P | 3e-07 | ||
| 3atq_A | 453 | Geranylgeranyl Reductase (Ggr) From Sulfolobus Acid | 6e-04 |
| >pdb|1ZOV|A Chain A, Crystal Structure Of Monomeric Sarcosine Oxidase From Bacillus Sp. Ns- 129 Length = 386 | Back alignment and structure |
|
| >pdb|1EL5|A Chain A, Complex Of Monomeric Sarcosine Oxidase With The Inhibitor Dimethylglycine Length = 389 | Back alignment and structure |
| >pdb|3M0O|A Chain A, Crystal Structure Of The Lys265met Mutant Of Monomeric Sarcosine Oxidase Length = 389 | Back alignment and structure |
| >pdb|3M12|A Chain A, Crystal Structure Of The Lys265arg Phosphate-Crytsallized Mu Monomeric Sarcosine Oxidase Length = 389 | Back alignment and structure |
| >pdb|3BHF|A Chain A, Crystal Structure Of R49k Mutant Of Monomeric Sarcosine Oxidase Crystallized In Peg As Precipitant Length = 390 | Back alignment and structure |
| >pdb|1L9C|A Chain A, Role Of Histidine 269 In Catalysis By Monomeric Sarcosine Oxidase Length = 389 | Back alignment and structure |
| >pdb|1EL9|A Chain A, Complex Of Monomeric Sarcosine Oxidase With The Inhibitor [methylthio]acetate Length = 389 | Back alignment and structure |
| >pdb|2UZZ|A Chain A, X-Ray Structure Of N-Methyl-L-Tryptophan Oxidase (Mtox) Length = 372 | Back alignment and structure |
| >pdb|2OLN|A Chain A, Nikd, An Unusual Amino Acid Oxidase Essential For Nikkomycin Biosynthesis: Closed Form At 1.15 A Resolution Length = 397 | Back alignment and structure |
| >pdb|3HZL|A Chain A, Tyr258phe Mutant Of Nikd, An Unusual Amino Acid Oxidase Essential For Nikkomycin Biosynthesis: Open Form At 1.55a Resolution Length = 397 | Back alignment and structure |
| >pdb|1Y56|B Chain B, Crystal Structure Of L-Proline Dehydrogenase From P.Horikoshii Length = 382 | Back alignment and structure |
| >pdb|3ATQ|A Chain A, Geranylgeranyl Reductase (Ggr) From Sulfolobus Acidocaldarius Length = 453 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 1e-121 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 1e-113 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 1e-109 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 8e-89 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 7e-40 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 1e-37 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 2e-35 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 2e-34 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 2e-32 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 2e-22 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 4e-10 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 4e-10 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 4e-10 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 4e-10 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 2e-09 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 2e-09 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 6e-09 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 9e-09 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 4e-08 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 8e-08 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 1e-07 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 4e-07 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 4e-07 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 4e-07 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 4e-07 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 5e-07 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 9e-07 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 1e-06 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 1e-06 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 2e-06 | |
| 3utf_A | 513 | UDP-galactopyranose mutase; nucleotide binding, fl | 2e-06 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 3e-06 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 4e-06 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 3e-06 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 4e-06 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 4e-06 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 4e-06 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 5e-06 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 6e-06 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 8e-06 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 8e-06 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 9e-06 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 1e-05 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 1e-05 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 1e-05 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 1e-05 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 2e-05 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 2e-05 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 2e-05 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 2e-05 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 4e-05 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 7e-05 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 8e-05 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 8e-05 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 1e-04 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 1e-04 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 1e-04 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 2e-04 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 2e-04 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 2e-04 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 3e-04 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 3e-04 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 3e-04 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 4e-04 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 5e-04 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 5e-04 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 5e-04 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 5e-04 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 6e-04 |
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 | Back alignment and structure |
|---|
Score = 357 bits (917), Expect = e-121
Identities = 123/394 (31%), Positives = 195/394 (49%), Gaps = 21/394 (5%)
Query: 6 ENFDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPED-YY 64
+FDVIVVGAG MG +A YQLAK+G KTLL++ FD H GS HG++R IR Y E Y
Sbjct: 2 THFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREY 61
Query: 65 HPMVLESSLLWEQAQSEIGYKVYFKAHQFDMGPSENKS-LRSVIASCRKNSVPHQVLDCR 123
P+ L S LW + + E +K++ K GP + + + + +++S+ +L+
Sbjct: 62 VPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGD 121
Query: 124 QVLQKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAIKNGAVLRDNTEVKTVLKVK 183
++ +++ G I +PEN+ + GV+ + ++ LA GA + +T V+
Sbjct: 122 EINKRWPG-ITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISP 180
Query: 184 DDVRGGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRIKEGD 243
D V + T++G + K +V+ GAW KL+ K+ L++P+Q V ++ E
Sbjct: 181 D----SVKIETANG-SYTADKLIVSMGAWNSKLLSKL-NLDIPLQPYRQVVGFFESDES- 233
Query: 244 EADYAVGGDFPSF-ASYGDPHVYGTPSLEYPGLIKIALHRGYLCDPDRRPWGPGPL---L 299
Y+ DFP F + YG PS GL G DPD G
Sbjct: 234 --KYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDE 291
Query: 300 DSLKELIQGRFAGRVDSSGPAATQLCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGF 359
+L+ ++ G + +CMY+ T D+ F+ID +VV+A GFSGHGF
Sbjct: 292 SNLRAFLEEYMPGA--NGELKRGAVCMYTKTLDEHFIIDLHPEH--SNVVIAAGFSGHGF 347
Query: 360 KMAPVVGRILADLVLSGEAQGVELRHFRIARFKE 393
K + VG +L+ L L+G+ + ++ F I R
Sbjct: 348 KFSSGVGEVLSQLALTGKTE-HDISIFSINRPAL 380
|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Length = 676 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Length = 689 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Length = 443 | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Length = 637 | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Length = 232 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Length = 561 | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Length = 641 | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Length = 571 | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Length = 501 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Length = 651 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 100.0 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 100.0 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 100.0 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 100.0 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 100.0 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 100.0 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 100.0 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 100.0 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 100.0 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 100.0 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 100.0 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 100.0 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 100.0 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 100.0 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 100.0 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 100.0 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 99.98 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 99.97 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 99.96 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 99.78 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 99.78 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 99.76 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 99.74 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 99.71 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 99.71 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.71 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.71 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 99.71 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 99.69 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 99.69 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 99.68 