Citrus Sinensis ID: 015122

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTPEEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL
cccccccccccHHHHHcHHHHHHHHHHHcccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccHHHHHHHHccEEEccccEEEEccccccHHHHHHHHHHHHHHHcccccccc
ccEEEEEccccHHHHHHHHHHHHHHHHcccccHHHcHHHHHHcEccHcccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHEEcccHHHHHHHHccHHHHHHHHHHccEEcccccEEEcccccccHHHHHHHHHHHHHHHcccccccc
magvslkcgdcGALLRSVQEAQEHaeltshsnfseSTEAVLNLVCAtcgkpcrsktetdlhrkrtghtdfvdktseaakpislevpkatadseeaidvdmsgsqpeemvepEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEhendpdidempmvpvsggggaskssltPEEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERrrrlglppedpattkssapvveekksmlpirpatKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNvaknpneekfRKIRLSNQTFQDRVGALKGGLEFLElcgfekieggeflflpreKVDMAVLNSAGSeltsainnpffgvl
magvslkcgdCGALLRSVQEAQEHAELtshsnfsesTEAVLNLVCATCGKpcrsktetdlhrkrtghtdfvdktseaakpislevpkatadseeaIDVDmsgsqpeemvEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGggaskssltpeeIKLKAQELRerarkkkeeeekrmererekeririgkelleakrieeenerkrilalrkaekeeekrAREKIrqkleedkaerrrrlglppedpattkssapvveekksmlpirpatkvEQMRECLRSLkqnhkdddakVKRAFQTLLTYignvaknpneekfrkiRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAgseltsainnpffgvl
MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGnanveaavnwvvehenDPDIDEMPMVPVSGGGGASKSSLTPEEIKLKAQelrerarkkkeeeekrmererekeririgkelleakrieeenerkrilalrkaekeeekrarekirQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL
*******CGDCGALL**********************EAVLNLVCATCGKPC********************************************************************LEAMGFPVARATRALHYSGNANVEAAVNWVVE************************************************************************************************************************************************************************VKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSA****************
****SLKCGDCGALLRSVQ**********HSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPK****************************ELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVE******************************************************************************************************************************************************M****************KVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL
MAGVSLKCGDCGALLRSVQEA**************STEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDV***************DKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG*********TPEEIKLKAQEL*********************ERIRIGKELLEAKRIEEENERKRILALRK***********KIRQKLEEDKAERRRRLGLPPE***************KSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL
*AGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPC*******LHRKRTGHTDFVDKTSEAAKPISLEVPKA*******************MVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPV***********************RERARKKK***********EKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRL**************************RPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTPEEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGKELLEAKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query413 2.2.26 [Sep-21-2011]
Q6IP50296 UBX domain-containing pro N/A no 0.406 0.567 0.367 2e-17
Q6GL77287 UBX domain-containing pro yes no 0.392 0.564 0.378 8e-17
Q6NXA9294 UBX domain-containing pro yes no 0.363 0.510 0.333 1e-15
Q6GLV4290 UBX domain-containing pro N/A no 0.418 0.596 0.339 1e-14
Q499N6297 UBX domain-containing pro yes no 0.397 0.552 0.381 1e-13
Q922Y1297 UBX domain-containing pro yes no 0.397 0.552 0.376 2e-13
P56399858 Ubiquitin carboxyl-termin no no 0.169 0.081 0.371 1e-09
Q32KW2297 UBX domain-containing pro yes no 0.401 0.558 0.359 1e-09
Q5R407858 Ubiquitin carboxyl-termin yes no 0.169 0.081 0.371 1e-09
P45974858 Ubiquitin carboxyl-termin yes no 0.169 0.081 0.371 1e-09
>sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 106/204 (51%), Gaps = 36/204 (17%)

Query: 118 LKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSS 177
           L+ L  MGF   RA +AL  +GN  +E A++W+VEHE+DPDIDE P V V  G     + 
Sbjct: 7   LESLIEMGFSSTRAEKALTATGNQGIEPAMDWLVEHEDDPDIDE-PSVVVPEGSSTDTAD 65

Query: 178 LTPEEIKLKAQELRERARK------KKEEEEKRM------------------EREREKER 213
            T        Q +   A +      +KE++ KRM                    E+EK+R
Sbjct: 66  TTDTTDTTDTQGMDTSAERLPLTEEEKEKQTKRMMELVAQKQNEREEREKKERIEQEKQR 125

Query: 214 IRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLG---- 269
            + G+EL   K+  +E E ++    R+ EK+EEK ARE++R+K+  DKA+R RR G    
Sbjct: 126 RKHGQELSAIKQKMQEQEMQKAAEDRRREKQEEKMARERVREKIARDKADRARRFGGASS 185

