Citrus Sinensis ID: 015126
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| 296085831 | 418 | unnamed protein product [Vitis vinifera] | 0.951 | 0.940 | 0.644 | 1e-155 | |
| 225439088 | 462 | PREDICTED: RING finger and transmembrane | 0.951 | 0.850 | 0.596 | 1e-153 | |
| 449457383 | 486 | PREDICTED: RING finger and transmembrane | 0.975 | 0.829 | 0.562 | 1e-150 | |
| 224069840 | 443 | predicted protein [Populus trichocarpa] | 0.903 | 0.841 | 0.634 | 1e-149 | |
| 297810201 | 429 | predicted protein [Arabidopsis lyrata su | 0.883 | 0.850 | 0.625 | 1e-149 | |
| 21593353 | 426 | unknown [Arabidopsis thaliana] | 0.883 | 0.856 | 0.625 | 1e-148 | |
| 18413797 | 426 | RING/U-box domain-containing protein [Ar | 0.883 | 0.856 | 0.625 | 1e-148 | |
| 255582028 | 475 | protein binding protein, putative [Ricin | 0.905 | 0.787 | 0.593 | 1e-144 | |
| 224139418 | 444 | predicted protein [Populus trichocarpa] | 0.903 | 0.840 | 0.579 | 1e-143 | |
| 356568264 | 440 | PREDICTED: RING finger and transmembrane | 0.961 | 0.902 | 0.625 | 1e-139 |
| >gi|296085831|emb|CBI31155.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 554 bits (1428), Expect = e-155, Method: Compositional matrix adjust.
Identities = 272/422 (64%), Positives = 323/422 (76%), Gaps = 29/422 (6%)
Query: 14 PDDDRTSTSASASDNSRSYEVQLPAALNLFRSPLSLLLEYS---RVMSTSQESEQDRLTV 70
P + +S + NSR Y +QL A+ N+ ++PLS LLEYS R S+ QE+E
Sbjct: 4 PGGNYRGSSEIGNGNSRRYGMQLSAS-NIIQAPLSALLEYSGLLRGRSSHQETESLIYGS 62
Query: 71 NADSEARGQTQLPNSALSTGEVSIQIIRQENGEA-TGAGEDNEGNAIGEGETVPLAASEG 129
D+EA Q Q+ +G V+++ Q GE+ G G GN G+GE A G
Sbjct: 63 VRDNEASVQ-QIAGQG--SGTVTLEGHGQGQGESRAGEGISQSGNGNGDGEA---ADGAG 116
Query: 130 STSREGSYQSYDIHQFARWVEQVLPFSLLLLVVFVRQHLQGFFVTVWITAVIFKSNDILR 189
+ R+ SYQ YDI Q ARW+EQVLPF+LLLLVVF+RQHLQGFFVT+WI+AV+FKSN+ILR
Sbjct: 117 ANGRDSSYQRYDIQQAARWIEQVLPFTLLLLVVFIRQHLQGFFVTIWISAVMFKSNEILR 176
Query: 190 KQTALK------------------VIGIYWWFRSDDILYPLLMIPPSTIPPFWHAVFIIL 231
KQTALK V G+YWW+ + D+LYPL+M+PP IPPFWHA+FII+
Sbjct: 177 KQTALKGERKISVLVGISLVFTLHVAGVYWWYHNGDLLYPLIMLPPKAIPPFWHAIFIIM 236
Query: 232 VNDTMVRQAAMAMKCLLLIYYKNGRGHNFRRQGQILTLVEYALLLYRALLPTPVWYRFFL 291
VNDT+VRQAAM KC+LL+YYKN RG N+R+QGQ+LTLVEY LLLYRALLP PVWYRFFL
Sbjct: 237 VNDTLVRQAAMVFKCILLMYYKNSRGRNYRKQGQLLTLVEYTLLLYRALLPAPVWYRFFL 296
Query: 292 NKDYGSLFSSLTTGLYLTFKLTTVVDKVQSLFAAIRALSRKEVHYGSYATTEQVNAAGDL 351
NK+YGSLFSSL TGLYLTFKLT+VV+KVQS FAA++ALSRKEVHYG+YAT+EQVNAAGDL
Sbjct: 297 NKEYGSLFSSLMTGLYLTFKLTSVVEKVQSFFAALKALSRKEVHYGAYATSEQVNAAGDL 356
Query: 352 CAICQEKMHAPILLQCKHLFCEDCVSEWLERERTCPLCRALVKPADLRSFGDGSTSLLFQ 411
CAICQEKMHAPILL+CKH+FCEDCVSEW ERERTCPLCRALVKPADLRS+GDGSTSL FQ
Sbjct: 357 CAICQEKMHAPILLRCKHIFCEDCVSEWFERERTCPLCRALVKPADLRSYGDGSTSLFFQ 416
Query: 412 LF 413
LF
Sbjct: 417 LF 418
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225439088|ref|XP_002265744.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449457383|ref|XP_004146428.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Cucumis sativus] gi|449528589|ref|XP_004171286.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224069840|ref|XP_002326427.1| predicted protein [Populus trichocarpa] gi|222833620|gb|EEE72097.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297810201|ref|XP_002872984.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318821|gb|EFH49243.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|21593353|gb|AAM65302.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18413797|ref|NP_568096.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|20466490|gb|AAM20562.1| unknown protein [Arabidopsis thaliana] gi|23198148|gb|AAN15601.1| unknown protein [Arabidopsis thaliana] gi|332003031|gb|AED90414.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255582028|ref|XP_002531811.1| protein binding protein, putative [Ricinus communis] gi|223528545|gb|EEF30568.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224139418|ref|XP_002323102.1| predicted protein [Populus trichocarpa] gi|222867732|gb|EEF04863.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356568264|ref|XP_003552333.1| PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| TAIR|locus:2185088 | 426 | AT5G01960 [Arabidopsis thalian | 0.527 | 0.511 | 0.825 | 2.2e-122 | |
| DICTYBASE|DDB_G0267718 | 592 | DDB_G0267718 [Dictyostelium di | 0.365 | 0.255 | 0.484 | 2e-43 | |
| UNIPROTKB|F1NDS9 | 347 | RNFT2 "Uncharacterized protein | 0.510 | 0.608 | 0.311 | 4.4e-34 | |