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 99.67 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.64 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 99.64 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.64 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 99.63 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 99.61 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 99.59 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 99.59 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 99.59 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 99.58 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 99.57 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 99.54 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 99.54 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.54 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 99.53 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 99.53 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 99.52 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 99.51 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.51 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.51 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 99.48 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 99.46 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 99.46 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 99.46 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 99.45 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 99.45 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.45 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 99.44 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 99.42 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 99.41 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 99.41 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 99.41 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 99.4 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 99.4 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.39 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 99.38 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 99.36 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 99.34 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 99.33 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 99.32 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 99.32 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 99.32 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 99.31 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 99.31 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 99.3 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 99.3 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 99.3 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 99.3 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 99.29 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 99.29 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 99.28 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 99.28 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 99.27 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 99.27 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 99.27 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.27 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 99.27 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 99.26 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 99.26 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 99.26 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 99.26 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 99.26 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 99.23 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 99.23 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 99.22 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 99.22 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 99.22 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 99.21 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 99.2 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 99.19 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 99.18 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.18 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 99.18 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 99.18 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 99.17 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 99.17 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 99.16 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.15 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 99.15 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.15 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.15 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 99.13 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 99.13 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 99.13 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 99.13 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 99.12 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.12 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 99.12 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 99.12 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 99.12 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 99.09 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 99.08 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 99.08 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 99.08 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 99.07 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 99.06 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 99.06 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 99.06 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 99.05 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 99.05 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 99.05 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 99.05 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 99.04 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 99.03 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 99.03 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 99.02 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 99.0 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 99.0 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 99.0 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 98.99 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 98.99 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 98.99 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 98.98 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 98.97 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 98.97 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 98.97 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 98.95 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 98.95 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 98.92 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 98.92 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 98.92 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 98.92 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 98.91 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 98.9 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 98.9 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 98.88 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.88 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 98.87 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.87 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 98.86 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 98.86 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 98.85 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 98.85 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 98.84 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 98.84 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 98.83 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 98.81 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 98.81 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 98.8 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 98.8 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 98.77 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 98.77 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 98.76 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 98.75 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 98.74 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 98.73 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 98.72 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 98.7 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 98.7 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 98.69 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 98.69 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.67 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 98.66 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 98.61 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 98.6 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 98.6 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 98.58 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 98.58 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 98.58 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 98.55 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 98.54 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 98.54 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 98.53 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 98.5 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 98.5 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 98.49 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 98.48 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 98.48 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 98.46 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 98.43 