Query: 270 ---LPPED---PATTKS-SAPVVE 286
               PP +   PATT S S+PV E
Sbjct: 186 EPISPPAETSIPATTPSPSSPVQE 209
Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulun that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems.
Xenopus laevis (taxid: 8355)
>sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 Back     alignment and function description
>sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 Back     alignment and function description
>sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=2 SV=2 Back     alignment and function description
>sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 Back     alignment and function description
>sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 Back     alignment and function description
>sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 Back     alignment and function description
>sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
225433606413 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.837 0.0
224140845414 predicted protein [Populus trichocarpa] 1.0 0.997 0.852 0.0
224060373415 predicted protein [Populus trichocarpa] 0.987 0.983 0.838 0.0
427199320411 ubiquitin-associated/TS-N domain-contain 0.995 1.0 0.830 1e-177
356525231415 PREDICTED: UBX domain-containing protein 0.997 0.992 0.810 1e-177
356512473415 PREDICTED: UBX domain-containing protein 0.997 0.992 0.810 1e-170
449442391411 PREDICTED: uncharacterized protein LOC10 0.995 1.0 0.815 1e-169
18390444413 ubiquitin-associated (UBA)/TS-N domain-c 0.990 0.990 0.805 1e-168
297848730413 ubiquitin-associated /TS-N domain-contai 0.990 0.990 0.800 1e-167
388495734410 unknown [Lotus japonicus] 0.992 1.0 0.801 1e-167
>gi|225433606|ref|XP_002273725.1| PREDICTED: uncharacterized protein LOC100248761 [Vitis vinifera] gi|298205155|emb|CBI17214.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/413 (83%), Positives = 382/413 (92%)

Query: 1   MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDL 60
           MAGVSLKCGDCGALL+SV+EAQEHAELTSHSNFSESTEAVLNL+C  C KPCRSKTE+DL
Sbjct: 1   MAGVSLKCGDCGALLKSVEEAQEHAELTSHSNFSESTEAVLNLICTICSKPCRSKTESDL 60

Query: 61  HRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKE 120
           H KRTGHT+FVDKTSEAAKPISLEVPKAT +S+E +D   S SQP+EM+ PEVDK+LL+E
Sbjct: 61  HTKRTGHTEFVDKTSEAAKPISLEVPKATDESQEVVDASGSSSQPQEMIAPEVDKKLLEE 120

Query: 121 LEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTP 180
           LEAMGFP ARATRALHYSGN ++EAAVNWVVEHEND DIDEMP+VPV+    A K SLTP
Sbjct: 121 LEAMGFPTARATRALHYSGNTSLEAAVNWVVEHENDSDIDEMPLVPVNTKVEAPKPSLTP 180

Query: 181 EEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRK 240
           EE+K+KAQELRERARKKKEEE+KRMERE+EKERIR+GKELLEAKRIEEENERKRILALR+
Sbjct: 181 EEMKIKAQELRERARKKKEEEDKRMEREKEKERIRVGKELLEAKRIEEENERKRILALRR 240

Query: 241 AEKEEEKRAREKIRQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKV 300
           AEKEEE+RAREKIRQKLEEDKAERRR+LGLPPEDPA  K SA VV+EKK+ LP++P TKV
Sbjct: 241 AEKEEEQRAREKIRQKLEEDKAERRRKLGLPPEDPAAVKPSASVVQEKKTFLPVKPVTKV 300

Query: 301 EQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGA 360
           EQMRECLRSLKQNHKD+DAKVKRAF TLLTYIGNVAKNP+EEKFRKIRL+N +FQ+RVG 
Sbjct: 301 EQMRECLRSLKQNHKDEDAKVKRAFHTLLTYIGNVAKNPDEEKFRKIRLTNPSFQERVGG 360

Query: 361 LKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL 413
           LKGG+EFLELCGFEKIEGGEFLFLPR+KV+MAVLNSAGSEL SAI NPFFGVL
Sbjct: 361 LKGGIEFLELCGFEKIEGGEFLFLPRDKVEMAVLNSAGSELNSAIVNPFFGVL 413