| ZFIN|ZDB-GENE-040426-2324 | 419 | rnft1 "ring finger protein, tr | 0.508 | 0.501 | 0.328 | 5.6e-34 | |
| UNIPROTKB|F1MN99 | 449 | RNFT2 "Uncharacterized protein | 0.508 | 0.467 | 0.310 | 6.2e-33 | |
| UNIPROTKB|Q96EX2 | 444 | RNFT2 "RING finger and transme | 0.510 | 0.475 | 0.307 | 6.2e-33 | |
| UNIPROTKB|J9P693 | 448 | RNFT2 "Uncharacterized protein | 0.508 | 0.468 | 0.310 | 7.9e-33 | |
| UNIPROTKB|F1RKE5 | 448 | RNFT2 "Uncharacterized protein | 0.508 | 0.468 | 0.305 | 1.6e-32 | |
| ZFIN|ZDB-GENE-050522-168 | 443 | rnft2 "ring finger protein, tr | 0.549 | 0.512 | 0.293 | 2.1e-32 | |
| MGI|MGI:2442859 | 445 | Rnft2 "ring finger protein, tr | 0.508 | 0.471 | 0.305 | 3.8e-31 |
| TAIR|locus:2185088 AT5G01960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1030 (367.6 bits), Expect = 2.2e-122, Sum P(2) = 2.2e-122
Identities = 180/218 (82%), Positives = 204/218 (93%)
Query: 196 VIGIYWWFRSDDILYPLLMIPPSTIPPFWHAVFIILVNDTMVRQAAMAMKCLLLIYYKNG 255
V+G+YWWFR DD+LYPL+M+PP +IPPFWHA+FII+VNDT+VRQA+M KC LL+YYKN
Sbjct: 209 VVGVYWWFRKDDLLYPLIMLPPKSIPPFWHAIFIIVVNDTLVRQASMIFKCFLLMYYKNS 268
Query: 256 RGHNFRRQGQILTLVEYALLLYRALLPTPVWYRFFLNKDYGSLFSSLTTGLYLTFKLTTV 315
RG N+R+QGQ+LTLVEY +LLYR+LLPTPVWYRFFLNKDYGSLFSSL TGLYLTFKLT+V
Sbjct: 269 RGRNYRKQGQLLTLVEYFMLLYRSLLPTPVWYRFFLNKDYGSLFSSLMTGLYLTFKLTSV 328
Query: 316 VDKVQSLFAAIRALSRKEVHYGSYATTEQVNAAGDLCAICQEKMHAPILLQCKHLFCEDC 375
V+KVQS F A++ALSRKEVHYGSYATTEQVNAAGDLCAICQEKMH PILL+CKH+FCEDC
Sbjct: 329 VEKVQSFFTALKALSRKEVHYGSYATTEQVNAAGDLCAICQEKMHTPILLRCKHMFCEDC 388
Query: 376 VSEWLERERTCPLCRALVKPADLRSFGDGSTSLLFQLF 413
VSEW ERERTCPLCRALVKPADL+SFGDGSTSL FQ+F
Sbjct: 389 VSEWFERERTCPLCRALVKPADLKSFGDGSTSLFFQIF 426
|
|
| DICTYBASE|DDB_G0267718 DDB_G0267718 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDS9 RNFT2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2324 rnft1 "ring finger protein, transmembrane 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MN99 RNFT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96EX2 RNFT2 "RING finger and transmembrane domain-containing protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P693 RNFT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKE5 RNFT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-168 rnft2 "ring finger protein, transmembrane 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2442859 Rnft2 "ring finger protein, transmembrane 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033639001 | SubName- Full=Chromosome chr8 scaffold_68, whole genome shotgun sequence; (436 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 3e-15 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-14 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 9e-14 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-12 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-10 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 2e-10 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 3e-10 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 2e-08 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 1e-06 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 2e-06 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 2e-06 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 4e-06 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 4e-05 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 4e-05 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 1e-04 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 5e-04 | |
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 0.002 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 0.003 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Score = 69.3 bits (170), Expect = 3e-15
Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
Query: 350 DLCAICQEKM---HAPILLQCKHLFCEDCVSEWLERERTCPLCRA 391
D C IC ++ ++L C H+F ++C+ +WL TCPLCRA
Sbjct: 1 DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRA 45
|
Length = 46 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| KOG4638 | 371 | consensus Uncharacterized conserved protein [Funct | 99.93 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 99.46 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.34 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.22 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.12 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 99.07 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.95 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.94 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.92 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.9 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.86 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.84 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.84 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.83 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.81 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.69 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.67 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.61 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.59 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.58 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.53 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.51 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.47 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.45 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.44 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.37 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.36 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.32 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.3 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.27 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.22 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.06 | |
| KOG4638 | 371 | consensus Uncharacterized conserved protein [Funct | 98.06 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.03 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.01 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.94 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.92 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.83 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.77 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.76 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 97.43 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.4 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.37 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.31 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.27 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.26 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.22 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.2 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.19 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.16 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.11 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.07 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.04 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.87 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.8 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.78 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.72 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 96.68 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.57 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.5 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.44 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 96.41 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.25 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.17 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 95.89 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.75 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 95.59 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.48 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.3 | |
| PHA02862 | 156 | 5L protein; Provisional | 95.2 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 95.11 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.05 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 94.99 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 94.89 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.72 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 94.65 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 94.53 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 94.11 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 94.08 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.04 | |
| PHA03096 | 284 | p28-like protein; Provisional | 93.13 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.1 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 92.82 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.34 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 92.18 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 92.07 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.31 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 91.26 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 90.61 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 90.55 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.38 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 90.31 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.13 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 89.85 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 89.4 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 88.83 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 86.24 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 86.12 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 85.89 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 85.54 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 85.3 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.88 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 82.07 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 81.48 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.46 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 81.43 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 81.29 |
| >KOG4638 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.9e-25 Score=219.78 Aligned_cols=285 Identities=22% Similarity=0.239 Sum_probs=198.4
Q ss_pred CCCccceeeccccccccchhhHHhhhhhcccccCCCcccccccccCCccccccccCCCCCCCCceeeEEEecCCCCccCC
Q 015126 27 DNSRSYEVQLPAALNLFRSPLSLLLEYSRVMSTSQESEQDRLTVNADSEARGQTQLPNSALSTGEVSIQIIRQENGEATG 106 (413)
Q Consensus 27 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gev~i~i~~~~~~~~~~ 106 (413)
..+++-+++ + +.|+||.|. .+|+|--+.+|.+++ +.|+..+.+.+|..+|||+|||++++++|+++
T Consensus 23 ~~~~~~s~~-a-~rs~Lqhs~---~~~tgss~~~~~Pqp---------~~ht~l~se~~~~~s~ev~~~i~s~sk~~ae~ 88 (371)
T KOG4638|consen 23 HHPFHHSMQ-A-NRSQLQHSG---PPGTGSSEAAPTPQP---------CVHTLLTSEGSCPSSGEVHIQIISISKECAEN 88 (371)
T ss_pred Cchhhhhhh-h-hhhhhccCC---CCCCCccCCCCCCCC---------CccccccccCCCCcCCceeEEEecccccchhh
Confidence 344556663 3 578887777 678877766665543 56677777888999999999999999999997
Q ss_pred CCCCCCCCc---------------cCCCCCcCccCCCCCCCCCCcccchhHHHHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 015126 107 AGEDNEGNA---------------IGEGETVPLAASEGSTSREGSYQSYDIHQFARWVEQVLPFSLLLLVVFVRQHLQGF 171 (413)
Q Consensus 107 ~~~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~s~~~~e~~~~~~~l~~~lPf~~ill~k~~~qH~~gi 171 (413)
..+.+.+.+ ..+++++-..+...++.+..+.+++|+|++++|.++++||++|+..||++||++||
T Consensus 89 a~~~~lreg~Hs~a~g~~~~r~q~~~~s~~~~~e~~~~~s~~~dnts~~ev~~~~s~~~~~lp~ifll~~~fv~dHl~gi 168 (371)
T KOG4638|consen 89 AMSRNLREGVHSCAHGCSNSRLQGLLGSERRLTEDLAAESGDLDNTSFSEVQYLFSWQQKILPFIFLLPVKFVMDHLTGI 168 (371)
T ss_pred hhhhhhccCcchhcccccchhhhcccCCcchhhhhhhccccccccchHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHH
Confidence 776644444 23334444455555666666669999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhhhhhhHHHHHhh----------------eeeeeeeeccCCcceeeeccCCCCCCchHHHHHHHHHHHH
Q 015126 172 FVTVWITAVIFKSNDILRKQTALK----------------VIGIYWWFRSDDILYPLLMIPPSTIPPFWHAVFIILVNDT 235 (413)
Q Consensus 172 ~~~i~l~~~~~~~N~~~~~qv~lk----------------v~~vy~~f~~~~l~~~l~~~~p~~~~~~~~~l~~V~v~d~ 235 (413)
+++||++++|+++|+.+|+||+++ ++.++|+|. +..|++|+.+++.+..--
T Consensus 169 ~~~ivl~~V~~~an~slk~qva~~~~~~~~i~~~~~F~~~vv~~~~~fR-------------~~sp~~~~~~~i~~~~~s 235 (371)
T KOG4638|consen 169 FLGIVLLTVFMYANKSLKNQVALLPKIILAIKSKVKFLLVVVVTVWLFR-------------SLSPPDFHGLYIPGDDSS 235 (371)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhhhhheeEeeeeeeEEEEEeeeehHHH-------------hcCCcchhheecccCCcc
Confidence 999999999999999999999986 233444443 122344444443332100
Q ss_pred HHHHHHHHHHHHHHHHhhcCCCCcccccccchhHHHHHHHHHHHHcCCchhhhhhhchhhhhHHHHHHHHHHHHHHHHH-
Q 015126 236 MVRQAAMAMKCLLLIYYKNGRGHNFRRQGQILTLVEYALLLYRALLPTPVWYRFFLNKDYGSLFSSLTTGLYLTFKLTT- 314 (413)
Q Consensus 236 ivr~~~i~lK~li~l~~~~~~~~~~~~kg~~~~~~E~~s~l~r~llp~~~W~~y~l~~~~g~i~~~Ll~~lYl~~k~~~- 314 (413)
. |.....+ .+...+.....-.-++ +.-++....+|+++.+.++|+..++...+|.++..+..++++.+++..