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 98.43 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 98.43 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 98.42 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 98.41 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 98.37 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 98.37 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 98.36 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 98.36 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 98.36 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 98.35 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 98.32 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 98.3 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.29 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 98.28 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 98.27 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 98.25 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 98.17 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 98.07 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 98.06 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 98.06 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 98.05 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 98.04 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 98.04 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 98.02 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 97.97 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 97.96 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 97.96 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 97.93 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 97.9 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 97.82 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.81 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 97.81 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 97.76 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 97.76 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 97.71 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 97.7 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 97.68 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 97.67 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 97.66 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 97.64 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 97.64 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 97.63 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 97.61 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 97.61 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 97.57 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 97.56 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 97.51 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 97.51 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 97.5 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 97.46 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 97.39 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 97.32 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 97.15 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 97.08 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 96.98 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.96 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 96.94 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.83 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 96.74 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 96.73 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 96.68 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 96.64 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 96.63 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 96.55 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 96.52 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.45 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 96.43 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 96.42 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 96.3 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 96.27 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 96.24 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 96.2 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 96.16 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 96.12 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 96.06 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.05 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 96.02 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.01 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 96.0 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 95.99 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 95.97 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 95.92 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 95.92 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 95.85 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 95.84 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 95.8 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 95.73 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 95.7 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.68 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 95.66 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 95.64 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 95.64 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 95.63 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 95.58 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 95.58 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 95.56 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 95.56 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 95.54 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 95.52 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 95.52 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 95.51 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 95.49 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 95.47 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 95.44 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 95.42 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 95.36 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 95.34 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 95.34 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 95.29 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 95.26 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 95.24 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 95.22 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 95.19 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 95.18 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 95.18 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 95.16 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 95.14 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 95.11 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 95.11 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 95.1 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 95.08 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 95.04 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 94.99 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 94.94 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 94.93 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 94.91 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 94.88 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 94.88 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 94.87 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 94.84 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 94.83 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 94.81 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 94.8 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 94.76 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 94.75 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 94.72 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 94.69 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 94.65 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 94.65 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 94.63 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 94.63 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 94.61 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 94.61 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 94.59 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 94.59 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 94.52 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 94.52 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 94.51 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 94.5 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 94.5 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 94.48 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 94.46 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 94.43 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 94.41 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 94.4 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 94.39 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 94.36 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 94.36 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 94.33 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 94.31 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 94.29 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 94.28 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 94.27 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 94.27 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 94.23 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 94.23 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 94.16 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 94.16 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 94.16 