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224140845|ref|XP_002323789.1| predicted protein [Populus trichocarpa] gi|222866791|gb|EEF03922.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224060373|ref|XP_002300167.1| predicted protein [Populus trichocarpa] gi|118482259|gb|ABK93057.1| unknown [Populus trichocarpa] gi|222847425|gb|EEE84972.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|427199320|gb|AFY26887.1| ubiquitin-associated/TS-N domain-containing protein [Morella rubra] Back     alignment and taxonomy information
>gi|356525231|ref|XP_003531230.1| PREDICTED: UBX domain-containing protein 1-A-like [Glycine max] Back     alignment and taxonomy information
>gi|356512473|ref|XP_003524943.1| PREDICTED: UBX domain-containing protein 1-A-like [Glycine max] Back     alignment and taxonomy information
>gi|449442391|ref|XP_004138965.1| PREDICTED: uncharacterized protein LOC101215434 [Cucumis sativus] gi|449505284|ref|XP_004162425.1| PREDICTED: uncharacterized LOC101215434 [Cucumis sativus] Back     alignment and taxonomy information
>gi|18390444|ref|NP_563718.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] gi|7211981|gb|AAF40452.1|AC004809_10 ESTs gb|N65605, gb|N38087, gb|T20485, gb|T13726, gb|N38339, gb|F15440 and gb|N97201 come from this gene [Arabidopsis thaliana] gi|17065066|gb|AAL32687.1| Unknown protein [Arabidopsis thaliana] gi|21594053|gb|AAM65971.1| unknown [Arabidopsis thaliana] gi|23197878|gb|AAN15466.1| Unknown protein [Arabidopsis thaliana] gi|332189630|gb|AEE27751.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848730|ref|XP_002892246.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338088|gb|EFH68505.1| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|388495734|gb|AFK35933.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
TAIR|locus:2010637413 AT1G04850 [Arabidopsis thalian 0.384 0.384 0.838 4.1e-134
TAIR|locus:2156489323 AT5G48690 "AT5G48690" [Arabido 0.380 0.486 0.493 2e-45
UNIPROTKB|Q9BZV1 441 UBXN6 "UBX domain-containing p 0.150 0.140 0.444 4.5e-08
FB|FBgn0034372 441 Gint3 "GDI interacting protein 0.261 0.244 0.324 8.7e-08
UNIPROTKB|F1S7L6 441 UBXN6 "Uncharacterized protein 0.147 0.138 0.451 2.4e-07
RGD|1590866 395 Ubxn6 "UBX domain protein 6" [ 0.169 0.177 0.397 3.3e-07
UNIPROTKB|F1MES6 441 UBXN6 "UBX domain-containing p 0.150 0.140 0.428 4e-07
UNIPROTKB|Q2KIJ6 441 UBXN6 "UBX domain-containing p 0.150 0.140 0.428 4e-07
MGI|MGI:1913780 442 Ubxn6 "UBX domain protein 6" [ 0.150 0.140 0.412 5.3e-07
UNIPROTKB|F1P3R7 435 UBXN6 "Uncharacterized protein 0.213 0.202 0.314 1.1e-05
TAIR|locus:2010637 AT1G04850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 707 (253.9 bits), Expect = 4.1e-134, Sum P(2) = 4.1e-134
 Identities = 135/161 (83%), Positives = 150/161 (93%)

Query:   255 QKLEEDKAERRRRLGLPPEDPATT--KSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQ 312
             QKLEEDKAERRR+LGLPPEDPAT   K S PVVEEKK  LPIRPATK EQMRECLRSLKQ
Sbjct:   253 QKLEEDKAERRRKLGLPPEDPATAAAKPSVPVVEEKKVTLPIRPATKTEQMRECLRSLKQ 312

Query:   313 NHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCG 372
              HK+DDAKVKRAFQTLLTY+GNVAKNP+EEKFRKIRL+NQTFQ+RVG+L+GG+EF+ELCG
Sbjct:   313 AHKEDDAKVKRAFQTLLTYMGNVAKNPDEEKFRKIRLTNQTFQERVGSLRGGIEFMELCG 372