T Consensus 236 ~--F~~~~~v----pi~lsstc~s~~~~~~-~~kv~~~l~ly~sl~v~pv~~t~~~~~~~g~l~~~c~~l~rl~l~llp~ 308 (371)
T KOG4638|consen 236 N--FYFLGGV----PIVLSSTCKSFDICGR-VGKVRKALKLYCSLQVYPVRATGQQCTEAGDLCAICQALFRLPLILLPQ 308 (371)
T ss_pred c--eeeeeee----EEEEeeccCCcccccc-hhHHHHHHHHHhhcccCCceeEEeeHhHHHHHHHHHHHHHHhhHHhhHH
Confidence 0 0000000 0011122222222233 567888999999999999999999999999999999999999988654
Q ss_pred HH------HHHHHHHHHHHHHhhhhhhcCCCCchhhh
Q 015126 315 VV------DKVQSLFAAIRALSRKEVHYGSYATTEQV 345 (413)
Q Consensus 315 i~------~~~~~~~~~lr~l~~~~~~~~~~~~~e~~ 345 (413)
.. -+++.+..++..+.++...++.....++.
T Consensus 309 hll~~~~~~~v~~~fesis~fsrk~~~~~~y~l~~~~ 345 (371)
T KOG4638|consen 309 HLLKGHKKLEVEKIFESISVFSRKVGEVYRYSLSVKK 345 (371)
T ss_pred HHHhhCCCceEeehHHHHHHHHHhhhhheeeeeeehh
Confidence 00 11223456677777787777776665544
|
|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4638 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 413 | ||||
| 2ecn_A | 70 | Solution Structure Of The Ring Domain Of The Human | 1e-06 | ||
| 2ecj_A | 58 | Solution Structure Of The Ring Domain Of The Human | 2e-06 | ||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 1e-05 | ||
| 4epo_C | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 1e-05 | ||
| 4ayc_A | 138 | Rnf8 Ring Domain Structure Length = 138 | 2e-05 | ||
| 2ect_A | 78 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 3e-05 | ||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 5e-05 | ||
| 2ecv_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 9e-05 | ||
| 1rmd_A | 116 | Rag1 Dimerization Domain Length = 116 | 1e-04 | ||
| 2l0b_A | 91 | Solution Nmr Structure Of Zinc Finger Domain Of E3 | 3e-04 | ||
| 2k4d_A | 83 | E2-C-Cbl Recognition Is Necessary But Not Sufficien | 4e-04 | ||
| 4a49_A | 84 | Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Len | 4e-04 | ||
| 2ep4_A | 74 | Solution Structure Of Ring Finger From Human Ring F | 5e-04 | ||
| 1chc_A | 68 | Structure Of The C3hc4 Domain By 1h-Nuclear Magneti | 5e-04 | ||
| 2d8t_A | 71 | Solution Structure Of The Ring Domain Of The Human | 5e-04 | ||
| 4a4c_A | 391 | Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Comp | 7e-04 | ||
| 1iym_A | 55 | Ring-H2 Finger Domain Of El5 Length = 55 | 8e-04 | ||
| 4a4b_A | 391 | Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Za | 8e-04 | ||
| 1fbv_A | 388 | Structure Of A Cbl-Ubch7 Complex: Ring Domain Funct | 9e-04 | ||
| 2y1m_A | 389 | Structure Of Native C-Cbl Length = 389 | 9e-04 |
| >pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 | Back alignment and structure |
|
| >pdb|2ECJ|A Chain A, Solution Structure Of The Ring Domain Of The Human Tripartite Motif-Containing Protein 39 Length = 58 | Back alignment and structure |
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
| >pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 | Back alignment and structure |
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
| >pdb|2ECV|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Tripartite Motif-Containing Protein 5 Length = 85 | Back alignment and structure |
| >pdb|1RMD|A Chain A, Rag1 Dimerization Domain Length = 116 | Back alignment and structure |
| >pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 | Back alignment and structure |
| >pdb|2K4D|A Chain A, E2-C-Cbl Recognition Is Necessary But Not Sufficient For Ubiquitination Activity Length = 83 | Back alignment and structure |
| >pdb|4A49|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Length = 84 | Back alignment and structure |
| >pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 | Back alignment and structure |
| >pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 | Back alignment and structure |
| >pdb|2D8T|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 146 Length = 71 | Back alignment and structure |
| >pdb|4A4C|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 | Back alignment and structure |
| >pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 | Back alignment and structure |
| >pdb|4A4B|A Chain A, Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 | Back alignment and structure |
| >pdb|1FBV|A Chain A, Structure Of A Cbl-Ubch7 Complex: Ring Domain Function In Ubiquitin-Protein Ligases Length = 388 | Back alignment and structure |
| >pdb|2Y1M|A Chain A, Structure Of Native C-Cbl Length = 389 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 1e-22 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-19 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 1e-18 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 1e-17 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-15 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 1e-15 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-15 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 3e-15 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 1e-14 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 1e-14 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 2e-14 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 4e-14 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 8e-14 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 1e-13 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 1e-13 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 2e-13 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 3e-13 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 6e-13 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 9e-13 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 2e-12 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 9e-12 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 9e-12 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 1e-11 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 4e-11 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 5e-11 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 8e-11 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 8e-11 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 1e-10 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 1e-10 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 2e-10 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 3e-10 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 5e-10 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 6e-10 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 9e-10 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 1e-08 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 9e-10 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 1e-09 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 1e-09 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 1e-09 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 2e-09 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 2e-09 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 3e-09 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 6e-09 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 4e-08 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 4e-08 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 5e-08 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 7e-08 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 7e-08 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 9e-08 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 1e-07 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 3e-07 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 7e-07 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 7e-07 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 1e-06 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 2e-06 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 2e-06 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 3e-06 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 4e-06 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 5e-05 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 1e-04 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 1e-04 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 2e-04 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 2e-04 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 3e-04 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 3e-04 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 4e-04 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 5e-04 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 5e-04 |
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
Score = 89.8 bits (223), Expect = 1e-22
Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 3/66 (4%)
Query: 337 GSYATTEQVNAAGD--LCAICQEKMHAPILLQCKHLFCEDCVSEWLERERTCPLCRALVK 394
GS ++ +V D C IC + A ++L C H FC+ C+ +W +R R CP+CR +
Sbjct: 1 GSSGSSGRVKQLTDEEECCICMDGR-ADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMT 59
Query: 395 PADLRS 400
A+ S
Sbjct: 60 GANESS 65
|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.35 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.29 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.27 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.27 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.24 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.23 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.23 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.23 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.22 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.21 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.21 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.2 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.19 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.19 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.19 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.18 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.18 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.18 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.18 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.17 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.17 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.17 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.17 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.16 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.16 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.15 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.14 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.11 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.11 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.08 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.06 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.06 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.06 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.05 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.05 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.05 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.01 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.01 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.0 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.99 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.98 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.96 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.96 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.95 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.93 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.9 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.9 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.89 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.89 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.88 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.88 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.86 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.86 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.84 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.82 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.8 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.77 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.75 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.71 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.7 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.67 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.67 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.64 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.54 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.52 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.38 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.36 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.22 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.15 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.02 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.61 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.89 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 94.57 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 93.59 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 93.45 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 86.03 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 80.8 |
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=99.35 E-value=5.9e-13 Score=104.49 Aligned_cols=62 Identities=31% Similarity=0.725 Sum_probs=53.6
Q ss_pred hhcCCcCccccccccCC---EeecCCCCcchhhHHHHhccCCCCCCCcccccCCCccccCCCCcc
Q 015126 346 NAAGDLCAICQEKMHAP---ILLQCKHLFCEDCVSEWLERERTCPLCRALVKPADLRSFGDGSTS 407 (413)
Q Consensus 346 ~~~~~~C~ICle~~~~p---v~L~CgHiFC~~CI~~Wl~~~~tCPlCR~~i~~~~~~~~~Dgsts 407 (413)
...+..|+||++.+..+ +.++|+|.||..|+.+|+..+.+||+||+.+...++..-..|.|.
T Consensus 12 ~~~~~~C~IC~~~~~~~~~~~~~~C~H~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~ 76 (78)
T 2ect_A 12 VGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTG 76 (78)
T ss_dssp SSSSCCCTTTTSCCCTTSCEEECTTSCEEETTTTHHHHTTTCSCTTTCCCCCCSCSCCCCSSCTT
T ss_pred CCCCCCCeeCCccccCCCCEEEeCCCCeecHHHHHHHHHcCCcCcCcCCccCCcccCCCCCCCCC
Confidence 44567999999999765 457999999999999999999999999999998888777777764
|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 413 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 4e-16 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-15 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 6e-15 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-14 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 5e-13 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-12 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-12 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 5e-12 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 3e-09 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 8e-09 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 3e-08 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 5e-08 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 9e-08 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 1e-07 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 2e-05 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 3e-04 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 7e-04 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.8 bits (173), Expect = 4e-16
Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
Query: 338 SYATTEQVNAAGDLCAICQEKMHAPILLQCKHLFCEDCVSEWLE-RERTCPLCRALVKPA 396
Y ++ + LC IC E + C HL C C++ W E + CP CR +K
Sbjct: 12 QYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGT 71
Query: 397 DL 398
+
Sbjct: 72 EP 73
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.32 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.27 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.21 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.19 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.17 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.16 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.09 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.06 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.05 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.04 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.01 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.0 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.95 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.81 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.79 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.82 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 83.99 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Probab=99.32 E-value=2.7e-13 Score=103.04 Aligned_cols=49 Identities=35% Similarity=0.893 Sum_probs=43.4
Q ss_pred hcCCcCccccccccCCE-eecCCCCcchhhHHHHhccCCCCCCCcccccC
Q 015126 347 AAGDLCAICQEKMHAPI-LLQCKHLFCEDCVSEWLERERTCPLCRALVKP 395 (413)
Q Consensus 347 ~~~~~C~ICle~~~~pv-~L~CgHiFC~~CI~~Wl~~~~tCPlCR~~i~~ 395 (413)
..++.|+||++.+.++. .++|||.||.+|+.+|++.+.+||+||+.+..
T Consensus 3 ~~~d~C~IC~~~~~~~~~~~~C~H~Fc~~Ci~~w~~~~~~CP~CR~~i~~ 52 (68)
T d1chca_ 3 TVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVES 52 (68)
T ss_dssp CCCCCCSSCCSCCCSCEEETTTTEEESTTHHHHHHHHSCSTTTTCCCCCC
T ss_pred CCCCCCccCCcCccCCcEEeCCCCcCcHHHHHHHHHhCCcCCCCCcchHh
Confidence 34678999999998775 58999999999999999999999999998853
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|