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 94.15 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 94.14 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 94.14 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 94.12 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 94.05 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 94.02 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 93.99 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 93.97 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 93.96 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.95 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 93.95 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 93.94 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 93.92 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.92 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 93.91 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 93.91 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 93.91 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.9 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.9 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 93.89 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 93.88 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 93.85 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 93.85 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 93.83 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 93.82 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 93.75 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 93.71 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 93.71 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 93.69 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 93.69 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 93.68 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 93.68 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 93.62 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 93.6 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 93.6 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 93.58 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 93.57 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 93.56 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.53 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 93.49 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 93.49 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 93.48 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 93.41 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 93.4 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 93.33 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 93.24 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 93.22 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 93.2 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 93.16 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 93.14 | |
| 3c7a_A | 404 | Octopine dehydrogenase; L) stereospecific opine de | 93.12 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 93.11 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 93.08 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 93.05 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 93.0 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 92.98 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 92.94 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 92.93 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 92.92 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 92.92 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 92.9 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 92.88 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 92.87 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 92.87 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 92.83 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 92.81 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 92.79 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 92.79 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 92.72 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 92.71 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 92.68 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 92.64 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 92.59 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 92.53 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 92.49 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 92.44 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 92.39 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 92.37 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 92.35 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 92.34 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 92.34 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 92.33 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 92.2 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 92.16 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 92.13 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 92.1 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 92.07 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 92.07 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 92.06 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 92.06 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 91.92 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 91.92 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 91.92 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 91.89 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 91.87 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 91.87 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 91.84 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 91.81 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 91.8 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 91.73 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 91.63 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 91.43 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 91.34 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 91.33 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 91.32 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 91.27 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 91.25 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 90.58 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 91.18 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 91.13 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 91.11 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 91.11 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 91.1 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 90.97 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 90.89 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 90.88 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 90.87 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 90.85 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 90.84 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 90.82 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 90.81 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 90.78 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 90.74 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 90.63 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 90.54 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 90.41 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 90.4 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 90.38 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 90.37 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 90.36 |
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.8e-46 Score=347.49 Aligned_cols=372 Identities=33% Similarity=0.554 Sum_probs=288.6
Q ss_pred CccEEEECCCHHHHHHHHHHHHcCCcEEEEcccCCCCCCCCCCCCCcceecccCC-ccccchHHHHHHHHHHHHHhcCCe
Q 015072 7 NFDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPE-DYYHPMVLESSLLWEQAQSEIGYK 85 (413)
Q Consensus 7 ~~dvvIIGgG~aG~~~A~~L~~~g~~V~lvE~~~~~~~~~~s~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~ 85 (413)
++||+|||||++|+++|++|+++|++|+|||+...++..+++..+.+.++..+.. ..+.++...+.+.|+++.+..+.+
T Consensus 3 ~~dvvIIGaG~~Gl~~A~~La~~G~~V~vie~~~~~~~~g~s~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~ 82 (389)
T 2gf3_A 3 HFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREYVPLALRSQELWYELEKETHHK 82 (389)
T ss_dssp CEEEEEECCSHHHHHHHHHHHHTTCCEEEECSSCSSCSSSSSCSSEEEECSSCTTCGGGHHHHHHHHHHHHHHHHHCSSC
T ss_pred cCCEEEECCCHHHHHHHHHHHhCCCeEEEEeCCCCCCCCCCCCCcchhhhhhhcCCchHHHHHHHHHHHHHHHHHHhCCc
Confidence 5899999999999999999999999999999988775446666666666655433 256677888899999998887776
Q ss_pred eEeeeeeeeeCCC-ChHHHHHHHHHHHhCCCCccccCHHHHHHhcCCcccCCCCeEEEEecCCeeecHHHHHHHHHHHHH
Q 015072 86 VYFKAHQFDMGPS-ENKSLRSVIASCRKNSVPHQVLDCRQVLQKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAI 164 (413)
Q Consensus 86 ~~~~~~~~~~~~~-~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~ 164 (413)
.+...+.+.+... +...+....+.+...+++.+.++.+++.+.+|. +.......+++.+.+++++|.++++.|.+.++
T Consensus 83 ~~~~~g~~~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~p~-~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~ 161 (389)
T 2gf3_A 83 IFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPG-ITVPENYNAIFEPNSGVLFSENCIRAYRELAE 161 (389)
T ss_dssp CEECCCEEEEEETTCCHHHHHHHHHHHHTTCCCEEEETHHHHHHSTT-CCCCTTEEEEEETTCEEEEHHHHHHHHHHHHH
T ss_pred ceeecceEEEcCCCchHHHHHHHHHHHHcCCCcEEcCHHHHHHhCCC-cccCCCceEEEeCCCcEEeHHHHHHHHHHHHH
Confidence 6666666655433 444456666677778888889999999888887 65566778899999999999999999999999
Q ss_pred HcCCeEecCceEEEEEeeeccCCCcEEEEeCCccEEEeCeEEEcCCcChhhhhhhhcCCCcceeEEEEEEEEEEecCCCc
Q 015072 165 KNGAVLRDNTEVKTVLKVKDDVRGGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRIKEGDE 244 (413)
Q Consensus 165 ~~gv~i~~~~~V~~i~~~~~~~~~~~~v~~~~g~~i~ad~vV~A~G~~~~~l~~~~~g~~~p~~~~~~~~~~~~~~~~~~ 244 (413)
+.|++++++++|++|.. + ++.+.+++++| +++||.||+|+|.|+..+++.+ +..+|+.|.+++++.++....
T Consensus 162 ~~Gv~i~~~~~v~~i~~--~--~~~~~v~~~~g-~~~a~~vV~A~G~~~~~l~~~~-g~~~pl~~~rg~~~~~~~~~~-- 233 (389)
T 2gf3_A 162 ARGAKVLTHTRVEDFDI--S--PDSVKIETANG-SYTADKLIVSMGAWNSKLLSKL-NLDIPLQPYRQVVGFFESDES-- 233 (389)
T ss_dssp HTTCEEECSCCEEEEEE--C--SSCEEEEETTE-EEEEEEEEECCGGGHHHHGGGG-TEECCCEEEEEEEEEECCCHH--
T ss_pred HCCCEEEcCcEEEEEEe--c--CCeEEEEeCCC-EEEeCEEEEecCccHHHHhhhh-ccCCceEEEEEEEEEEecCcc--
Confidence 99999999999999998 6 34577888777 4999999999999999888876 767899999999998864320
Q ss_pred cccccCCCCceEEec-CCCeeEecCCCCCCCeEEEEe-CCCCcCCCCCCCCCC---CcchHHHHHHHHhhcCCCCCCCCC
Q 015072 245 ADYAVGGDFPSFASY-GDPHVYGTPSLEYPGLIKIAL-HRGYLCDPDRRPWGP---GPLLDSLKELIQGRFAGRVDSSGP 319 (413)
Q Consensus 245 ~~~~~~~~~~~~~~~-~~~~~~~~p~~~~~g~~~~~~-~~~~~~~~~~~~~~~---~~~~~~l~~~~~~~~p~~~~~~~~ 319 (413)
.+.....+|.+... .+..+|++|..+.. .+.++. ..+...+++..+... .+..+.+.+.+.+++|.+.+ .+
T Consensus 234 -~~~~~~~~p~~~~~~~~~~~y~~p~~~g~-~~~iG~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~P~l~~--~~ 309 (389)
T 2gf3_A 234 -KYSNDIDFPGFMVEVPNGIYYGFPSFGGC-GLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEEYMPGANG--EL 309 (389)
T ss_dssp -HHBGGGTCCEEEEEETTEEEEEECBSTTC-CEEEEESSCCEECCTTTCCCCTTSSHHHHHHHHHHHHHHCGGGCS--CE
T ss_pred -cccccccCCEEEEeCCCCcEEEcCCCCCC-cEEEEEcCCCCccCcccccCccCCCHHHHHHHHHHHHHhCCCCCC--Cc
Confidence 11000124554432 22368888876522 344443 222222333222222 22678999999999999874 46
Q ss_pred ceeeeeeeeccCCCCeEEecCCCCCCCCEEEEeCCCccccccchHHHHHHHHHHHcCCCCccccccccccccCCC
Q 015072 320 AATQLCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGFKMAPVVGRILADLVLSGEAQGVELRHFRIARFKEN 394 (413)
Q Consensus 320 ~~~~~g~~~~t~d~~p~ig~~~~~~~~~~~~~~G~~~~G~~~a~~~a~~~a~~i~~~~~~~~~~~~~~~~R~~~~ 394 (413)
...|+|+|++|+|+.|+||++|.. +|+|+++||+|+|+++||++|+++|++|+++.+ +.+++.|+|+||...
T Consensus 310 ~~~w~g~r~~t~D~~p~ig~~~~~--~~l~~a~G~~g~G~~~ap~~g~~la~~i~~~~~-~~~~~~~~~~Rf~~~ 381 (389)
T 2gf3_A 310 KRGAVCMYTKTLDEHFIIDLHPEH--SNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKT-EHDISIFSINRPALK 381 (389)
T ss_dssp EEEEEEEEEECTTSCCEEEEETTE--EEEEEEECCTTCCGGGHHHHHHHHHHHHHHSCC-SSCCGGGCTTCGGGT
T ss_pred eEEEEEEeccCCCCCeEEccCCCC--CCEEEEECCccccccccHHHHHHHHHHHcCCCC-CCCcccccccccccc
Confidence 788999999999999999999877 899999999999999999999999999995544 667899999999754
|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 413 | ||||
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 9e-21 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 2e-10 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 8e-19 | |
| d2gf3a2 | 104 | d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus s | 2e-18 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 6e-15 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 3e-05 | |
| d1kifa1 | 246 | c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N | 3e-11 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 1e-09 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 0.003 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 1e-09 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 3e-09 | |
| d1c0pa1 | 268 | c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida | 5e-09 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 3e-08 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 3e-08 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 4e-08 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 4e-08 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 5e-08 | |
| d3coxa1 | 370 | c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of | 1e-07 | |
| d1neka2 | 330 | c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase | 2e-07 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 3e-07 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 4e-07 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 4e-07 | |
| d2cula1 | 230 | c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T | 6e-07 | |
| d1n4wa1 | 367 | c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of | 1e-06 | |
| d2bi7a1 | 314 | c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu | 1e-06 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 2e-06 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 3e-06 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 3e-06 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 3e-06 | |
| d1k0ia1 | 292 | c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr | 4e-06 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 8e-06 | |
| d1h6va1 | 235 | c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin | 1e-05 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 1e-05 | |
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 1e-05 | |
| d3lada1 | 229 | c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd | 1e-05 | |
| d1kdga1 | 360 | c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain | 2e-05 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 2e-05 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 3e-05 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 3e-05 | |
| d1cf3a1 | 385 | c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper | 3e-05 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 3e-05 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 4e-05 | |
| d1onfa1 | 259 | c.3.1.5 (A:1-153,A:271-376) Glutathione reductase | 5e-05 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 6e-05 | |
| d1mo9a1 | 261 | c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop | 6e-05 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 7e-05 | |
| d1gpea1 | 391 | c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic | 7e-05 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 7e-05 | |
| d3grsa1 | 221 | c.3.1.5 (A:18-165,A:291-363) Glutathione reductase | 1e-04 | |
| d1feca1 | 240 | c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas | 1e-04 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 1e-04 | |
| d1aoga1 | 238 | c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas | 2e-04 | |
| d1fl2a1 | 184 | c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide | 3e-04 | |
| d1wdka3 | 186 | c.2.1.6 (A:311-496) Fatty oxidation complex alpha | 3e-04 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 4e-04 | |
| d1kf6a2 | 311 | c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es | 4e-04 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 5e-04 | |
| d1f0ya2 | 192 | c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA | 5e-04 | |
| d1vdca1 | 192 | c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase | 7e-04 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 8e-04 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 0.001 | |
| d1trba1 | 190 | c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase | 0.002 |
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Sarcosine oxidase species: Bacillus sp., strain b0618 [TaxId: 1409]
Score = 89.4 bits (220), Expect = 9e-21
Identities = 72/214 (33%), Positives = 105/214 (49%), Gaps = 6/214 (2%)
Query: 8 FDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPED-YYHP 66
FDVIVVGAG MG +A YQLAK+G KTLL++ FD H GS HG++R IR Y E Y P
Sbjct: 4 FDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREYVP 63
Query: 67 MVLESSLLWEQAQSEIGYKVYFKAHQFDMGPSENKSLRSVIASCRKNSVPHQVLDCRQVL 126
+ L S LW + + E +K++ K GP + + K L +
Sbjct: 64 LALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEI 123
Query: 127 QKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLAIKNGAVLRDNTEVKTVLKVKDDV 186
K I +PEN+ + GV+ + ++ LA GA + +T V+ D
Sbjct: 124 NKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPD-- 181
Query: 187 RGGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKI 220
V + T++G + K +V+ GAW KL+ K+
Sbjct: 182 --SVKIETANG-SYTADKLIVSMGAWNSKLLSKL 212
|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d2gf3a2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 104 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 100.0 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 100.0 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 99.95 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 99.75 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 99.72 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 99.71 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 99.69 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 99.67 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 99.67 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.66 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 99.63 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.58 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 99.51 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 99.46 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.46 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 99.44 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 99.43 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 99.41 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 99.39 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 99.31 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.31 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 99.28 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 99.28 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 99.27 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 99.26 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 99.25 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 99.22 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 99.22 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 99.21 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 99.19 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 99.18 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 99.18 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 99.17 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 99.17 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 99.13 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 99.12 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 99.11 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 99.09 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 99.09 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 99.08 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 99.05 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 99.05 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 99.05 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 99.04 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 99.04 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 99.04 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 99.03 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 99.03 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 99.02 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 99.01 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 98.97 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.95 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 98.94 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.92 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 98.92 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 98.89 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.83 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.82 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 98.77 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 98.75 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 98.75 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.71 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.7 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 98.68 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.67 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 98.62 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 98.6 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.59 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 98.58 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.58 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.54 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.52 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 98.49 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 98.49 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.47 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.47 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 98.45 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 98.44 | |
| d1kifa2 | 93 | D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 | 98.43 | |
| d1ryia2 | 88 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 98.41 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 98.39 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 98.35 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 98.34 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.32 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 98.29 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.24 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.17 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 98.15 | |
| d1c0pa2 | 95 | D-aminoacid oxidase {Rhodotorula gracilis [TaxId: | 98.02 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 97.95 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.84 | |
| d2gf3a2 | 104 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 97.82 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 97.72 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.54 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 97.53 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 97.37 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.29 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 97.28 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 97.2 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 97.14 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 97.05 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 96.95 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 96.84 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 96.84 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 96.81 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.73 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 96.73 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 96.71 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 96.66 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 96.64 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 96.55 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 96.47 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 96.46 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 96.45 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 96.15 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.82 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 95.8 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 95.79 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 95.77 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 95.71 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 95.7 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 95.64 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 95.61 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 95.57 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 95.5 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.5 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 95.49 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 95.45 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 95.44 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 95.42 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 95.38 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 95.34 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.32 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 95.28 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 95.27 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 95.17 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 95.05 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 94.87 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 94.79 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 94.7 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 94.63 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 94.55 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 94.51 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 94.26 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 94.01 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 93.92 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 93.87 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 93.82 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 93.67 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 93.66 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 93.64 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 93.63 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 93.63 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 93.61 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 93.54 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 93.51 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 93.5 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 93.12 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 93.08 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 93.0 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 92.85 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 92.53 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 92.53 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 92.04 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 91.94 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 91.87 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 91.8 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 91.52 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 91.15 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 90.99 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 90.92 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 90.8 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 90.78 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 90.73 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 90.68 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 90.29 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 90.2 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 89.44 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 89.43 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 89.27 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 89.07 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 88.95 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 88.89 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 88.83 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 88.76 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 88.49 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 88.33 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 88.25 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 88.0 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 87.86 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 87.84 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 87.81 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 87.49 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 87.37 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 86.58 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 86.2 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 86.13 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 85.89 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 84.53 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 84.52 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 84.46 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 84.4 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 84.32 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 84.32 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 83.96 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 83.9 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 83.89 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 83.82 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 83.76 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 83.75 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 83.64 | |
| d1pj5a3 | 119 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 83.51 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 82.91 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 82.91 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 82.88 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 82.7 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 82.29 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 82.27 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 81.98 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 81.84 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 81.72 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 81.56 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 81.54 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 81.45 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 81.33 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 81.29 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 81.26 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 81.25 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 81.23 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 81.18 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 80.85 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 80.55 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 80.41 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 80.06 |
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Sarcosine oxidase species: Bacillus sp., strain b0618 [TaxId: 1409]
Probab=100.00 E-value=3.5e-35 Score=260.11 Aligned_cols=274 Identities=35% Similarity=0.627 Sum_probs=226.9
Q ss_pred CCccEEEECCCHHHHHHHHHHHHcCCcEEEEcccCCCCCCCCCCCCCcceecccCC-ccccchHHHHHHHHHHHHHhcCC
Q 015072 6 ENFDVIVVGAGIMGSSAAYQLAKRGQKTLLLEQFDFLHHRGSSHGESRTIRATYPE-DYYHPMVLESSLLWEQAQSEIGY 84 (413)
Q Consensus 6 ~~~dvvIIGgG~aG~~~A~~L~~~g~~V~lvE~~~~~~~~~~s~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~ 84 (413)
.+|||+|||||++|+++|++|+++|++|+|||+.+.+++.+++.+..+.++..+.. ..+.++...+.+.|.++.++.+.
T Consensus 2 ~~yDvvIIGaGi~Gls~A~~La~~G~~V~viE~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~l~~~s~~~~~~l~~e~~~ 81 (281)
T d2gf3a1 2 THFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREYVPLALRSQELWYELEKETHH 81 (281)
T ss_dssp CCEEEEEECCSHHHHHHHHHHHHTTCCEEEECSSCSSCSSSSSCSSEEEECSSCTTCGGGHHHHHHHHHHHHHHHHHCSS
T ss_pred CcCCEEEECcCHHHHHHHHHHHHCCCcEEEEeCCCCCCcccccCCCcceeecccCCcchhhhhcccccceeecchhhhhh
Confidence 46999999999999999999999999999999988776666666666666555543 44567788899999999999988
Q ss_pred eeEeeeeeeeeC-CCChHHHHHHHHHHHhCCCCccccCHHHHHHhcCCcccCCCCeEEEEecCCeeecHHHHHHHHHHHH
Q 015072 85 KVYFKAHQFDMG-PSENKSLRSVIASCRKNSVPHQVLDCRQVLQKYSGRIEIPENWVGVTTELGGVIKPTKAVSMFQTLA 163 (413)
Q Consensus 85 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~g~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~ 163 (413)
+.+...+.+... ..+...+....+..+..+.+.+.++.+++.+.+|. ++.+....+++.+.+++++|..++..|.+.+
T Consensus 82 ~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~e~~~~~p~-~~~~~~~~~~~~~~~g~~~p~~~~~~l~~~a 160 (281)
T d2gf3a1 82 KIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPG-ITVPENYNAIFEPNSGVLFSENCIRAYRELA 160 (281)
T ss_dssp CCEECCCEEEEEETTCCHHHHHHHHHHHHTTCCCEEEETHHHHHHSTT-CCCCTTEEEEEETTCEEEEHHHHHHHHHHHH
T ss_pred ccccccceeeeeecchhhhhhhhhhhhccccchhhhhhhHhhhhhhhc-ccccccceeeecccccccccccccccccccc
Confidence 887777766654 33345566777777888999999999999999998 7777888899999999999999999999999
Q ss_pred HHcCCeEecCceEEEEEeeeccCCCcEEEEeCCccEEEeCeEEEcCCcChhhhhhhhcCCCcceeEEEEEEEEEEecCCC
Q 015072 164 IKNGAVLRDNTEVKTVLKVKDDVRGGVTVVTSSGEEFWGKKCVVTAGAWVGKLVKKISGLELPIQAVETSVCYWRIKEGD 243 (413)
Q Consensus 164 ~~~gv~i~~~~~V~~i~~~~~~~~~~~~v~~~~g~~i~ad~vV~A~G~~~~~l~~~~~g~~~p~~~~~~~~~~~~~~~~~ 243 (413)
++.|++++++++|++|.. + ++.+.|+|++|+ +.||+||+|+|+|+..+++++ |+.+
T Consensus 161 ~~~Gv~i~~~~~V~~i~~--~--~~~v~V~t~~g~-i~a~~VViAaG~~s~~l~~~l-g~~~------------------ 216 (281)
T d2gf3a1 161 EARGAKVLTHTRVEDFDI--S--PDSVKIETANGS-YTADKLIVSMGAWNSKLLSKL-NLDI------------------ 216 (281)
T ss_dssp HHTTCEEECSCCEEEEEE--C--SSCEEEEETTEE-EEEEEEEECCGGGHHHHGGGG-TEEC------------------
T ss_pred ccccccccCCcEEEEEEE--E--CCEEEEEECCcE-EEcCEEEECCCCcchhhHHhc-CCcc------------------
Confidence 999999999999999999 7 567899999887 999999999999999988776 3110
Q ss_pred ccccccCCCCceEEecCCCeeEecCCCCCCCeEEEEeCCCCcCCCCCCCCCCCcchHHHHHHHHhhcCCCCCCCCCceee
Q 015072 244 EADYAVGGDFPSFASYGDPHVYGTPSLEYPGLIKIALHRGYLCDPDRRPWGPGPLLDSLKELIQGRFAGRVDSSGPAATQ 323 (413)
Q Consensus 244 ~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~p~~~~~~~~~~~~ 323 (413)
T Consensus 217 -------------------------------------------------------------------------------- 216 (281)
T d2gf3a1 217 -------------------------------------------------------------------------------- 216 (281)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred eeeeeccCCCCeEEecCCCCCCCCEEEEeCCCccccccchHHHHHHHHHHHcCCCCccccccccccccCCC
Q 015072 324 LCMYSMTPDKDFVIDFLGGELGEDVVVAGGFSGHGFKMAPVVGRILADLVLSGEAQGVELRHFRIARFKEN 394 (413)
Q Consensus 324 ~g~~~~t~d~~p~ig~~~~~~~~~~~~~~G~~~~G~~~a~~~a~~~a~~i~~~~~~~~~~~~~~~~R~~~~ 394 (413)
++..+.++..|.. ++++++.|++|+|+.++|..|+++++++..+++ ..|+..|++.|+.-+
T Consensus 217 -------~~~~~~~~~~P~~--~~~~~~~g~~g~g~~~~p~~G~~~~~~~~~~~~-~~d~~~f~~~R~~~~ 277 (281)
T d2gf3a1 217 -------PDEHFIIDLHPEH--SNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKT-EHDISIFSINRPALK 277 (281)
T ss_dssp -------CTSCCEEEEETTE--EEEEEEECCTTCCGGGHHHHHHHHHHHHHHSCC-SSCCGGGCTTCGGGT
T ss_pred -------ccccceeccccCC--CCEEEEeccCCcccccChhHHHHHHHHHhcCCC-CCCchhhCCCCccch
Confidence 0122234445555 788999999999999999999999999998877 568999999997654
|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2gf3a2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|