Query:   373 FEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL 413
             FEKIEGGEFLFLPR+K+D A++NSAG+EL SAINNPFFGVL
Sbjct:   373 FEKIEGGEFLFLPRDKIDSAIINSAGTELNSAINNPFFGVL 413
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2156489 AT5G48690 "AT5G48690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZV1 UBXN6 "UBX domain-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0034372 Gint3 "GDI interacting protein 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7L6 UBXN6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1590866 Ubxn6 "UBX domain protein 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MES6 UBXN6 "UBX domain-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIJ6 UBXN6 "UBX domain-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1913780 Ubxn6 "UBX domain protein 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3R7 UBXN6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00038843001
SubName- Full=Chromosome chr5 scaffold_98, whole genome shotgun sequence; (413 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
cd10461107 cd10461, PUB_UBA_plant, PNGase/UBA or UBX (PUB) do 2e-60
cd0921296 cd09212, PUB, PNGase/UBA or UBX (PUB) domain of p9 3e-23
pfam0940985 pfam09409, PUB, PUB domain 3e-22
cd10460102 cd10460, PUB_UBXD1, PNGase/UBA or UBX (PUB) domain 9e-21
cd10462100 cd10462, PUB_UBA, PNGase/UBA or UBX (PUB) domain o 8e-17
cd1046396 cd10463, PUB_WLM, PNGase/UBA or UBX (PUB) domain o 4e-16
smart0058057 smart00580, PUG, domain in protein kinases, N-glyc 7e-13
cd1045993 cd10459, PUB_PNGase, PNGase/UBA or UBX (PUB) domai 6e-12
COG5207749 COG5207, UBP14, Isopeptidase T [Posttranslational 1e-07
cd0019438 cd00194, UBA, Ubiquitin Associated domain 7e-07
pfam0062737 pfam00627, UBA, UBA/TS-N domain 1e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
smart0016537 smart00165, UBA, Ubiquitin associated domain 2e-04
pfam07227446 pfam07227, DUF1423, Protein of unknown function (D 3e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-04
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 6e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
PRK12705 508 PRK12705, PRK12705, hypothetical protein; Provisio 0.003
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
>gnl|CDD|198419 cd10461, PUB_UBA_plant, PNGase/UBA or UBX (PUB) domain of plant Ubiquitin-associated (UBA) domain containing proteins Back     alignment and domain information 
 Score =  191 bits (486), Expect = 2e-60
 Identities = 80/107 (74%), Positives = 93/107 (86%)

Query: 307 LRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLE 366
           L  LK+ HKDD   VK AFQTLLTY+GNVAKNP+EEKFR+IRL+N  FQ+RVGAL+GG+E
Sbjct: 1   LVDLKKAHKDDPDAVKTAFQTLLTYLGNVAKNPDEEKFRRIRLTNAAFQERVGALRGGIE 60

Query: 367 FLELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSAINNPFFGVL 413
           FLELCGFE+ EG E L LPR+KVDMA+LN+AG+EL SAINNPFFGVL
Sbjct: 61  FLELCGFERDEGDEALVLPRDKVDMALLNTAGAELNSAINNPFFGVL 107

