Citrus Sinensis ID: 015096
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| 255580205 | 412 | arsenical pump-driving atpase, putative | 0.990 | 0.992 | 0.817 | 0.0 | |
| 297829562 | 410 | anion-transporting ATPase family protein | 0.932 | 0.939 | 0.820 | 0.0 | |
| 225449002 | 413 | PREDICTED: putative arsenical pump-drivi | 0.932 | 0.932 | 0.815 | 0.0 | |
| 224109802 | 407 | predicted protein [Populus trichocarpa] | 0.934 | 0.948 | 0.827 | 1e-180 | |
| 356576235 | 403 | PREDICTED: putative arsenical pump-drivi | 0.932 | 0.955 | 0.810 | 1e-180 | |
| 296085994 | 589 | unnamed protein product [Vitis vinifera] | 0.932 | 0.653 | 0.809 | 1e-179 | |
| 30681260 | 411 | anion-transporting ATPase family protein | 0.932 | 0.936 | 0.817 | 1e-178 | |
| 357443179 | 404 | ATPase ASNA1-like protein [Medicago trun | 0.937 | 0.957 | 0.809 | 1e-178 | |
| 356535619 | 404 | PREDICTED: putative arsenical pump-drivi | 0.951 | 0.972 | 0.795 | 1e-178 | |
| 449449294 | 409 | PREDICTED: putative arsenical pump-drivi | 0.973 | 0.982 | 0.777 | 1e-167 |
| >gi|255580205|ref|XP_002530933.1| arsenical pump-driving atpase, putative [Ricinus communis] gi|223529492|gb|EEF31448.1| arsenical pump-driving atpase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 668 bits (1724), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 340/416 (81%), Positives = 376/416 (90%), Gaps = 7/416 (1%)
Query: 1 MTTAACCFRSTSLPSSFSIHKKLAVKRNSNAVSFMGLLSFSPKTS---SFSTGLISISLK 57
M T A C + S SSFS+H L RNS +S +GLLSF+P+T S +T LI+ S+K
Sbjct: 1 MATIASCIVTHST-SSFSLHN-LFTPRNS--MSAVGLLSFAPRTRTSPSLATSLIAFSVK 56
Query: 58 QRRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNG 117
Q+ +NS QVR+VAAP+E V+GFDEMV+GTQRKYYMLGGKGGVGKTSCAASLAVKFANNG
Sbjct: 57 QKPGRNSLQVRSVAAPAEDVAGFDEMVSGTQRKYYMLGGKGGVGKTSCAASLAVKFANNG 116
Query: 118 HPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGG 177
HPTLVVSTDPAHSLSDSFAQ+L GG LVPVEGPD+PL+ALEINPEKAREEFR +QK+GG
Sbjct: 117 HPTLVVSTDPAHSLSDSFAQNLAGGTLVPVEGPDYPLYALEINPEKAREEFRGASQKNGG 176
Query: 178 TGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLESQEYSMFTRIV 237
TGVKDFM+GMGLGM+VEQLGELKLGELLDTPPPGLDEAIAISKV+QFLESQEY MFTRIV
Sbjct: 177 TGVKDFMEGMGLGMIVEQLGELKLGELLDTPPPGLDEAIAISKVMQFLESQEYKMFTRIV 236
Query: 238 FDTAPTGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERL 297
FDTAPTGHTLRLLSLPDFLDASIGKILKL++KI+SATSAIKSVFGQE+ RQ A+DKLERL
Sbjct: 237 FDTAPTGHTLRLLSLPDFLDASIGKILKLKQKISSATSAIKSVFGQEETRQDAADKLERL 296
Query: 298 RERMVKVRELFRDTDSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSA 357
RERM+KVRELFRDTDSTEFV+VTIPTVMA+SESSRL SLKKENVPVKRLIVNQI+PPSA
Sbjct: 297 RERMIKVRELFRDTDSTEFVVVTIPTVMAISESSRLHASLKKENVPVKRLIVNQILPPSA 356
Query: 358 SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK 413
SDCKFCAMKRKDQ RAL+MI+SD ELSSL LI APLVDVEIRGVPAL+F+GDIIWK
Sbjct: 357 SDCKFCAMKRKDQTRALDMIQSDPELSSLTLIRAPLVDVEIRGVPALQFLGDIIWK 412
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297829562|ref|XP_002882663.1| anion-transporting ATPase family protein [Arabidopsis lyrata subsp. lyrata] gi|297328503|gb|EFH58922.1| anion-transporting ATPase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225449002|ref|XP_002271753.1| PREDICTED: putative arsenical pump-driving ATPase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224109802|ref|XP_002315316.1| predicted protein [Populus trichocarpa] gi|118487322|gb|ABK95489.1| unknown [Populus trichocarpa] gi|222864356|gb|EEF01487.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356576235|ref|XP_003556239.1| PREDICTED: putative arsenical pump-driving ATPase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296085994|emb|CBI31435.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|30681260|ref|NP_187646.2| anion-transporting ATPase family protein [Arabidopsis thaliana] gi|119935933|gb|ABM06038.1| At3g10350 [Arabidopsis thaliana] gi|332641373|gb|AEE74894.1| anion-transporting ATPase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357443179|ref|XP_003591867.1| ATPase ASNA1-like protein [Medicago truncatula] gi|355480915|gb|AES62118.1| ATPase ASNA1-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356535619|ref|XP_003536342.1| PREDICTED: putative arsenical pump-driving ATPase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449449294|ref|XP_004142400.1| PREDICTED: putative arsenical pump-driving ATPase-like [Cucumis sativus] gi|449513079|ref|XP_004164222.1| PREDICTED: putative arsenical pump-driving ATPase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| TAIR|locus:2175816 | 391 | AT5G60730 [Arabidopsis thalian | 0.852 | 0.900 | 0.603 | 1.5e-108 | |
| DICTYBASE|DDB_G0293528 | 329 | arsA "arsenite-translocating A | 0.479 | 0.601 | 0.317 | 1.2e-43 | |
| FB|FBgn0033191 | 336 | CG1598 [Drosophila melanogaste | 0.481 | 0.592 | 0.309 | 1.4e-40 | |
| POMBASE|SPAC1142.06 | 329 | get3 "GET complex ATPase subun | 0.481 | 0.604 | 0.289 | 1.1e-38 | |
| ZFIN|ZDB-GENE-040625-120 | 341 | asna1 "arsA arsenite transport | 0.450 | 0.545 | 0.284 | 5.8e-38 | |
| UNIPROTKB|A5PJI5 | 348 | ASNA1 "ATPase ASNA1" [Bos taur | 0.450 | 0.534 | 0.284 | 2e-37 | |
| UNIPROTKB|O43681 | 348 | ASNA1 "ATPase ASNA1" [Homo sap | 0.450 | 0.534 | 0.284 | 2e-37 | |
| UNIPROTKB|F2Z5J4 | 348 | ASNA1 "Uncharacterized protein | 0.450 | 0.534 | 0.284 | 2e-37 | |
| MGI|MGI:1928379 | 348 | Asna1 "arsA arsenite transport | 0.450 | 0.534 | 0.284 | 2e-37 | |
| UNIPROTKB|G3V9T7 | 348 | Asna1 "ArsA arsenite transport | 0.450 | 0.534 | 0.284 | 2e-37 |
| TAIR|locus:2175816 AT5G60730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1073 (382.8 bits), Expect = 1.5e-108, P = 1.5e-108
Identities = 215/356 (60%), Positives = 268/356 (75%)
Query: 59 RRSKNSFQVRAVAAPSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGH 118
R S F+VR++A +E S F+EMV+ QRKYY+LGGKGGVGKTSCAASLAVKFA++GH
Sbjct: 39 RISGTLFRVRSLATLAEGASHFNEMVSVNQRKYYLLGGKGGVGKTSCAASLAVKFASHGH 98
Query: 119 PTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGT 178
PT+VVSTDPAHSLSDSF+QDL+GG L PV+G D PL ALEI PE ++E + T G
Sbjct: 99 PTIVVSTDPAHSLSDSFSQDLSGGVLKPVQGVDSPLLALEITPEIMKDEIKRQT---GDK 155
Query: 179 GVKDFMDGMGLGMXXXXXXXXXXXXXXDTPPPGLDEAIAISKVIQFLESQEYSMFTRIVF 238
VK+ MD MGLGM + PG+DE AISKV+QF+E+ EYS FTRIVF
Sbjct: 156 SVKNMMDSMGLGMFAGELGDLNLEDMLNAASPGIDEIAAISKVLQFMEAPEYSRFTRIVF 215
Query: 239 DTAPTGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGA-SDKLERL 297
DTAPTGHTLRLLSLPDF D+SI KI KL++KI +A SA K VFG+++ +Q ++L++L
Sbjct: 216 DTAPTGHTLRLLSLPDFYDSSISKITKLKKKITAAASAFKLVFGKKEIQQKELPNELDQL 275
Query: 298 RERMVKVRELFRDTDSTEFVIVTIPTVMAVXXXXXXXXXXXXXNVPVKRLIVNQIIPPSA 357
+ERM KVR +FRD D+TEFVIVTIPTVMA+ NVPV RLIVNQ++P S
Sbjct: 276 KERMEKVRNVFRDVDTTEFVIVTIPTVMAINESSRLHASLRKENVPVHRLIVNQLLPQSE 335
Query: 358 SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK 413
SDCKFC+++RK+Q R L +I++D+ELS L LI++PL+D EIRGVPAL+FMGD+IWK
Sbjct: 336 SDCKFCSIRRKEQTRVLGLIQNDTELSGLKLIQSPLLDAEIRGVPALKFMGDLIWK 391
|
|
| DICTYBASE|DDB_G0293528 arsA "arsenite-translocating ATPase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033191 CG1598 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1142.06 get3 "GET complex ATPase subunit Get3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-120 asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5PJI5 ASNA1 "ATPase ASNA1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43681 ASNA1 "ATPase ASNA1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5J4 ASNA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1928379 Asna1 "arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V9T7 Asna1 "ArsA arsenite transporter, ATP-binding, homolog 1 (Bacterial)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| pfam02374 | 304 | pfam02374, ArsA_ATPase, Anion-transporting ATPase | 6e-77 | |
| COG0003 | 322 | COG0003, ArsA, Predicted ATPase involved in chromo | 4e-70 | |
| cd02035 | 217 | cd02035, ArsA, ArsA ATPase functionas as an efflux | 2e-65 | |
| TIGR00345 | 284 | TIGR00345, GET3_arsA_TRC40, transport-energizing A | 6e-59 | |
| TIGR04291 | 566 | TIGR04291, arsen_driv_ArsA, arsenical pump-driving | 3e-29 | |
| TIGR04291 | 566 | TIGR04291, arsen_driv_ArsA, arsenical pump-driving | 4e-18 | |
| cd02042 | 104 | cd02042, ParA, ParA and ParB of Caulobacter cresce | 6e-08 | |
| cd02034 | 116 | cd02034, CooC, The accessory protein CooC, which c | 9e-08 | |
| pfam01656 | 217 | pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi | 2e-07 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 5e-06 | |
| TIGR03371 | 246 | TIGR03371, cellulose_yhjQ, cellulose synthase oper | 7e-06 | |
| PHA02518 | 211 | PHA02518, PHA02518, ParA-like protein; Provisional | 8e-06 | |
| COG1192 | 259 | COG1192, Soj, ATPases involved in chromosome parti | 2e-05 | |
| cd02038 | 139 | cd02038, FleN-like, FleN is a member of the Fer4_N | 5e-05 | |
| cd02036 | 179 | cd02036, MinD, Bacterial cell division requires th | 2e-04 | |
| COG1149 | 284 | COG1149, COG1149, MinD superfamily P-loop ATPase c | 3e-04 | |
| COG3640 | 255 | COG3640, CooC, CO dehydrogenase maturation factor | 0.001 |
| >gnl|CDD|217004 pfam02374, ArsA_ATPase, Anion-transporting ATPase | Back alignment and domain information |
|---|
Score = 240 bits (615), Expect = 6e-77
Identities = 111/324 (34%), Positives = 173/324 (53%), Gaps = 21/324 (6%)
Query: 90 KYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEG 149
++ GGKGGVGKT+ + + AV+ + G L+VSTDPAHSLSDSF Q G + ++G
Sbjct: 2 RWIFFGGKGGVGKTTVSCATAVRLSEQGKKVLLVSTDPAHSLSDSFNQKF-GHEPTKIKG 60
Query: 150 PDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPP 209
+ L A+EI+P+ EE+R Q M G+L E+L L
Sbjct: 61 VE-NLSAMEIDPQMELEEYRGEVQDPIN---AVLGLDMLEGILAEELSSL---------- 106
Query: 210 PGLDEAIAISKVIQFLESQEYSMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKILKLREK 269
PG+DE + + ++++ EY + ++FDTAPTGHTLRLLSLP L + KI+KL+ +
Sbjct: 107 PGIDEIASFDEFKKYMDEGEYDV---VIFDTAPTGHTLRLLSLPTVLSWYLEKIVKLKNQ 163
Query: 270 IASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSE 329
I K + A + LE +E++ K RE+ D + T F +V IP M++ E
Sbjct: 164 IGPLAKPFKGMGMGGSCLPEALESLEETKEQIEKAREILSDPERTSFRLVCIPEKMSLYE 223
Query: 330 SSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQMRALEMIKSDSELSSLMLI 389
+ R + L K + V +IVNQ++P + C FC +++ Q + L+ I+ S L +
Sbjct: 224 TERAIQELAKYGIDVDAVIVNQVLPET-EQCPFCEARKEIQQKYLKEIEEL--FSDLPVA 280
Query: 390 EAPLVDVEIRGVPALRFMGDIIWK 413
+ PL+ E+ G+ AL ++
Sbjct: 281 KLPLLPEEVVGLEALEKFSQTLYG 304
|
This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304 |
| >gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >gnl|CDD|232932 TIGR00345, GET3_arsA_TRC40, transport-energizing ATPase, TRC40/GET3/ArsA family | Back alignment and domain information |
|---|
| >gnl|CDD|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|213904 TIGR04291, arsen_driv_ArsA, arsenical pump-driving ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234188 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >gnl|CDD|222854 PHA02518, PHA02518, ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|226166 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| KOG2825 | 323 | consensus Putative arsenite-translocating ATPase [ | 100.0 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 100.0 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 100.0 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 100.0 | |
| TIGR00345 | 284 | arsA arsenite-activated ATPase (arsA). The N-termi | 100.0 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 99.96 | |
| KOG3022 | 300 | consensus Predicted ATPase, nucleotide-binding [Ce | 99.94 | |
| COG0489 | 265 | Mrp ATPases involved in chromosome partitioning [C | 99.94 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 99.92 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 99.91 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 99.91 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 99.91 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 99.9 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 99.9 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 99.9 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 99.89 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 99.89 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 99.89 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 99.89 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 99.88 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 99.88 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 99.88 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 99.88 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 99.88 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 99.88 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 99.88 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 99.87 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 99.87 | |
| PRK10037 | 250 | cell division protein; Provisional | 99.87 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 99.87 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 99.86 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 99.86 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 99.86 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 99.86 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 99.86 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 99.86 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 99.85 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 99.85 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 99.84 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 99.84 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 99.84 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 99.84 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 99.83 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 99.83 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 99.83 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 99.82 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 99.82 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 99.81 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 99.81 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 99.81 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 99.81 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 99.79 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 99.77 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 99.76 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 99.71 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 99.69 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 99.68 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 99.63 | |
| PF09140 | 261 | MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi | 99.63 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 99.56 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 99.51 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 99.45 | |
| COG4963 | 366 | CpaE Flp pilus assembly protein, ATPase CpaE [Intr | 99.4 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 99.38 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 99.31 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 99.29 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 99.27 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 99.24 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 99.24 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 99.23 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 99.21 | |
| PRK13768 | 253 | GTPase; Provisional | 99.19 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 99.17 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 99.1 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 99.07 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 99.07 | |
| PF10609 | 81 | ParA: ParA/MinD ATPase like; InterPro: IPR019591 T | 98.99 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.93 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 98.89 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 98.88 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 98.85 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 98.77 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 98.77 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.72 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 98.66 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 98.6 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 98.59 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 98.57 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 98.56 | |
| COG0132 | 223 | BioD Dethiobiotin synthetase [Coenzyme metabolism] | 98.41 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 98.38 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 98.38 | |
| PRK05632 | 684 | phosphate acetyltransferase; Reviewed | 98.38 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.37 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.34 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 98.34 | |
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 98.33 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 98.23 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 98.21 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.19 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 98.14 | |
| PRK12374 | 231 | putative dithiobiotin synthetase; Provisional | 98.13 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 98.08 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.05 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 98.05 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 97.97 | |
| PRK13505 | 557 | formate--tetrahydrofolate ligase; Provisional | 97.95 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 97.93 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 97.92 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.87 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 97.85 | |
| cd00477 | 524 | FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca | 97.84 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 97.83 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 97.75 | |
| PRK13506 | 578 | formate--tetrahydrofolate ligase; Provisional | 97.74 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 97.7 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 97.59 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 97.52 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 97.46 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.45 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.44 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 97.44 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.26 | |
| PRK06526 | 254 | transposase; Provisional | 97.25 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 97.21 | |
| PRK08181 | 269 | transposase; Validated | 97.19 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.13 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.13 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.12 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 97.11 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 97.06 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 97.06 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.02 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 97.0 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 96.93 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 96.92 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 96.91 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.9 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.87 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.87 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.83 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.81 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 96.8 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.8 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.78 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.74 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.71 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.67 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 96.67 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 96.66 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 96.63 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.62 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 96.6 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.6 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.54 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.48 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.48 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.47 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.46 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 96.43 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.43 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 96.43 | |
| cd03113 | 255 | CTGs CTP synthetase (CTPs) is a two-domain protein | 96.43 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 96.4 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.38 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 96.36 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.34 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 96.34 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.3 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.27 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.22 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 96.21 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.21 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.18 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.16 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.13 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 96.1 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 96.07 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 96.0 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.96 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.95 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.95 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.95 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.93 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.93 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.89 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 95.87 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 95.86 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 95.83 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.82 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.81 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 95.8 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 95.8 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 95.8 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.79 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 95.78 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.75 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 95.74 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 95.74 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 95.71 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 95.65 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 95.65 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.64 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 95.64 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.64 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 95.63 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 95.62 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 95.6 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 95.58 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 95.58 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 95.57 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.56 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.55 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 95.53 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.52 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.49 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 95.49 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.46 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 95.44 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.42 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.41 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 95.4 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 95.4 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.39 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 95.38 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 95.33 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 95.32 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.29 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.28 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.23 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.23 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 95.23 | |
| COG0857 | 354 | Pta BioD-like N-terminal domain of phosphotransace | 95.22 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 95.17 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.16 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 95.16 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 95.14 | |
| PF06418 | 276 | CTP_synth_N: CTP synthase N-terminus; InterPro: IP | 95.11 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 95.1 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 95.09 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.09 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 95.08 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 95.07 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 95.01 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 95.0 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.99 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.94 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 94.92 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.9 | |
| PRK08116 | 268 | hypothetical protein; Validated | 94.88 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 94.88 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.86 | |
| COG0504 | 533 | PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide | 94.85 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 94.83 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.73 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 94.66 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 94.63 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 94.49 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 94.48 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 94.47 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 94.41 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 94.4 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.4 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 94.4 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.38 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 94.38 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.35 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 94.35 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.34 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 94.33 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 94.33 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 94.31 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 94.31 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 94.3 | |
| COG2403 | 449 | Predicted GTPase [General function prediction only | 94.3 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 94.25 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.22 | |
| PRK06217 | 183 | hypothetical protein; Validated | 94.18 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 94.17 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.12 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 94.06 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 94.06 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 94.05 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 94.03 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 94.03 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 93.98 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 93.87 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 93.84 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 93.83 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 93.82 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 93.81 | |
| TIGR00682 | 311 | lpxK tetraacyldisaccharide 4'-kinase. Also called | 93.78 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 93.76 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 93.73 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 93.68 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 93.65 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.63 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 93.62 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 93.56 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 93.52 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 93.49 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 93.48 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 93.45 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 93.45 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 93.44 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 93.33 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 93.3 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 93.29 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 93.27 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 93.12 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 93.1 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 93.09 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 92.85 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.82 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 92.8 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 92.76 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 92.73 | |
| PRK03839 | 180 | putative kinase; Provisional | 92.73 | |
| PLN02327 | 557 | CTP synthase | 92.64 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 92.63 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 92.61 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 92.61 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 92.6 | |
| PLN02924 | 220 | thymidylate kinase | 92.5 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 92.44 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.41 | |
| PRK01906 | 338 | tetraacyldisaccharide 4'-kinase; Provisional | 92.4 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 92.39 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 92.38 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 92.37 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 92.28 | |
| PRK05380 | 533 | pyrG CTP synthetase; Validated | 92.27 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 92.22 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.18 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 92.17 | |
| TIGR00337 | 525 | PyrG CTP synthase. CTP synthase is involved in pyr | 92.16 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 92.15 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 92.13 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 92.11 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 92.08 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 92.05 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 92.04 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 91.9 | |
| PF02606 | 326 | LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr | 91.85 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 91.83 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 91.74 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 91.63 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 91.53 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 91.5 | |
| PLN02200 | 234 | adenylate kinase family protein | 91.47 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 91.42 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 91.33 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.31 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 91.25 | |
| PLN02348 | 395 | phosphoribulokinase | 91.18 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 91.05 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 90.93 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 90.77 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 90.76 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 90.75 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 90.66 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 90.65 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 90.65 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 90.6 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 90.52 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 90.48 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 90.39 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 90.32 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 90.31 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 90.31 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 90.3 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 90.3 | |
| KOG2749 | 415 | consensus mRNA cleavage and polyadenylation factor | 90.2 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 90.18 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 90.14 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 90.1 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 90.0 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 89.99 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 89.93 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 89.91 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 89.9 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 89.84 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 89.83 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 89.78 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 89.78 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 89.72 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 89.56 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 89.55 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 89.53 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 89.52 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 89.5 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 89.49 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 89.4 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 89.39 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 89.37 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 89.36 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 89.34 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 89.26 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 89.24 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 89.23 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 89.21 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 89.16 | |
| PRK13764 | 602 | ATPase; Provisional | 89.12 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 89.08 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 89.03 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 89.01 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 88.89 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 88.88 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 88.85 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 88.83 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 88.81 | |
| PRK13695 | 174 | putative NTPase; Provisional | 88.75 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 88.75 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 88.67 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 88.65 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 88.63 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 88.59 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 88.56 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 88.52 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 88.32 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 88.22 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 88.18 | |
| COG1663 | 336 | LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env | 88.08 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 87.98 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 87.97 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 87.52 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 87.47 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 87.4 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 87.39 | |
| CHL00071 | 409 | tufA elongation factor Tu | 87.37 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 87.25 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 87.22 | |
| COG2205 | 890 | KdpD Osmosensitive K+ channel histidine kinase [Si | 87.21 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 87.17 | |
| PLN02422 | 232 | dephospho-CoA kinase | 87.14 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 87.07 | |
| PF01268 | 557 | FTHFS: Formate--tetrahydrofolate ligase; InterPro: | 87.0 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 87.0 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 86.99 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 86.96 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 86.94 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 86.92 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 86.79 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 86.79 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 86.76 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 86.75 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 86.61 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 86.61 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 86.51 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 86.46 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 86.43 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 86.39 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 86.37 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 86.3 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 86.29 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 86.28 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 86.24 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 86.16 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 86.16 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 86.13 | |
| TIGR03783 | 829 | Bac_Flav_CT_G Bacteroides conjugation system ATPas | 86.12 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 86.07 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 85.93 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 85.92 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 85.73 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 85.66 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 85.58 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 85.55 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 85.55 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 85.52 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 85.49 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 85.48 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 85.42 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 85.39 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 85.32 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 85.17 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 84.99 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 84.96 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 84.85 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 84.75 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 84.62 | |
| COG3911 | 183 | Predicted ATPase [General function prediction only | 84.58 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 84.5 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 84.49 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 84.46 | |
| PRK13507 | 587 | formate--tetrahydrofolate ligase; Provisional | 84.39 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 84.38 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 84.27 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 84.23 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 84.19 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 84.16 | |
| TIGR02746 | 797 | TraC-F-type type-IV secretion system protein TraC. | 84.09 | |
| KOG2878 | 282 | consensus Predicted kinase [General function predi | 83.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 83.92 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 83.87 | |
| TIGR03172 | 232 | probable selenium-dependent hydroxylase accessory | 83.81 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 83.71 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 83.63 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 83.59 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 83.57 |
| >KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-54 Score=388.98 Aligned_cols=313 Identities=40% Similarity=0.658 Sum_probs=279.9
Q ss_pred chhhhhcCCCcEEEEEeCCCcchhhHHHHHHHHHHHHCCCCEEEEecCCCCCcchHhhccccCCccccccCCCCCeeeec
Q 015096 79 GFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALE 158 (413)
Q Consensus 79 ~~~~~~~~~~~~i~v~sgKGGvGKTTvAa~LA~~lA~~G~rVLlvD~D~~~~l~~~lg~~~~~~~~~~v~~~~~~l~~~~ 158 (413)
++..++++...+++|++|||||||||+|+.||..||+-+.+||+|++||+||+++.|+++. ++.|+.+.|.++ |++++
T Consensus 9 ~l~nil~q~slKwifVGGKGGVGKTTcs~sLAvqla~~r~~vLiISTDPAHNlSDAF~qkf-tk~pt~V~Gf~n-LfAME 86 (323)
T KOG2825|consen 9 TLQNILEQTSLKWIFVGGKGGVGKTTCSCSLAVQLAKVRESVLIISTDPAHNLSDAFSQKF-TKTPTKVEGFEN-LFAME 86 (323)
T ss_pred hHHHHhhcceeeEEEEcCcCCcCccchhhHHHHHHhccCCceEEeecCcccchHHHHHHHh-cCCCccccChhh-heeee
Confidence 6677888899999999999999999999999999999999999999999999999999998 589999999887 99999
Q ss_pred cChHHHHHHHHhhhhccCCcchhhhhcccchhhHHHHHhhhhcccccCCCCCCHHHHHHHHHHHHHHHhcccCCccEEEE
Q 015096 159 INPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLESQEYSMFTRIVF 238 (413)
Q Consensus 159 ~d~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~l~~~~~~~~l~~~~pg~~e~~~~~~l~~~l~~~~~~~yD~IVi 238 (413)
+||.....+..+...... ..... .|.+.+.+... ..||.+|.++...+.+++.. . +||.|||
T Consensus 87 IDp~~e~~~~~~m~~~~~---~n~~~--~g~g~l~e~~~----------~~Pgideamsfae~~klvk~--~-~F~~vVF 148 (323)
T KOG2825|consen 87 IDPNVEMGDMPEMFGNAA---NNEGS--DGKGMLQELAN----------AFPGIDEAMSFAEVMKLVKG--M-NFDVVVF 148 (323)
T ss_pred cCCchhhhhhHHHhhccc---ccccc--cchhHHHHHHh----------cCCChhHHHhHHHHHHHhhc--c-ccceEEe
Confidence 999987776665433221 11222 22333433332 37999999999999999975 3 3999999
Q ss_pred cCCCChhHHHhcCChHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCcc-chhhHHHHHHHHHHHHHHHHHHhcCCCCceEE
Q 015096 239 DTAPTGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQ-NRQGASDKLERLRERMVKVRELFRDTDSTEFV 317 (413)
Q Consensus 239 DtpP~~~~l~~l~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~g~~~-~~~~~~~~l~~~~~~~~~~~~~l~d~~~t~~v 317 (413)
||+|||||+|+|.+|..+++.+++++.++.|+.+..+.+.+.||.+. ..+++...++.+++.++++++.++||+.|.||
T Consensus 149 DTAPTGHTLRlL~fP~~lek~lgKl~~l~~k~~pm~sq~~sm~g~~~~~~~~l~~kle~~~~~i~~vn~qFkdpd~TtFV 228 (323)
T KOG2825|consen 149 DTAPTGHTLRLLQFPTTLEKGLGKLLSLKNKIGPMLSQMGSMFGMEDAGADDLAGKLEELLEVIEKVNEQFKDPDCTTFV 228 (323)
T ss_pred ccCCCcceehhhccchHHHHHHHHHHHHHHHHHHHHHHHhhhhccccCCHHHHHHHHHHHHHHHHHHHHHcCCCCCceEE
Confidence 99999999999999999999999999999999999999999999864 56899999999999999999999999999999
Q ss_pred EEEcCCcccHHHHHHHHHHHHhCCCCCCeEEEecccCCCC-CchHHHHHHHHHHHHHHHHhHhcCCCCCCceEEecCCCC
Q 015096 318 IVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSA-SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDV 396 (413)
Q Consensus 318 lVt~p~~~~~~~~~r~~~~l~~~g~~~~gvVvN~v~p~~~-~~~~~~~~~~~~q~~~l~~i~~~~~~~~~~~~~~P~~~~ 396 (413)
.|+.|+.+++.|++|++..|.+.++++..+|||+++++.. ..|..|..|++.|.+||..|.++++ +..+..+|+++.