The PUB domain functions as a p97 (also known as valosin-containing protein or VCP) adaptor by interacting with the D1 and/or D2 ATPase domains. The type II AAA+ ATPase p97 is involved in a variety of cellular processes such as the deglycosylation of ERAD substrates, membrane fusion, transcription factor activation and cell cycle regulation through differential binding to specific adaptor proteins. The UBA domain, along with UBL (ubiquitin-like) domain, has been implicated in proteasomal degradation by associating with substrates destined for degradation as well as with subunits of the proteasome, thus regulating protein turnover. This family contains only plant UBA domain-containing proteins. Length = 107
>gnl|CDD|198416 cd09212, PUB, PNGase/UBA or UBX (PUB) domain of p97 adaptor proteins Back     alignment and domain information
>gnl|CDD|220225 pfam09409, PUB, PUB domain Back     alignment and domain information
>gnl|CDD|198418 cd10460, PUB_UBXD1, PNGase/UBA or UBX (PUB) domain of UBXD1 Back     alignment and domain information
>gnl|CDD|198420 cd10462, PUB_UBA, PNGase/UBA or UBX (PUB) domain of Ubiquitin-associated (UBA) domain containing proteins Back     alignment and domain information
>gnl|CDD|198421 cd10463, PUB_WLM, PNGase/UBA or UBX (PUB) domain of the Wss1p-like metalloprotease (WLM) family Back     alignment and domain information
>gnl|CDD|197798 smart00580, PUG, domain in protein kinases, N-glycanases and other nuclear proteins Back     alignment and domain information
>gnl|CDD|198417 cd10459, PUB_PNGase, PNGase/UBA or UBX (PUB) domain of the P97 adaptor protein Peptide:N-glycanase (PNGase) Back     alignment and domain information
>gnl|CDD|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423) Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 413
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 99.97
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 99.95
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 99.94
KOG2699407 consensus Predicted ubiquitin regulatory protein [ 99.86
PF0940987 PUB: PUB domain; InterPro: IPR018997 The PUB (also 99.75
KOG2507506 consensus Ubiquitin regulatory protein UBXD2, cont 99.68
smart0058058 PUG domain in protein kinases, N-glycanases and ot 99.03
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 98.89
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 98.7
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 98.7
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 98.39
cd02664327 Peptidase_C19H A subfamily of Peptidase C19. Pepti 97.7
cd02668324 Peptidase_C19L A subfamily of Peptidase C19. Pepti 97.68
cd02667279 Peptidase_C19K A subfamily of Peptidase C19. Pepti 97.63
cd02660328 Peptidase_C19D A subfamily of Peptidase C19. Pepti 97.59
cd02663300 Peptidase_C19G A subfamily of Peptidase C19. Pepti 97.42
cd02657305 Peptidase_C19A A subfamily of Peptidase C19. Pepti 97.37
cd02661304 Peptidase_C19E A subfamily of Peptidase C19. Pepti 97.33
cd02658311 Peptidase_C19B A subfamily of Peptidase C19. Pepti 97.31
cd02659334 peptidase_C19C A subfamily of Peptidase C19. Pepti 97.27
cd02671332 Peptidase_C19O A subfamily of Peptidase C19. Pepti 97.16
cd02674230 Peptidase_C19R A subfamily of peptidase C19. Pepti 97.1
cd02673245 Peptidase_C19Q A subfamily of Peptidase C19. Pepti 96.94
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 96.87
KOG1865545 consensus Ubiquitin carboxyl-terminal hydrolase [P 96.57
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 96.35
COG5533415 UBP5 Ubiquitin C-terminal hydrolase [Posttranslati 95.69
cd02662240 Peptidase_C19F A subfamily of Peptidase C19. Pepti 95.42
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 95.06
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 94.91
KOG4598 1203 consensus Putative ubiquitin-specific protease [Po 94.68
KOG0011340 consensus Nucleotide excision repair factor NEF2, 94.42
KOG0011340 consensus Nucleotide excision repair factor NEF2, 94.11
cd02257255 Peptidase_C19 Peptidase C19 contains ubiquitinyl h 93.87
cd02672268 Peptidase_C19P A subfamily of Peptidase C19. Pepti 93.7
KOG01631259 consensus Myosin class VI heavy chain [Cytoskeleto 93.69
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 93.17
PTZ00266 1021 NIMA-related protein kinase; Provisional 92.75
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 92.56
cd02669440 Peptidase_C19M A subfamily of Peptidase C19. Pepti 92.15
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 92.06
KOG1866 944 consensus Ubiquitin carboxyl-terminal hydrolase [P 91.94
PTZ00266 1021 NIMA-related protein kinase; Provisional 91.25
smart0054643 CUE Domain that may be involved in binding ubiquit 90.13
COG177355 Rubredoxin [Energy production and conversion] 88.92
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 88.77
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 88.42
PF00443269 UCH: Ubiquitin carboxyl-terminal hydrolase; InterP 87.35
KOG2412 591 consensus Nuclear-export-signal (NES)-containing p 87.25
PF08882112 Acetone_carb_G: Acetone carboxylase gamma subunit; 87.17
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 87.0
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 86.46
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 86.14
COG5560823 UBP12 Ubiquitin C-terminal hydrolase [Posttranslat 84.37
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 83.49
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 83.47
KOG1868653 consensus Ubiquitin C-terminal hydrolase [Posttran 82.25
cd02670241 Peptidase_C19N A subfamily of Peptidase C19. Pepti 82.25
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 81.97
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 81.78
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 80.81
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.97  E-value=3.9e-31  Score=277.13  Aligned_cols=157  Identities=29%  Similarity=0.443  Sum_probs=131.9

Q ss_pred             CceeecCcccccccchHHH----------------HHHHhhhccCCCCcchhhhhhcccCCCCCCCCCcccccccccccc
Q 015122            3 GVSLKCGDCGALLRSVQEA----------------QEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTG   66 (413)
Q Consensus         3 ~~~l~C~~C~~~~~~~~~a----------------q~h~~~tgh~~F~e~~e~~~~~~C~~C~~~~~~~~e~~~~~K~t~   66 (413)
                      .-|++|..|++|......-                +..-+ ...++|..   .+.+|.|++||.+       +.|+|+|+
T Consensus       438 e~Rv~C~~c~kVrYs~~~~~~i~lpv~~~~~v~~~v~~~~-cleaff~p---q~~df~s~ac~~K-------~~a~kt~~  506 (763)
T KOG0944|consen  438 EDRVSCLGCRKVRYSYESEYLIQLPVPMTNEVREKVPISA-CLEAFFEP---QVDDFWSTACGEK-------KGATKTTR  506 (763)
T ss_pred             hhhhhhhccccccccchhheeeEeeccccccccccCCHHH-HHHHhcCC---cchhhhhHhhcCc-------cccccccc
Confidence            3489999999999444331                11111 33344444   3789999999987       89999999


Q ss_pred             ccccccchhcccccccccc--Cccc---cCCccccccCCC---CC-CCCcC--------cccccCHHHHHHHHhCCCCHH
Q 015122           67 HTDFVDKTSEAAKPISLEV--PKAT---ADSEEAIDVDMS---GS-QPEEM--------VEPEVDKELLKELEAMGFPVA  129 (413)
Q Consensus        67 ~~tfp~~L~v~~~r~~l~~--p~K~---~~~~~~ldl~~~---g~-~~ee~--------~~~~~~~~~l~~L~~MGF~~~  129 (413)
                      |+|||+||++|+.||.|.+  |+|+   ++|||.|||+.|   |+ |+|+.        +.+.+|+.++.||++||||.+
T Consensus       507 ~ksfP~yLiiqv~rf~~~dw~pkKld~~iempe~ldls~~rs~g~~p~ee~lpde~~~~~~~~~d~s~i~qL~~MGFp~e  586 (763)
T KOG0944|consen  507 FKSFPDYLIIQVGRFTLQDWVPKKLDVSIEMPEELDLSSYRSKGLQPGEEALPDEAPETSEFAADRSVISQLVEMGFPEE  586 (763)
T ss_pred             cccCCceEEEEeeEEEecCceeeeeccceecchhhchhhhhhcCCCCcccccCCcCcccCccchhHHHHHHHHHcCCCHH
Confidence            9999999999999999976  9999   779999999977   65 77642        445589999999999999999


Q ss_pred             HHHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCCCCCCCCC
Q 015122          130 RATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGG  170 (413)
Q Consensus       130 ~a~kAL~~tgn~~~E~A~~Wl~~h~dd~d~d~p~~~~~~~~  170 (413)
                      +|.|||++|||+++|+|+|||++||+|||+|+|+.+|+++.
T Consensus       587 ac~rAly~tgN~~aEaA~NWl~~HMdDpd~~~p~vvp~~~~  627 (763)
T KOG0944|consen  587 ACRRALYYTGNSGAEAASNWLMEHMDDPDIDDPFVVPGNSP  627 (763)
T ss_pred             HHHHHHhhhcCccHHHHHHHHHHhccCcccCCceecCCCCC
Confidence            99999999999999999999999999999999999988643

>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09409 PUB: PUB domain; InterPro: IPR018997 The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain [] Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>smart00580 PUG domain in protein kinases, N-glycanases and other nuclear proteins Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02664 Peptidase_C19H A subfamily of Peptidase C19 Back     alignment and domain information
>cd02668 Peptidase_C19L A subfamily of Peptidase C19 Back     alignment and domain information
>cd02667 Peptidase_C19K A subfamily of Peptidase C19 Back     alignment and domain information
>cd02660 Peptidase_C19D A subfamily of Peptidase C19 Back     alignment and domain information
>cd02663 Peptidase_C19G A subfamily of Peptidase C19 Back     alignment and domain information
>cd02657 Peptidase_C19A A subfamily of Peptidase C19 Back     alignment and domain information
>cd02661 Peptidase_C19E A subfamily of Peptidase C19 Back     alignment and domain information
>cd02658 Peptidase_C19B A subfamily of Peptidase C19 Back     alignment and domain information
>cd02659 peptidase_C19C A subfamily of Peptidase C19 Back     alignment and domain information
>cd02671 Peptidase_C19O A subfamily of Peptidase C19 Back     alignment and domain information
>cd02674 Peptidase_C19R A subfamily of peptidase C19 Back     alignment and domain information
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG1865 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02662 Peptidase_C19F A subfamily of Peptidase C19 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4598 consensus Putative ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>cd02672 Peptidase_C19P A subfamily of Peptidase C19 Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>cd02669 Peptidase_C19M A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1866 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>COG1773 Rubredoxin [Energy production and conversion] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>PF08882 Acetone_carb_G: Acetone carboxylase gamma subunit; InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction: CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+ It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits) Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>KOG1868 consensus Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02670 Peptidase_C19N A subfamily of Peptidase C19 Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
2ccq_A99 The Pub Domain Functions As A P97 Binding Module In 2e-07
2hpl_A100 Crystal Structure Of The Mouse P97PNGASE COMPLEX Le 7e-07
2hpj_A99 Crystal Structure Of The Pub Domain Of Mouse Pngase 8e-07
2d5u_A124 Solution Structure Of The N-Terminal Portion Of The 1e-06
2cm0_A99 The Pub Domain Functions As A P97 Binding Module In 4e-05
>pdb|2CCQ|A Chain A, The Pub Domain Functions As A P97 Binding Module In Human Peptide N-Glycanase Length = 99 Back     alignment and structure 
Iteration: 1