T Consensus 229 cVcI~eflslyEteRliqeL~k~~idthnIIVNQLL~~~~~~~ck~C~ar~k~Q~kyLdqi~elye--dfhv~klPl~~~ 306 (323)
T KOG2825|consen 229 CVCIAEFLSLYETERLIQELAKQGIDTHNIIVNQLLFPDNEVSCKKCAARRKMQSKYLDQIEELYE--DFHVVKLPLLPM 306 (323)
T ss_pred EEEHHHHHhHHHHHHHHHHHHhcCCcccceeeeeccCCCCccchHHHHHHHHHHHHHhhhHHHHHh--hcceeecccchh
Confidence 9999999999999999999999999999999999988766 7899999999999999999999754 689999999999
Q ss_pred CCCCHHHHHHHHHHhhC
Q 015096 397 EIRGVPALRFMGDIIWK 413 (413)
Q Consensus 397 e~~g~~~L~~l~~~~~~ 413 (413)
|++|+++|+.|++.+||
T Consensus 307 EvrG~~al~~fse~l~k 323 (323)
T KOG2825|consen 307 EVRGVEALNFFSEILLK 323 (323)
T ss_pred hhcCHHHHHHHHHHhcC
Confidence 99999999999999986
|
|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >TIGR00345 arsA arsenite-activated ATPase (arsA) | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >PRK05632 phosphate acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12374 putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK13505 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK13506 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position [] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >COG2403 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00682 lpxK tetraacyldisaccharide 4'-kinase | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02327 CTP synthase | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01906 tetraacyldisaccharide 4'-kinase; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK05380 pyrG CTP synthetase; Validated | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00337 PyrG CTP synthase | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >COG3911 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13507 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >TIGR02746 TraC-F-type type-IV secretion system protein TraC | Back alignment and domain information |
|---|
| >KOG2878 consensus Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 413 | ||||
| 3zq6_A | 324 | Adp-Alf4 Complex Of M. Therm. Trc40 Length = 324 | 2e-42 | ||
| 3ug6_A | 349 | Crystal Structure Of Get3 From Methanocaldococcus J | 1e-38 | ||
| 3iqw_A | 334 | Amppnp Complex Of C. Therm. Get3 Length = 334 | 4e-32 | ||
| 2woo_A | 329 | Nucleotide-Free Form Of S. Pombe Get3 Length = 329 | 2e-30 | ||
| 3ibg_A | 348 | Crystal Structure Of Aspergillus Fumigatus Get3 Wit | 1e-28 | ||
| 3io3_A | 348 | Get3 With Adp From D. Hansenii In Closed Form Lengt | 6e-25 | ||
| 3idq_A | 369 | Crystal Structure Of S. Cerevisiae Get3 At 3.7 Angs | 3e-24 | ||
| 3vlc_A | 354 | Crystal Structure Of S. Cerevisiae Get3 In The Semi | 3e-24 | ||
| 2woj_A | 354 | Adp-Alf4 Complex Of S. Cerevisiae Get3 Length = 354 | 3e-24 | ||
| 3sja_A | 362 | Crystal Structure Of S. Cerevisiae Get3 In The Open | 3e-24 | ||
| 3a36_A | 362 | Structural Insight Into The Membrane Insertion Of T | 4e-24 | ||
| 1f48_A | 589 | Crystal Structure Of The Escherichia Coli Arsenite- | 9e-15 |
| >pdb|3ZQ6|A Chain A, Adp-Alf4 Complex Of M. Therm. Trc40 Length = 324 | Back alignment and structure |
|
| >pdb|3UG6|A Chain A, Crystal Structure Of Get3 From Methanocaldococcus Jannaschii Length = 349 | Back alignment and structure |
| >pdb|3IQW|A Chain A, Amppnp Complex Of C. Therm. Get3 Length = 334 | Back alignment and structure |
| >pdb|2WOO|A Chain A, Nucleotide-Free Form Of S. Pombe Get3 Length = 329 | Back alignment and structure |
| >pdb|3IBG|A Chain A, Crystal Structure Of Aspergillus Fumigatus Get3 With Bound Adp Length = 348 | Back alignment and structure |
| >pdb|3IO3|A Chain A, Get3 With Adp From D. Hansenii In Closed Form Length = 348 | Back alignment and structure |
| >pdb|3IDQ|A Chain A, Crystal Structure Of S. Cerevisiae Get3 At 3.7 Angstrom Resolution Length = 369 | Back alignment and structure |
| >pdb|3VLC|A Chain A, Crystal Structure Of S. Cerevisiae Get3 In The Semi Open Conformation In Complex With Get1 Cytosolic Domain At 4.5 Angstrom Resolution Length = 354 | Back alignment and structure |
| >pdb|2WOJ|A Chain A, Adp-Alf4 Complex Of S. Cerevisiae Get3 Length = 354 | Back alignment and structure |
| >pdb|3SJA|A Chain A, Crystal Structure Of S. Cerevisiae Get3 In The Open State In Complex With Get1 Cytosolic Domain Length = 362 | Back alignment and structure |
| >pdb|3A36|A Chain A, Structural Insight Into The Membrane Insertion Of Tail- Anchored Proteins By Get3 Length = 362 | Back alignment and structure |
| >pdb|1F48|A Chain A, Crystal Structure Of The Escherichia Coli Arsenite-Translocating Atpase Length = 589 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 1e-104 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 5e-98 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 2e-97 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 3e-95 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 8e-95 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 2e-94 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 1e-82 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 4e-74 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 2e-64 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-13 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 8e-08 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 2e-07 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 6e-06 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 6e-05 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 9e-05 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 1e-04 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 1e-04 |
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 | Back alignment and structure |
|---|
Score = 310 bits (795), Expect = e-104
Identities = 98/342 (28%), Positives = 171/342 (50%), Gaps = 24/342 (7%)
Query: 72 APSEAVSGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSL 131
+ + ++ T K+ +GGKGGVGKT+ + SLA++ + L++STDPAH+L
Sbjct: 2 SFDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNL 61
Query: 132 SDSFAQDLTGGQLVPVEGPDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGM 191
SD+F G V G D L A+EI+P + +E L
Sbjct: 62 SDAFGTKF-GKDARKVPGFD-NLSAMEIDPNLSIQEMTE--------QADQQNPNNPLSG 111
Query: 192 LVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLESQEYSMFTRIVFDTAPTGHTLRLLS 251
+++ L PG+DEA+A +++++ ++S E+ ++FDTAPTGHTLR L+
Sbjct: 112 MMQDLA---------FTIPGIDEALAFAEILKQIKSMEFD---CVIFDTAPTGHTLRFLN 159
Query: 252 LPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDT 311
P L+ ++GK+ L + + + S+ G N Q K+E +R + +V + F++
Sbjct: 160 FPTVLEKALGKLGGLSSRFGPMINQMGSIMGVNANEQDLFGKMESMRANISEVNKQFKNP 219
Query: 312 DSTEFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQIIPPSASDCKFCAMKRKDQM 371
D T FV V I +++ E+ R+ + L + ++VNQ++ + C C +RK Q
Sbjct: 220 DLTTFVCVCISEFLSLYETERMIQELTSYEIDTHNIVVNQLLLDPNTTCPQCMARRKMQQ 279
Query: 372 RALEMIKSDSELSSLMLIEAPLVDVEIRGVPALRFMGDIIWK 413
+ L I + +++ P V E+RG AL+ +++ K
Sbjct: 280 KYLAQI--EELYEDFHVVKVPQVPAEVRGTEALKSFSEMLVK 319
|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Length = 354 | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Length = 348 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 100.0 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 100.0 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 100.0 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 100.0 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 100.0 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 100.0 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 100.0 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 100.0 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 100.0 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 99.94 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 99.94 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 99.92 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 99.9 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 99.89 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 99.89 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 99.89 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 99.89 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 99.88 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 99.87 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 99.87 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 99.87 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 99.86 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 99.85 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 99.85 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 99.85 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 99.85 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 99.84 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 99.83 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 99.83 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 99.81 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 99.81 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 99.79 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 99.72 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 99.47 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 99.38 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 99.36 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 99.31 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 99.25 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.23 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 99.18 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 99.17 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 99.16 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 99.09 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 99.04 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 99.01 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 99.01 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 99.0 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 99.0 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 98.93 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 98.75 | |
| 3pzx_A | 557 | Formate--tetrahydrofolate ligase; HET: TOE; 2.20A | 98.23 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.99 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.81 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.81 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.78 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 97.42 | |
| 2obn_A | 349 | Hypothetical protein; structural genomics, joint c | 97.4 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.15 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.1 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.04 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.01 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.95 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.91 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.7 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.68 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.46 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 96.4 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.39 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.39 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.37 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.36 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 96.35 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.28 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 96.25 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.14 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.98 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.97 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 95.93 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 95.92 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.91 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.82 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.79 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.79 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 95.78 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 95.75 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.73 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 95.73 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.7 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 95.66 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.64 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.58 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 95.57 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 95.56 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.54 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.53 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.42 | |
| 2c5m_A | 294 | CTP synthase; cytidine 5-prime triphosphate synthe | 95.29 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 95.25 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.16 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.15 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.15 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 95.09 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 95.08 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 95.07 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.04 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 95.01 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 94.96 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.96 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 94.9 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.88 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.8 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.8 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 94.78 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.56 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 94.54 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 94.51 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 94.37 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 94.34 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 94.33 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 94.3 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.29 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.22 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.19 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 94.18 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 94.04 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 94.04 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 94.03 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 94.01 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 93.99 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 93.91 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.9 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.9 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 93.81 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 93.57 | |
| 2g0t_A | 350 | Conserved hypothetical protein; structural genomic | 93.56 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 93.55 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 93.55 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 93.54 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 93.53 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 93.48 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 93.46 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.45 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 93.44 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 93.42 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 93.42 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 93.4 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 93.38 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 93.3 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 93.27 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 93.25 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 93.25 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 93.24 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.22 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 93.2 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.18 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 93.18 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 93.09 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 93.04 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.99 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.96 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 92.88 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.84 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.84 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 92.77 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 92.75 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.74 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 92.73 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 92.71 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 92.7 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 92.66 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 92.58 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 92.54 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 92.5 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 92.47 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.47 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 92.44 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 92.4 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 92.39 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.39 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 92.35 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 92.27 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 92.25 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 92.24 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 92.2 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.14 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 92.11 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 91.99 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 91.97 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 91.87 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 91.82 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 91.78 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 91.75 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 91.72 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 91.66 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.66 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.59 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 91.53 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 91.47 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 91.42 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 91.4 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 91.38 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.38 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 91.36 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 91.27 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 91.25 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 91.16 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 91.08 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 91.08 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 91.05 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 91.05 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 91.01 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 90.92 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 90.85 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 90.76 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 90.66 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 90.66 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 90.62 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 90.55 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 90.51 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 90.45 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 90.27 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 90.25 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 90.24 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 90.2 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 90.07 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 89.99 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 89.98 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 89.97 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 89.92 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 89.74 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 89.73 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 89.52 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.43 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 89.26 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 89.2 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 88.96 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 88.84 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 88.77 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.66 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 88.63 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 88.52 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 88.42 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 88.39 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 88.33 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 88.3 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 88.07 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.06 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 88.02 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 88.0 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 87.88 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 87.86 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 87.82 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 87.76 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 87.73 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 87.73 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 87.49 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 87.48 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 87.41 | |
| 2vo1_A | 295 | CTP synthase 1; pyrimidine biosynthesis, glutamine | 87.4 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 87.26 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 87.04 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 86.91 | |
| 3do6_A | 543 | Formate--tetrahydrofolate ligase; TM1766, putative | 86.89 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 86.69 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 86.49 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 86.4 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 86.39 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 86.38 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 85.93 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 85.72 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 85.68 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 85.43 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 85.29 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 85.28 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 85.27 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 85.21 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 84.7 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 84.57 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 84.4 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 84.38 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 84.38 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 84.21 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 84.19 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 84.12 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 84.11 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 84.1 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 84.02 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 83.95 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 83.57 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 83.45 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 83.22 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 83.18 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 83.13 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 83.01 | |
| 1w78_A | 422 | FOLC bifunctional protein; DHFS, dihydrofolate syn | 82.76 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 82.64 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 82.64 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 82.62 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 82.57 | |
| 1jbw_A | 428 | Folylpolyglutamate synthase; FPGS folate AMPPCP te | 82.52 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 82.52 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 82.13 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 81.98 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 81.95 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 81.87 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 81.87 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 81.87 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 81.86 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 81.78 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 81.58 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 81.51 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 81.5 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 81.4 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 81.38 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 81.09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 80.97 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 80.97 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 80.9 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 80.68 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 80.62 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 80.45 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 80.38 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 80.12 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 80.05 |
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-51 Score=401.08 Aligned_cols=313 Identities=33% Similarity=0.574 Sum_probs=229.3
Q ss_pred CchhhhhcCCCcEEEEEeCCCcchhhHHHHHHHHHHHHCCCCEEEEecCCCCCcchHhhccccCCccccccCCCCCeeee
Q 015096 78 SGFDEMVAGTQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFAL 157 (413)
Q Consensus 78 ~~~~~~~~~~~~~i~v~sgKGGvGKTTvAa~LA~~lA~~G~rVLlvD~D~~~~l~~~lg~~~~~~~~~~v~~~~~~l~~~ 157 (413)
++++.++.+.+++|+|+||||||||||+|+|||.++|+.|+||+|||+|++++++.+||.+. +..+..+.+.. ++++.
T Consensus 5 ~~l~~~l~~~~~~i~~~sgkGGvGKTt~a~~lA~~la~~g~~vllid~D~~~~l~~~l~~~~-~~~~~~v~~~~-~L~~~ 82 (334)
T 3iqw_A 5 PTLQSILDQRSLRWIFVGGKGGVGKTTTSCSLAIQLAKVRRSVLLLSTDPAHNLSDAFSQKF-GKEARLVEGFD-NLYAM 82 (334)
T ss_dssp SSSHHHHHCTTCCEEEEECSTTSSHHHHHHHHHHHHTTSSSCEEEEECCSSCHHHHHHTSCC-CSSCEECTTCS-SEEEE
T ss_pred ccHHHHhcCCCeEEEEEeCCCCccHHHHHHHHHHHHHhCCCcEEEEECCCCCChhHHhcccc-CCCceeecCCC-Cceee
Confidence 45666777788899999999999999999999999999999999999999999999999876 45566665544 49999
Q ss_pred ccChHHHHHHHHhhhhccCCcchhhhhcccchhhHHHHHhhhhcccccCCCCCCHHHHHHHHHHHHHHHhcccCCccEEE
Q 015096 158 EINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLESQEYSMFTRIV 237 (413)
Q Consensus 158 ~~d~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~l~~~~~~~~l~~~~pg~~e~~~~~~l~~~l~~~~~~~yD~IV 237 (413)
++|++..+.++........ .. ...++. +. ..+....||++|.+.+.++.+++. +.+|||||
T Consensus 83 ~id~~~~~~~~~~~~~~~~----~~--~~~~l~-~~---------~~~~~~~Pg~~e~~~~~~~~~~~~---~~~yD~VI 143 (334)
T 3iqw_A 83 EIDPNGSMQDLLAGQTGDG----DA--GMGGVG-VM---------QDLAYAIPGIDEAMSFAEVLKQVN---SLSYETIV 143 (334)
T ss_dssp ECCC------------------------------------------------CCHHHHHHHHHHHHHHH---TSSCSEEE
T ss_pred ecCHHHHHHHHHHHhhccc----cc--ccccch-hh---------HHhhcCCCCHHHHHHHHHHHHHHH---hCCCCEEE
Confidence 9999988877654221110 00 000110 00 111133699999999999999886 35799999
Q ss_pred EcCCCChhHHHhcCChHHHHHHHHHHHHHHHHHHHHHHHHHhhhCC---ccchhhHHHHHHHHHHHHHHHHHHhcCCCCc
Q 015096 238 FDTAPTGHTLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQ---EQNRQGASDKLERLRERMVKVRELFRDTDST 314 (413)
Q Consensus 238 iDtpP~~~~l~~l~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~g~---~~~~~~~~~~l~~~~~~~~~~~~~l~d~~~t 314 (413)
|||||+||++++|.+|+.+.+|++++++++.++..+.+.+.+.+|. ....+++++.++.++++++++++.|+||..|
T Consensus 144 iDtpPtg~tLrlL~lp~~l~~~l~~~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~~l~~~~~~~~~~~~~L~dp~~t 223 (334)
T 3iqw_A 144 FDTAPTGHTLRFLQFPTVLEKALAKVSQLSGQYGSLLNGILGGSGTLPNGQTLSDVMEKLDSLRVTISEVNAQFKDERLT 223 (334)
T ss_dssp EECCCHHHHHHHHTHHHHC-----------------------------------CCHHHHHHHHHHHHHHHHHHTCTTTE
T ss_pred EeCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcccccHHHHHHHHHHHHHHHHHHHHHhhCCCCe
Confidence 9999999999999999999999999999999998888877777765 2345788999999999999999999999999
Q ss_pred eEEEEEcCCcccHHHHHHHHHHHHhCCCCCCeEEEeccc-CCCCCchHHHHHHHHHHHHHHHHhHhcCCCCC-CceEEec
Q 015096 315 EFVIVTIPTVMAVSESSRLSESLKKENVPVKRLIVNQII-PPSASDCKFCAMKRKDQMRALEMIKSDSELSS-LMLIEAP 392 (413)
Q Consensus 315 ~~vlVt~p~~~~~~~~~r~~~~l~~~g~~~~gvVvN~v~-p~~~~~~~~~~~~~~~q~~~l~~i~~~~~~~~-~~~~~~P 392 (413)
++++|++|+.+++.+++|+++.|++.|+++.|+|+|++. |.....|++|..+.+.|.++|++|++. |.+ .+++.+|
T Consensus 224 ~~vlVt~pe~~~~~ea~r~~~~L~~~gi~v~gvVvN~~~~p~~~~~~~~~~~r~~~q~~~l~~i~~~--~~~~~~~~~~p 301 (334)
T 3iqw_A 224 TFVCVCIPEFLSLYETERMIQELANYGIDTHCIVVNQLLFPKPGSDCEQCTARRRMQKKYLDQIEEL--YDEEFNVVKMP 301 (334)
T ss_dssp EEEEEECSSHHHHHHHHHHHHHHHHTTCCEEEEEEEEECCCCTTCCCHHHHHHHHHHHHHHHHHHHH--HTTTSEEEEEE
T ss_pred eEEEEECCCccHHHHHHHHHHHHHHCCCCccEEEECCCcCcccCCcCHHHHHHHHHHHHHHHHHHHh--ccCCCCEEEec
Confidence 999999999999999999999999999999999999998 554568999999999999999999984 567 8999999
Q ss_pred CCCCCCCCHHHHHHHHHHhhC
Q 015096 393 LVDVEIRGVPALRFMGDIIWK 413 (413)
Q Consensus 393 ~~~~e~~g~~~L~~l~~~~~~ 413 (413)
++..||+|+++|+.|++.+|+
T Consensus 302 l~~~e~~G~~~L~~~~~~l~~ 322 (334)
T 3iqw_A 302 LLVEEVRGKERLEKFSEMLIK 322 (334)
T ss_dssp CCSSCCCHHHHHHHHHHHHHS
T ss_pred CCCCCCCCHHHHHHHHHHHcC
Confidence 999999999999999999985
|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 413 | ||||
| d1ihua1 | 296 | c.37.1.10 (A:1-296) Arsenite-translocating ATPase | 1e-48 | |
| d1ihua2 | 279 | c.37.1.10 (A:308-586) Arsenite-translocating ATPas | 9e-42 | |
| d1hyqa_ | 232 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 1e-07 | |
| d1g3qa_ | 237 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 4e-07 | |
| d1cp2a_ | 269 | c.37.1.10 (A:) Nitrogenase iron protein {Clostridi | 6e-07 | |
| d2afhe1 | 289 | c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot | 2e-06 | |
| d1okkd2 | 207 | c.37.1.10 (D:97-303) GTPase domain of the signal r | 9e-04 | |
| d1ls1a2 | 207 | c.37.1.10 (A:89-295) GTPase domain of the signal s | 0.003 |
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Arsenite-translocating ATPase ArsA species: Escherichia coli [TaxId: 562]
Score = 165 bits (417), Expect = 1e-48
Identities = 81/319 (25%), Positives = 131/319 (41%), Gaps = 37/319 (11%)
Query: 90 KYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEG 149
Y GKGGVGKTS + + A++ A G L+VSTDPA ++ F+Q + G +
Sbjct: 9 PYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSQTI--GNTIQAIA 66
Query: 150 PDFPLFALEINPEKAREEFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPP 209
L ALEI+P+ A +++R +K + + + +L T
Sbjct: 67 SVPGLSALEIDPQAAAQQYR----ARIVDPIKGVLPDDVVSSI-----NEQLSGACTTEI 117
Query: 210 PGLDEAIAISKVIQFLESQEYSMFTRIVFDTAPTGHTLRLLSLPDFLDASIGKILKLREK 269
DE ++ + F I+FDTAPTGHT+RLL LP + I +
Sbjct: 118 AAFDEFTG-----LLTDASLLTRFDHIIFDTAPTGHTIRLLQLPGAWSSFIDSNPEGASC 172
Query: 270 IASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVMAVSE 329
+ G LE+ RE+ E D T V+V + E
Sbjct: 173 L------------------GPMAGLEKQREQYAYAVEALSDPKRTRLVLVARLQKSTLQE 214
Query: 330 SSRLSESLKKENVPVKRLIVNQIIPPS-ASDCKFCAMKRKDQMRALEMIKSDSELSSLML 388
+R L + + L++N ++P + A++ A + + AL + ++L+ L
Sbjct: 215 VARTHLELAAIGLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALANLP--ADLAGLPT 272
Query: 389 IEAPLVDVEIRGVPALRFM 407
L V + GV AL +
Sbjct: 273 DTLFLQPVNMVGVSALSRL 291
|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 100.0 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 100.0 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 99.91 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 99.9 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 99.87 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 99.87 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 99.65 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.85 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 98.84 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.83 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.7 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.53 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.7 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.56 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.44 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.44 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.38 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.22 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.13 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.95 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 96.75 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.72 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.61 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.56 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.53 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.52 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.48 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.48 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.36 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.3 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.25 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.12 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.06 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.03 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.98 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.77 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.59 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 95.5 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.38 | |
| d1vcoa2 | 272 | CTP synthase PyrG, N-terminal domain {Thermus ther | 95.38 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.2 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.18 | |
| d1s1ma2 | 266 | CTP synthase PyrG, N-terminal domain {Escherichia | 95.16 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.09 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.07 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.97 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.85 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.83 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.56 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.55 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 94.52 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.51 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.48 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.47 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.37 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.26 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 93.71 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.5 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.46 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.43 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 93.41 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 93.34 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.2 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 93.06 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.8 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 92.6 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 92.33 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 92.19 | |
| d1eg7a_ | 549 | Formyltetrahydrofolate synthetase {Moorella thermo | 92.18 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.1 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 92.05 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 91.9 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 91.89 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 91.88 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 91.84 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 91.61 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.59 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 91.59 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 91.57 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.51 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.48 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 91.42 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.42 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 91.06 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 91.06 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 90.68 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 90.42 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 90.09 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 89.82 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 89.79 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 89.76 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 89.73 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 89.68 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 89.6 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 89.43 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 89.39 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 89.37 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 89.06 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 89.01 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 89.0 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 88.81 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 88.56 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 88.54 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 88.4 | |
| d2vo1a1 | 273 | CTP synthase PyrG, N-terminal domain {Human (Homo | 88.39 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 88.37 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 87.98 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 87.84 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 87.67 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 87.47 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 87.45 | |
| d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 87.26 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 87.13 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 87.05 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 86.88 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 86.75 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 85.89 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 85.84 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 85.35 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 85.06 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 84.8 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 84.73 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 84.72 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.53 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 84.4 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 83.95 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 83.82 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.61 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 83.35 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 83.26 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 83.23 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 83.18 | |
| d1p3da3 | 215 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 83.07 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 83.01 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 82.99 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 82.91 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 82.86 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 82.86 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 82.82 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 82.54 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 82.54 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 82.43 | |
| d2jfga3 | 204 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 81.93 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 81.91 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 81.36 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 81.34 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 81.19 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 81.09 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 81.03 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 80.83 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 80.37 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 80.14 |
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Arsenite-translocating ATPase ArsA species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=7e-43 Score=333.29 Aligned_cols=285 Identities=29% Similarity=0.408 Sum_probs=211.6
Q ss_pred CCcEEEEEeCCCcchhhHHHHHHHHHHHHCCCCEEEEecCCCCCcchHhhccccCCccccccCCCCCeeeeccChHHHHH
Q 015096 87 TQRKYYMLGGKGGVGKTSCAASLAVKFANNGHPTLVVSTDPAHSLSDSFAQDLTGGQLVPVEGPDFPLFALEINPEKARE 166 (413)
Q Consensus 87 ~~~~i~v~sgKGGvGKTTvAa~LA~~lA~~G~rVLlvD~D~~~~l~~~lg~~~~~~~~~~v~~~~~~l~~~~~d~~~~~~ 166 (413)
++.+|+|+||||||||||+|+|||.+||++|+|||+||+||++|+++.||.+. +..+..+....+ +++.+++++...+
T Consensus 6 ~~p~~i~~sGKGGVGKTTvaa~lA~~lA~~G~rVLlvD~Dp~~~l~~~lg~~~-~~~~~~~~~~~~-~~~~~~~~~~~~~ 83 (296)
T d1ihua1 6 NIPPYLFFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNVGQVFSQTI-GNTIQAIASVPG-LSALEIDPQAAAQ 83 (296)
T ss_dssp SCCSEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEEECCTTCCHHHHTTSCC-CSSCEECTTSTT-EEEEECCHHHHHH
T ss_pred CCCeEEEEECCCcChHHHHHHHHHHHHHHCCCCEEEEeCCCCCCHHHHhCCCC-cccccccccccc-cchhccChhhHHH
Confidence 44567788999999999999999999999999999999999999999999986 455555554444 9999999999888
Q ss_pred HHHhhhhccCCcchhhhhcccchhhHHHHHhhhhcccccCCCCCCHHHHHHHHHHHHHHHh-cccCCccEEEEcCCCChh
Q 015096 167 EFRNVTQKDGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKVIQFLES-QEYSMFTRIVFDTAPTGH 245 (413)
Q Consensus 167 ~~~~~~~~~~~~~l~~l~~~~~~~~~~~~l~~~~~~~~l~~~~pg~~e~~~~~~l~~~l~~-~~~~~yD~IViDtpP~~~ 245 (413)
++...... ++........+..+.... ..+...+.....++...+.. ..+++||||||||||+++
T Consensus 84 ~~~~~~~~----~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~yD~iviD~pp~~~ 148 (296)
T d1ihua1 84 QYRARIVD----PIKGVLPDDVVSSINEQL-----------SGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTAPTGH 148 (296)
T ss_dssp HHHHHHHG----GGTTTSCHHHHHHHHHHT-----------SSHHHHHHHHHHHHHHHHHCTTHHHHCSEEEESSCCCHH
T ss_pred HHHhhccc----hhhhcccccchhhhHHhh-----------hhhhhhhHHHHHHHHHHHHHhhhcccceEEEeccCCCch
Confidence 87653321 222222211111111110 01223334444555554432 224569999999999999
Q ss_pred HHHhcCChHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCccchhhHHHHHHHHHHHHHHHHHHhcCCCCceEEEEEcCCcc
Q 015096 246 TLRLLSLPDFLDASIGKILKLREKIASATSAIKSVFGQEQNRQGASDKLERLRERMVKVRELFRDTDSTEFVIVTIPTVM 325 (413)
Q Consensus 246 ~l~~l~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~~~~~~~~~~~~l~d~~~t~~vlVt~p~~~ 325 (413)
+++++.++..+.+|+........ .++ ....++.+.+.++.+.+.+.|+..|++++|++|+.+
T Consensus 149 ~l~~~~l~~~~~~~~~~~~~~~~-----------~~~-------~~~~~~~~~~~~~~~~~~~~~~~~t~~~lVt~pe~~ 210 (296)
T d1ihua1 149 TIRLLQLPGAWSSFIDSNPEGAS-----------CLG-------PMAGLEKQREQYAYAVEALSDPKRTRLVLVARLQKS 210 (296)
T ss_dssp HHHHHHCGGGGTCCC------CC-----------CCG-------GGGGCCSCHHHHHHHHHHHHCTTTEEEEEEEESCHH
T ss_pred HHHHHhHHHHHHHHHhhccchhh-----------hcc-------cccchhHHHHHHHHHHhhccCcccceeeEecCcchh
Confidence 99999999877655543222110 111 112223445667778889999999999999999999
Q ss_pred cHHHHHHHHHHHHhCCCCCCeEEEecccCCCC-CchHHHHHHHHHHHHHHHHhHhcCCCCCCceEEecCCCCCCCCHHHH
Q 015096 326 AVSESSRLSESLKKENVPVKRLIVNQIIPPSA-SDCKFCAMKRKDQMRALEMIKSDSELSSLMLIEAPLVDVEIRGVPAL 404 (413)
Q Consensus 326 ~~~~~~r~~~~l~~~g~~~~gvVvN~v~p~~~-~~~~~~~~~~~~q~~~l~~i~~~~~~~~~~~~~~P~~~~e~~g~~~L 404 (413)
++.+++|+++.+++.|+++.++|+||+.|... ..+.+|..+.+.|.+++..|++ .|.+.++..+|+++.||+|+++|
T Consensus 211 ~~~~~~r~~~~l~~~gi~~~~vVvN~v~p~~~~~~~~~~~~~~~~q~~~l~~i~~--~~~~~~~~~vp~~~~e~~G~~aL 288 (296)
T d1ihua1 211 TLQEVARTHLELAAIGLKNQYLVINGVLPKTEAANDTLAAAIWEREQEALANLPA--DLAGLPTDTLFLQPVNMVGVSAL 288 (296)
T ss_dssp HHHHHHHHHHHHHHHTCCCEEEEEEEECCGGGGSSCHHHHHHHHHHHHHHHTCCH--HHHTSCEEEEECCSSCCCSHHHH
T ss_pred HHHHHHHHHHHHHhcCCCceEEEEcCCcCccCCCCCHHHHHHHHHHHHHHHHHHH--HccCCceEEecCCCCCCcCHHHH
Confidence 99999999999999999999999999998754 3578899999999999999987 57889999999999999999999
Q ss_pred HHHH
Q 015096 405 RFMG 408 (413)
Q Consensus 405 ~~l~ 408 (413)
++|.
T Consensus 289 ~~l~ 292 (296)
T d1ihua1 289 SRLL 292 (296)
T ss_dssp HHTT
T ss_pred HHHh
Confidence 9874
|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|