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 2/64 (3%)
Query: 324 AFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLF 383
           A + LLTY  N+ +NPN+EK+R IR+ N  F  R+  ++G +E L   GFE  EG   L 
Sbjct: 21  ASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFE--EGETHLI 78
Query: 384 LPRE 387
            P++
Sbjct: 79  FPKK 82
>pdb|2HPL|A Chain A, Crystal Structure Of The Mouse P97PNGASE COMPLEX Length = 100 Back     alignment and structure
>pdb|2HPJ|A Chain A, Crystal Structure Of The Pub Domain Of Mouse Pngase Length = 99 Back     alignment and structure
>pdb|2D5U|A Chain A, Solution Structure Of The N-Terminal Portion Of The Pub Domain Of Mouse Peptide:n-Glycanase Length = 124 Back     alignment and structure
>pdb|2CM0|A Chain A, The Pub Domain Functions As A P97 Binding Module In Human Peptide N-Glycanase Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
2ccq_A99 P97, peptide N-glycanase homolog; glycoprotein; 1. 9e-24
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 7e-23
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 4e-22
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 1e-21
2d5u_A124 N-glycanase 1; pngase, hydrolase; NMR {Mus musculu 2e-21
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 4e-21
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 2e-19
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 1e-15
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 6e-15
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 4e-13
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 3e-07
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 1e-11
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 1e-11
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3by4_A212 OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro 8e-09
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 9e-05
2zuo_A861 MVP, major vault protein; repeat domains, protein- 7e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 5e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-05
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 4e-05
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-04
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 2e-04
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 4e-04
>2ccq_A P97, peptide N-glycanase homolog; glycoprotein; 1.6A {Homo sapiens} SCOP: d.314.1.1 PDB: 2hpl_A 2hpj_A 2cm0_A Length = 99 Back     alignment and structure
 Score = 93.8 bits (233), Expect = 9e-24
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 308 RSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEF 367
            ++ +  ++       A + LLTY  N+ +NPN+EK+R IR+ N  F  R+  ++G +E 
Sbjct: 5   PAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVEC 64

Query: 368 LELCGFEKIEGGEFLFLPREKVDMAVLNSAGSELTSA 404
           L   GFE  EG   L  P++   +  L      +   
Sbjct: 65  LFEMGFE--EGETHLIFPKK-ASVEQLQKIRDLIAIE 98
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 84 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>2d5u_A N-glycanase 1; pngase, hydrolase; NMR {Mus musculus} SCOP: d.314.1.1 Length = 124 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A Length = 212 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
2ccq_A99 P97, peptide N-glycanase homolog; glycoprotein; 1. 99.83
2d5u_A124 N-glycanase 1; pngase, hydrolase; NMR {Mus musculu 99.83
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.81
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.71
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 99.64
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.64
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.59
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.58
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.58
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.48
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.43
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.37
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.34
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.23
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.23
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.2
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 99.17
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.16
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 99.15
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 99.13
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.12
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.05
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.03
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 98.92
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 98.9
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 98.89
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 98.78
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 98.69
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 98.68
2dna_A67 Unnamed protein product; ubiquitin associated doma 98.67
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 98.64
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 98.6
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.46
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.31
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 98.26
2cwb_A108 Chimera of immunoglobulin G binding protein G and 98.13
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 98.1
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 98.09
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 97.97
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 97.87
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 97.64
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 97.63
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 97.56
2ayn_A404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 97.53
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 97.47
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 97.4
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 97.39
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.35
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 97.13
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 97.04
1vjv_A415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 96.97
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 96.93
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 96.64
1nb8_A353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 96.28
2f1z_A522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 95.83
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 95.17
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 93.99
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 93.22
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 88.65
2dhy_A67 CUE domain-containing protein 1; structural genomi 88.03
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 85.88
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 85.22
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 84.92
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 83.9
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 82.44
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 82.09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 81.78
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 81.25
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 81.08
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 80.8
>2ccq_A P97, peptide N-glycanase homolog; glycoprotein; 1.6A {Homo sapiens} SCOP: d.314.1.1 PDB: 2hpl_A 2hpj_A 2cm0_A Back     alignment and structure
Probab=99.83  E-value=1.1e-20  Score=158.05  Aligned_cols=94  Identities=31%  Similarity=0.496  Sum_probs=84.3

Q ss_pred             HHHHHHhhhhcCCchHHHHHHHHHHHHHHhhhccCCCccccccccccchhhhhhccCcccHHHHHHHcCCeeecCCceEE
Q 015122          304 RECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLF  383 (413)
Q Consensus       304 r~~L~slk~~~~~s~a~~~~a~~tL~~~l~Ni~~~P~e~KfRrIr~~N~~f~~kV~~~~ga~e~L~a~GF~~~~~~~~lv  383 (413)
                      +.|+.+|..|+   .+.+.+|++||.+|++||+.||+|+|||+||++|++|+++|++++||++||.++||++.  ++.|+
T Consensus         4 ~~~l~~L~~n~---~~~~~~a~~tL~k~l~Nil~~P~e~KyR~Ir~~N~~f~~~v~~~~G~~e~L~a~GF~~~--~~~l~   78 (99)
T 2ccq_A            4 SPAVAELCQNT---PETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEG--ETHLI   78 (99)
T ss_dssp             SHHHHHHTSSC---HHHHHHHHHHHHHHHHHHHHCTTCGGGGEEETTCHHHHHHTTTSTTHHHHHHHHTCEEC--SSEEE
T ss_pred             HHHHHHHHhCC---HHHHHHHHHHHHHHHHHHHcCCCCcccceeecCCHHHHHHhcCCccHHHHHHHccceeC--CCeee
Confidence            46888888765   45689999999999999999999999999999999999999999999999999999964  55699


Q ss_pred             ecCCCCCHHHHHHHHHHHHH
Q 015122          384 LPREKVDMAVLNSAGSELTS  403 (413)
Q Consensus       384 l~~~~~~~~~L~~A~~~L~~  403 (413)
                      ||.+ .++..|..+++.|..
T Consensus        79 lp~~-~~~~~l~~~~d~l~~   97 (99)
T 2ccq_A           79 FPKK-ASVEQLQKIRDLIAI   97 (99)
T ss_dssp             CCTT-SCHHHHHHHHHHHHT
T ss_pred             cCCC-CCHHHHHHHHHHHHh
Confidence            9855 699999999998864
>2d5u_A N-glycanase 1; pngase, hydrolase; NMR {Mus musculus} SCOP: d.314.1.1 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A Back     alignment and structure
>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Back     alignment and structure
>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 413
d2ccqa199 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal dom 3e-23
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 1e-20
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 4e-20
d2crna151 a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig 3e-17
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 1e-16
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 2e-12
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 2e-10
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 4e-10
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 5e-07
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 3e-05
>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PUG domain-like
superfamily: PUG domain-like
family: PUG domain
domain: N-glycanase 1, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.4 bits (227), Expect = 3e-23
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 305 ECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGG 364
             +  L QN  +       A + LLTY  N+ +NPN+EK+R IR+ N  F  R+  ++G 
Sbjct: 5   PAVAELCQNTPE---TFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGA 61

Query: 365 LEFLELCGFEKIEGGEFLFLPREK 388
           +E L   GFE  EG   L  P++ 
Sbjct: 62  VECLFEMGFE--EGETHLIFPKKA 83
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
d2ccqa199 N-glycanase 1, N-terminal domain {Human (Homo sapi 99.79
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.76
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.75
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.74
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.62
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.52
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.26
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.22
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.07
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.02
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 98.36
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 97.75
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 97.72
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.72
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.71
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 97.24
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.82
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 96.3
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 96.09
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 96.05
d1nbfa_347 Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU 95.34
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 93.58
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 92.92
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 92.67
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 92.23
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 91.97
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 91.74
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 87.96
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 87.85
>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PUG domain-like
superfamily: PUG domain-like
family: PUG domain
domain: N-glycanase 1, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.6e-19  Score=149.06  Aligned_cols=83  Identities=34%  Similarity=0.588  Sum_probs=75.5

Q ss_pred             chHHHHHHHHHHHHHHhhhccCCCccccccccccchhhhhhccCcccHHHHHHHcCCeeecCCceEEecCCCCCHHHHHH
Q 015122          317 DDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQDRVGALKGGLEFLELCGFEKIEGGEFLFLPREKVDMAVLNS  396 (413)
Q Consensus       317 s~a~~~~a~~tL~~~l~Ni~~~P~e~KfRrIr~~N~~f~~kV~~~~ga~e~L~a~GF~~~~~~~~lvl~~~~~~~~~L~~  396 (413)
                      +.+...+|++||.+|+.||+.||+|+|||+||++|++|+.+|++++||.++|.++||+  ++++||+||.+ .++..|..
T Consensus        14 ~~~~~~~~l~~L~ki~~NIl~~P~e~KyR~Ir~sN~~f~~~v~~~~ga~e~L~~~GF~--e~~~~lvlp~~-~~~~~l~~   90 (99)
T d2ccqa1          14 TPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFE--EGETHLIFPKK-ASVEQLQK   90 (99)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHCTTCGGGGEEETTCHHHHHHTTTSTTHHHHHHHHTCE--ECSSEEECCTT-SCHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHcCCCCcceeeeecCCHHHHHHHcccccHHHHHHHcCce--eCCceEEecCC-CCHHHHHH
Confidence            4566899999999999999999999999999999999999999999999999999998  57899999855 57888888


Q ss_pred             HHHHHH
Q 015122          397 AGSELT  402 (413)
Q Consensus       397 A~~~L~  402 (413)
                      .++.|.
T Consensus        91 ~rd~L~   96 (99)
T d2ccqa1          91 IRDLIA   96 (99)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            877664
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure