Citrus Sinensis ID: 015129

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---

MAGLAPEGSQFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL

cccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccEEEcccHHHHHHHcccccccccccEEEEEccHHccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEcccccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccccccEEccccccccccccEEEEcccHHHHHHHHHHHHHHccccccccccHHccc

ccccccccccccccccccHcccccccccccccEccccccccHHHccccHHHHHHHHHcccccccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHccEEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEcEcccccccccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccEEHHcccccHHHHHHHHHHHHccccEEEEEEEHHHccccccccEEEEEEcccccHHHHEEEEccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHccccHHHHc

maglapegsqfdarqYDTKMNELlstdgqdfftsydEVYDSFDAMGLQENLLRGIYAygfekpsaiqqrgivpfckgLDVIQQaqsgtgktatfCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHAcvggtsvreDQRILQAGVHVVVGTPGRVFDMLRrqslrpdyikMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQvgvfsatmppeALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDwltdkmrsrdhtvsathgdmdqntRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVInydlptqpenylhrigrsgrfgrkgvainfvtrdderMLFDIQKFYNVVIEELpsnvadll

maglapegsqfdaRQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGvhvvvgtpgrvfDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALeitrkfmnkpvRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLaitqsvifvntrrkvdwltdkmrsrdhtvsathgdmdqntrDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYlhrigrsgrfgrkGVAINfvtrddermLFDIQKFYNVVIEELPSNVADLL

***********************LSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDK********************DIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEEL********

**********************************YDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNV*DLL

*********QFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL

******************************FFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNV****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		413	2.2.26 [Sep-21-2011]
P41381		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.953	0.0
Q40467		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.951	0.0
P41382		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.951	0.0
Q40465		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.953	0.0
P41379		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.951	0.0
Q40468		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.953	0.0
Q40470		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.944	0.0
Q40471		413	Eukaryotic initiation fac	N/A	no	1.0	1.0	0.946	0.0
P35683		414	Eukaryotic initiation fac	yes	no	1.0	0.997	0.937	0.0
Q6Z2Z4		414	Eukaryotic initiation fac	yes	no	1.0	0.997	0.937	0.0

>sp\|P41381\|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function desciption

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/413 (95%), Positives = 408/413 (98%)

Query: 1   MAGLAPEGSQFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60
           MA LAP+G+QFDARQYD+KMN+LL+ DG+DFFTSYDEVYDSFDAMGLQENLLRGIYAYGF
Sbjct: 1   MARLAPDGAQFDARQYDSKMNDLLAADGKDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 61  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL 120
           EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL 120

Query: 121 AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP 180
           AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRIL AGVHV+VGTPGRVFDMLRRQSLRP
Sbjct: 121 AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILAAGVHVIVGTPGRVFDMLRRQSLRP 180

Query: 181 DYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVR 240
           DY++MFVLDEADEMLSRGFKDQIYDIFQ+LP KVQVGVFSATMPPEAL+ITRKFMNKPVR
Sbjct: 181 DYLRMFVLDEADEMLSRGFKDQIYDIFQMLPTKVQVGVFSATMPPEALDITRKFMNKPVR 240

Query: 241 ILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR 300
           ILVKRDELTLEGIKQFYVNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR
Sbjct: 241 ILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR 300

Query: 301 SRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP 360
           +RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP
Sbjct: 301 TRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP 360

Query: 361 ENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 413
           ENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFYNV+IEELPSNVADLL
Sbjct: 361 ENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFYNVIIEELPSNVADLL 413

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Nicotiana tabacum (taxid: 4097)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q40467\|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|P41382\|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|Q40465\|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|P41379\|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1	Back alignment and function description

>sp\|Q40468\|IF415_TOBAC Eukaryotic initiation factor 4A-15 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|Q40470\|IF4A7_TOBAC Eukaryotic initiation factor 4A-7 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|Q40471\|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|P35683\|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2	Back alignment and function description

>sp\|Q6Z2Z4\|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		413
255560725		413	dead box ATP-dependent RNA helicase, put	1.0	1.0	0.983	0.0
307135861		413	helicase [Cucumis melo subsp. melo]	1.0	1.0	0.973	0.0
449458151		413	PREDICTED: eukaryotic initiation factor	1.0	1.0	0.973	0.0
283049400		413	DEAD-box RNA helicase-like protein [Prun	1.0	1.0	0.970	0.0
224073500		413	predicted protein [Populus trichocarpa]	1.0	1.0	0.970	0.0
147779855		413	hypothetical protein VITISV_040122 [Viti	1.0	1.0	0.970	0.0
225429488		413	PREDICTED: eukaryotic initiation factor	1.0	1.0	0.968	0.0
359484301		803	PREDICTED: eukaryotic initiation factor	1.0	0.514	0.968	0.0
297738640		413	unnamed protein product [Vitis vinifera]	1.0	1.0	0.968	0.0
363807008		413	uncharacterized protein LOC100786735 [Gl	1.0	1.0	0.961	0.0

>gi\|255560725\|ref\|XP_002521376.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223539454\|gb\|EEF41044.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/413 (98%), Positives = 411/413 (99%)

Query: 1   MAGLAPEGSQFDARQYDTKMNELLSTDGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60
           MAGLAPEGSQFDA+QYD KM+ELLST+GQ+FFT+YDEVYDSFDAMGLQENLLRGIYAYGF
Sbjct: 1   MAGLAPEGSQFDAKQYDAKMSELLSTEGQEFFTTYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 61  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL 120
           EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTREL 120

Query: 121 AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP 180
           AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP
Sbjct: 121 AQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRP 180

Query: 181 DYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVR 240
           DYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVR
Sbjct: 181 DYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVR 240

Query: 241 ILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR 300
           ILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR
Sbjct: 241 ILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR 300

Query: 301 SRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP 360
           SRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP
Sbjct: 301 SRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQP 360

Query: 361 ENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 413
           ENYLHRIGR GRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
Sbjct: 361 ENYLHRIGRGGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 413

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|307135861\|gb\|ADN33729.1\| helicase [Cucumis melo subsp. melo]	Back alignment and taxonomy information

>gi\|449458151\|ref\|XP_004146811.1\| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus] gi\|449476633\|ref\|XP_004154791.1\| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|283049400\|gb\|ADB07168.1\| DEAD-box RNA helicase-like protein [Prunus persica] gi\|283049402\|gb\|ADB07169.1\| DEAD-box RNA helicase-like protein [Prunus persica]	Back alignment and taxonomy information

>gi\|224073500\|ref\|XP_002304104.1\| predicted protein [Populus trichocarpa] gi\|118484805\|gb\|ABK94270.1\| unknown [Populus trichocarpa] gi\|222841536\|gb\|EEE79083.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147779855\|emb\|CAN61608.1\| hypothetical protein VITISV_040122 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225429488\|ref\|XP_002278119.1\| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera] gi\|296081635\|emb\|CBI20640.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359484301\|ref\|XP_002281247.2\| PREDICTED: eukaryotic initiation factor 4A-15-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297738640\|emb\|CBI27885.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|363807008\|ref\|NP_001242064.1\| uncharacterized protein LOC100786735 [Glycine max] gi\|255635856\|gb\|ACU18275.1\| unknown [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		413
TAIR\|locus:2020078		412	EIF4A-2 "eif4a-2" [Arabidopsis	0.995	0.997	0.937	9.8e-206
TAIR\|locus:2030285		414	AT1G72730 [Arabidopsis thalian	1.0	0.997	0.898	7.6e-199
TAIR\|locus:2088237		415	EIF4A1 "eukaryotic translation	0.941	0.937	0.938	8.1e-195
UNIPROTKB\|Q8JFP1		407	EIF4A2 "Eukaryotic initiation	0.922	0.936	0.738	6e-151
UNIPROTKB\|Q3SZ65		407	EIF4A2 "Eukaryotic initiation	0.922	0.936	0.735	3.3e-150
UNIPROTKB\|E2R3J1		407	EIF4A2 "Uncharacterized protei	0.922	0.936	0.735	3.3e-150
UNIPROTKB\|Q14240		407	EIF4A2 "Eukaryotic initiation	0.922	0.936	0.735	3.3e-150
UNIPROTKB\|A6M930		407	EIF4A2 "Eukaryotic translation	0.922	0.936	0.735	3.3e-150
MGI\|MGI:106906		407	Eif4a2 "eukaryotic translation	0.922	0.936	0.735	3.3e-150
RGD\|1309225		407	Eif4a2 "eukaryotic translation	0.922	0.936	0.735	3.3e-150

TAIR\|locus:2020078 EIF4A-2 "eif4a-2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1990 (705.6 bits), Expect = 9.8e-206, P = 9.8e-206
 Identities = 388/414 (93%), Positives = 403/414 (97%)

Query:     1 MAGLAPEGSQFDARQYDTKMNELLSTDGQD-FFTSYDEVYDSFDAMGLQENLLRGIYAYG 59
             MAG APEG+QFD RQ+D ++NE+L  DGQD FFTSYDEV++SFDAMGLQENLLRGIYAYG
Sbjct:     1 MAGSAPEGTQFDTRQFDQRLNEVL--DGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYG 58

Query:    60 FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLAPTRE 119
             FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSG+LQQLDY L+QCQALVLAPTRE
Sbjct:    59 FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYALLQCQALVLAPTRE 118

Query:   120 LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR 179
             LAQQIEKVMRALGDY GVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR
Sbjct:   119 LAQQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLR 178

Query:   180 PDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPV 239
             PD IKMFVLDEADEMLSRGFKDQIYDIFQLLP K+QVGVFSATMPPEALEITRKFM+KPV
Sbjct:   179 PDCIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPV 238

Query:   240 RILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKM 299
             RILVKRDELTLEGIKQFYVNVEKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKM
Sbjct:   239 RILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKM 298

Query:   300 RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQ 359
             RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQ
Sbjct:   299 RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQ 358

Query:   360 PENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 413
             PENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFYNVV+EELPSNVADLL
Sbjct:   359 PENYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL 412

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003743 "translation initiation factor activity" evidence=ISS

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS

GO:0046686 "response to cadmium ion" evidence=IEP;RCA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=RCA

GO:0006094 "gluconeogenesis" evidence=RCA

GO:0006096 "glycolysis" evidence=RCA

GO:0009651 "response to salt stress" evidence=RCA

TAIR\|locus:2030285 AT1G72730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2088237 EIF4A1 "eukaryotic translation initiation factor 4A1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8JFP1 EIF4A2 "Eukaryotic initiation factor 4A-II" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SZ65 EIF4A2 "Eukaryotic initiation factor 4A-II" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R3J1 EIF4A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14240 EIF4A2 "Eukaryotic initiation factor 4A-II" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A6M930 EIF4A2 "Eukaryotic translation initiation factor 4A isoform 2" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:106906 Eif4a2 "eukaryotic translation initiation factor 4A2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1309225 Eif4a2 "eukaryotic translation initiation factor 4A2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q0UU86	IF4A_PHANO	3, ., 6, ., 4, ., 1, 3	0.7191	0.9225	0.9621	N/A	no
Q40470	IF4A7_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9443	1.0	1.0	N/A	no
Q40471	IF4A9_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9467	1.0	1.0	N/A	no
P0CQ73	FAL1_CRYNB	3, ., 6, ., 4, ., 1, 3	0.6933	0.9079	0.9469	N/A	no
A7EGL7	IF4A_SCLS1	3, ., 6, ., 4, ., 1, 3	0.7165	0.9225	0.9572	N/A	no
P10630	IF4A2_MOUSE	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9361	yes	no
P35683	IF4A1_ORYSJ	3, ., 6, ., 4, ., 1, 3	0.9371	1.0	0.9975	yes	no
Q4R4Y9	IF4A2_MACFA	3, ., 6, ., 4, ., 1, 3	0.7329	0.9225	0.9338	N/A	no
A1D7N3	IF4A_NEOFI	3, ., 6, ., 4, ., 1, 3	0.7165	0.9225	0.9572	N/A	no
Q41741	IF4A_MAIZE	3, ., 6, ., 4, ., 1, 3	0.9249	0.9927	1.0	N/A	no
A4QVP2	IF4A_MAGO7	3, ., 6, ., 4, ., 1, 3	0.7217	0.9225	0.9621	N/A	no
Q6Z2Z4	IF4A3_ORYSJ	3, ., 6, ., 4, ., 1, 3	0.9371	1.0	0.9975	yes	no
Q4P331	IF4A_USTMA	3, ., 6, ., 4, ., 1, 3	0.6997	0.9491	0.9537	N/A	no
Q3SZ54	IF4A1_BOVIN	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9384	no	no
P41382	IF410_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9515	1.0	1.0	N/A	no
Q7RV88	IF4A_NEUCR	3, ., 6, ., 4, ., 1, 3	0.7217	0.9225	0.9596	N/A	no
P41381	IF4A8_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9539	1.0	1.0	N/A	no
P47943	IF4A_SCHPO	3, ., 6, ., 4, ., 1, 3	0.7165	0.9225	0.9719	yes	no
P0CQ72	FAL1_CRYNJ	3, ., 6, ., 4, ., 1, 3	0.6933	0.9079	0.9469	yes	no
Q2UPY3	IF4A_ASPOR	3, ., 6, ., 4, ., 1, 3	0.6919	0.9564	0.9382	yes	no
Q5R4X1	IF4A2_PONAB	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9361	yes	no
Q14240	IF4A2_HUMAN	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9361	yes	no
Q4WX43	IF4A_ASPFU	3, ., 6, ., 4, ., 1, 3	0.7169	0.9152	0.9310	yes	no
P41377	IF4A2_ARATH	3, ., 6, ., 4, ., 1, 3	0.9371	0.9951	0.9975	yes	no
P41376	IF4A1_ARATH	3, ., 6, ., 4, ., 1, 3	0.9396	0.9951	0.9975	yes	no
A5A6N4	IF4A1_PANTR	3, ., 6, ., 4, ., 1, 3	0.7329	0.9225	0.9384	no	no
Q40467	IF414_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9515	1.0	1.0	N/A	no
Q40466	IF413_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9492	0.8595	1.0	N/A	no
Q40465	IF411_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9539	1.0	1.0	N/A	no
O02494	IF4A_CRYPV	3, ., 6, ., 4, ., 1, 3	0.6797	0.9225	0.9407	yes	no
Q40468	IF415_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9539	1.0	1.0	N/A	no
Q02748	IF4A_DROME	3, ., 6, ., 4, ., 1, 3	0.7060	0.9225	0.9454	yes	no
P41379	IF4A2_NICPL	3, ., 6, ., 4, ., 1, 3	0.9515	1.0	1.0	N/A	no
Q5RKI1	IF4A2_RAT	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9361	yes	no
Q9CAI7	IF4A3_ARATH	3, ., 6, ., 4, ., 1, 3	0.8985	1.0	0.9975	no	no
Q5R5F5	IF4A1_PONAB	3, ., 6, ., 4, ., 1, 3	0.7303	0.9225	0.9384	yes	no
Q1DQ20	IF4A_COCIM	3, ., 6, ., 4, ., 1, 3	0.7112	0.9225	0.9572	N/A	no
Q4R8K5	IF4A1_MACFA	3, ., 6, ., 4, ., 1, 3	0.7329	0.9225	0.9384	N/A	no
Q2HFP1	IF4A_CHAGB	3, ., 6, ., 4, ., 1, 3	0.7139	0.9225	0.9596	N/A	no
P41378	IF4A_WHEAT	3, ., 6, ., 4, ., 1, 3	0.9347	1.0	0.9975	N/A	no
A2QEN5	IF4A_ASPNC	3, ., 6, ., 4, ., 1, 3	0.7007	0.9225	0.9572	yes	no
P27639	IF4A_CAEEL	3, ., 6, ., 4, ., 1, 3	0.6649	0.9588	0.9850	yes	no
A1CJT5	IF4A_ASPCL	3, ., 6, ., 4, ., 1, 3	0.7139	0.9225	0.9572	N/A	no
Q3SZ65	IF4A2_BOVIN	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9361	yes	no
Q5B948	IF4A_EMENI	3, ., 6, ., 4, ., 1, 3	0.6981	0.9225	0.9572	yes	no
P29562	IF4A1_RABIT	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9572	no	no
Q8JFP1	IF4A2_CHICK	3, ., 6, ., 4, ., 1, 3	0.7382	0.9225	0.9361	yes	no
A6RJ45	IF4A_BOTFB	3, ., 6, ., 4, ., 1, 3	0.7191	0.9225	0.9572	N/A	no
P60842	IF4A1_HUMAN	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9384	no	no
P60843	IF4A1_MOUSE	3, ., 6, ., 4, ., 1, 3	0.7356	0.9225	0.9384	no	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.13	0.993
3rd Layer	3.6.4	0.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	grail3.0110000802	SubName- Full=Putative uncharacterized protein; (413 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	grail3.0040005401	SubName- Full=Putative uncharacterized protein; (1166 aa)	•	0.800
	eugene3.00061309	hypothetical protein (798 aa)	•	0.800
	estExt_fgenesh4_pm.C_LG_XVIII0340	hypothetical protein (793 aa)	•	0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		413
PTZ00424		401	PTZ00424, PTZ00424, helicase 45; Provisional	0.0
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	1e-141
cd00268		203	cd00268, DEADc, DEAD-box helicases	1e-102
PRK11776		460	PRK11776, PRK11776, ATP-dependent RNA helicase Dbp	7e-97
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	2e-79
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	2e-74
PRK11192		434	PRK11192, PRK11192, ATP-dependent RNA helicase Srm	1e-72
PTZ00110		545	PTZ00110, PTZ00110, helicase; Provisional	3e-65
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	1e-64
PLN00206		518	PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel	3e-60
PRK04837		423	PRK04837, PRK04837, ATP-dependent RNA helicase Rhl	5e-59
PRK04537		572	PRK04537, PRK04537, ATP-dependent RNA helicase Rhl	8e-56
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	1e-54
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	1e-50
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	7e-43
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	6e-40
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	8e-28
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	5e-27
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	1e-16
COG0514		590	COG0514, RecQ, Superfamily II DNA helicase [DNA re	7e-15
COG1205		851	COG1205, COG1205, Distinct helicase family with a	5e-14
TIGR00614		470	TIGR00614, recQ_fam, ATP-dependent DNA helicase, R	7e-10
COG1202		830	COG1202, COG1202, Superfamily II helicase, archaea	1e-09
TIGR01389		591	TIGR01389, recQ, ATP-dependent DNA helicase RecQ	3e-09
COG1204		766	COG1204, COG1204, Superfamily II helicase [General	1e-08
COG1061		442	COG1061, SSL2, DNA or RNA helicases of superfamily	2e-08
PRK11057		607	PRK11057, PRK11057, ATP-dependent DNA helicase Rec	2e-08
TIGR04121		803	TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA	8e-07
TIGR00643		630	TIGR00643, recG, ATP-dependent DNA helicase RecG	2e-06
COG1111		542	COG1111, MPH1, ERCC4-like helicases [DNA replicati	1e-05
PLN03137		1195	PLN03137, PLN03137, ATP-dependent DNA helicase; Q4	5e-05
PRK09751		1490	PRK09751, PRK09751, putative ATP-dependent helicas	2e-04
TIGR00631		655	TIGR00631, uvrb, excinuclease ABC, B subunit	0.002

>gnl\|CDD\|185609 PTZ00424, PTZ00424, helicase 45; Provisional	Back alignment and domain information

 Score =  633 bits (1634), Expect = 0.0
 Identities = 277/381 (72%), Positives = 316/381 (82%)

Query: 33  TSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTA 92
           ++YDE+ DSFDA+ L E+LLRGIY+YGFEKPSAIQQRGI P   G D I QAQSGTGKTA
Sbjct: 21  SNYDEIVDSFDALKLNEDLLRGIYSYGFEKPSAIQQRGIKPILDGYDTIGQAQSGTGKTA 80

Query: 93  TFCSGILQQLDYGLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQ 152
           TF    LQ +DY L  CQAL+LAPTRELAQQI+KV+ ALGDYL V+ HACVGGT VR+D 
Sbjct: 81  TFVIAALQLIDYDLNACQALILAPTRELAQQIQKVVLALGDYLKVRCHACVGGTVVRDDI 140

Query: 153 RILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPA 212
             L+AGVH+VVGTPGRV+DM+ ++ LR D +K+F+LDEADEMLSRGFK QIYD+F+ LP 
Sbjct: 141 NKLKAGVHMVVGTPGRVYDMIDKRHLRVDDLKLFILDEADEMLSRGFKGQIYDVFKKLPP 200

Query: 213 KVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCD 272
            VQV +FSATMP E LE+T KFM  P RILVK+DELTLEGI+QFYV VEKEEWK +TLCD
Sbjct: 201 DVQVALFSATMPNEILELTTKFMRDPKRILVKKDELTLEGIRQFYVAVEKEEWKFDTLCD 260

Query: 273 LYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRV 332
           LYETL ITQ++I+ NTRRKVD+LT KM  RD TVS  HGDMDQ  RD+IMREFRSGS+RV
Sbjct: 261 LYETLTITQAIIYCNTRRKVDYLTKKMHERDFTVSCMHGDMDQKDRDLIMREFRSGSTRV 320

Query: 333 LITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLF 392
           LITTDLLARGIDVQQVSLVINYDLP  PENY+HRIGRSGRFGRKGVAINFVT DD   L 
Sbjct: 321 LITTDLLARGIDVQQVSLVINYDLPASPENYIHRIGRSGRFGRKGVAINFVTPDDIEQLK 380

Query: 393 DIQKFYNVVIEELPSNVADLL 413
           +I++ YN  IEE+P  VAD L
Sbjct: 381 EIERHYNTQIEEMPMEVADYL 401

Length = 401

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>gnl\|CDD\|240273 PTZ00110, PTZ00110, helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>gnl\|CDD\|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ	Back alignment and domain information

>gnl\|CDD\|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>gnl\|CDD\|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated	Back alignment and domain information

>gnl\|CDD\|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG	Back alignment and domain information

>gnl\|CDD\|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>gnl\|CDD\|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>gnl\|CDD\|233063 TIGR00631, uvrb, excinuclease ABC, B subunit	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		413
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00110		545	helicase; Provisional	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
PTZ00424		401	helicase 45; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0327		397	consensus Translation initiation factor 4F, helica	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0334		997	consensus RNA helicase [RNA processing and modific	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
KOG4284		980	consensus DEAD box protein [Transcription]	100.0
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
COG1202		830	Superfamily II helicase, archaea-specific [General	100.0
PHA02558		501	uvsW UvsW helicase; Provisional	100.0
COG1204		766	Superfamily II helicase [General function predicti	100.0
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK09401		1176	reverse gyrase; Reviewed	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
COG1205		851	Distinct helicase family with a unique C-terminal	100.0
KOG0354		746	consensus DEAD-box like helicase [General function	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
PRK13766		773	Hef nuclease; Provisional	100.0
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	100.0
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	100.0
PRK14701		1638	reverse gyrase; Provisional	100.0
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	100.0
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	100.0
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	100.0
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	100.0
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	100.0
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	100.0
PRK09200		790	preprotein translocase subunit SecA; Reviewed	100.0
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	100.0
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	100.0
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	100.0
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	100.0
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	100.0
PRK04914		956	ATP-dependent helicase HepA; Validated	100.0
KOG0353		695	consensus ATP-dependent DNA helicase [General func	100.0
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	100.0
PRK05580		679	primosome assembly protein PriA; Validated	100.0
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	100.0
PRK09694		878	helicase Cas3; Provisional	100.0
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	100.0
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	100.0
TIGR00595		505	priA primosomal protein N'. All proteins in this f	100.0
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.98
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.97
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.97
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.97
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.97
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.97
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.97
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.97
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.97
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.97
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.96
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.96
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.96
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.95
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.95
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.95
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.94
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.94
COG4096		875	HsdR Type I site-specific restriction-modification	99.94
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.94
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	99.94
KOG0387		923	consensus Transcription-coupled repair protein CSB	99.93
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.92
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	99.92
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	99.92
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.92
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.91
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.91
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	99.91
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	99.9
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.9
KOG1123		776	consensus RNA polymerase II transcription initiati	99.9
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.9
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.9
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	99.9
COG4889		1518	Predicted helicase [General function prediction on	99.89
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	99.89
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	99.88
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.88
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	99.88
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.88
PRK05298		652	excinuclease ABC subunit B; Provisional	99.87
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.86
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.86
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	99.85
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.85
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	99.84
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.84
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.84
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.82
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.81
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	99.81
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	99.8
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.8
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	99.79
KOG1002		791	consensus Nucleotide excision repair protein RAD16	99.77
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.77
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.77
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	99.76
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	99.75
KOG4439		901	consensus RNA polymerase II transcription terminat	99.74
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	99.74
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.73
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	99.72
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.72
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	99.71
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	99.7
COG0610		962	Type I site-specific restriction-modification syst	99.68
PRK14873		665	primosome assembly protein PriA; Provisional	99.66
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	99.64
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	99.64
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.64
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	99.63
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	99.6
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	99.52
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	99.49
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	99.41
KOG2340		698	consensus Uncharacterized conserved protein [Funct	99.35
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	99.3
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	99.3
KOG1016		1387	consensus Predicted DNA helicase, DEAD-box superfa	99.26
PRK15483		986	type III restriction-modification system StyLTI en	99.23
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	99.05
KOG1001		674	consensus Helicase-like transcription factor HLTF/	99.02
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	98.97
COG3587		985	Restriction endonuclease [Defense mechanisms]	98.93
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	98.85
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	98.83
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	98.81
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.8
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.76
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	98.72
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	98.72
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	98.67
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	98.65
PRK10536		262	hypothetical protein; Provisional	98.54
KOG1131		755	consensus RNA polymerase II transcription initiati	98.47
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	98.36
PF13245		76	AAA_19: Part of AAA domain	98.31
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	98.29
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	98.27
KOG1803		649	consensus DNA helicase [Replication, recombination	98.26
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	98.25
TIGR00376		637	DNA helicase, putative. The gene product may repre	98.23
PRK10875		615	recD exonuclease V subunit alpha; Provisional	98.22
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	98.16
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	98.13
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	98.11
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	98.09
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.97
PRK04296		190	thymidine kinase; Provisional	97.97
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	97.96
PRK08181		269	transposase; Validated	97.94
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	97.94
KOG0298		1394	consensus DEAD box-containing helicase-like transc	97.94
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	97.88
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	97.85
PRK06526		254	transposase; Provisional	97.85
PRK13889		988	conjugal transfer relaxase TraA; Provisional	97.77
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	97.77
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.72
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.65
PRK13826		1102	Dtr system oriT relaxase; Provisional	97.62
smart00382		148	AAA ATPases associated with a variety of cellular	97.61
PF13871		278	Helicase_C_4: Helicase_C-like	97.5
KOG0383		696	consensus Predicted helicase [General function pre	97.48
KOG1805		1100	consensus DNA replication helicase [Replication, r	97.44
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	97.42
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.41
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.39
PRK14974		336	cell division protein FtsY; Provisional	97.37
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	97.37
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	97.32
PRK11054		684	helD DNA helicase IV; Provisional	97.26
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	97.26
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	97.26
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	97.25
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.25
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	97.23
PRK00149		450	dnaA chromosomal replication initiation protein; R	97.23
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.22
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	97.21
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.19
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.18
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	97.18
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	97.17
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	97.16
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	97.15
PRK05642		234	DNA replication initiation factor; Validated	97.15
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	97.13
COG2256		436	MGS1 ATPase related to the helicase subunit of the	97.09
PRK12377		248	putative replication protein; Provisional	97.09
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	97.08
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	97.08
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	97.08
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	97.06
PRK09183		259	transposase/IS protein; Provisional	97.06
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	97.05
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	97.04
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	97.03
PRK08116		268	hypothetical protein; Validated	97.02
PRK06893		229	DNA replication initiation factor; Validated	97.01
PHA02533		534	17 large terminase protein; Provisional	97.0
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	97.0
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	96.99
PRK14087		450	dnaA chromosomal replication initiation protein; P	96.99
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	96.99
PRK05707		328	DNA polymerase III subunit delta'; Validated	96.96
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	96.96
PRK08769		319	DNA polymerase III subunit delta'; Validated	96.95
PRK07952		244	DNA replication protein DnaC; Validated	96.94
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	96.93
PRK12402		337	replication factor C small subunit 2; Reviewed	96.92
CHL00181		287	cbbX CbbX; Provisional	96.92
PRK08903		227	DnaA regulatory inactivator Hda; Validated	96.91
PRK08727		233	hypothetical protein; Validated	96.9
PRK14088		440	dnaA chromosomal replication initiation protein; P	96.9
PRK06921		266	hypothetical protein; Provisional	96.9
COG1484		254	DnaC DNA replication protein [DNA replication, rec	96.89
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	96.88
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	96.87
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	96.87
PRK08084		235	DNA replication initiation factor; Provisional	96.87
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	96.84
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	96.8
PF13173		128	AAA_14: AAA domain	96.77
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	96.77
PRK06835		329	DNA replication protein DnaC; Validated	96.77
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	96.76
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	96.74
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	96.73
PRK14086		617	dnaA chromosomal replication initiation protein; P	96.73
PRK00411		394	cdc6 cell division control protein 6; Reviewed	96.72
PTZ00293		211	thymidine kinase; Provisional	96.72
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	96.72
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	96.7
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	96.7
PRK12422		445	chromosomal replication initiation protein; Provis	96.69
PLN03025		319	replication factor C subunit; Provisional	96.69
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	96.69
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	96.68
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	96.67
PRK06871		325	DNA polymerase III subunit delta'; Validated	96.67
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	96.65
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	96.63
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.63
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	96.62
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	96.62
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	96.61
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	96.57
PHA02544		316	44 clamp loader, small subunit; Provisional	96.57
PHA03333		752	putative ATPase subunit of terminase; Provisional	96.55
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	96.53
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	96.52
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	96.5
PTZ00112		1164	origin recognition complex 1 protein; Provisional	96.5
PHA03368		738	DNA packaging terminase subunit 1; Provisional	96.46
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	96.42
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	96.41
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	96.4
PRK08533		230	flagellar accessory protein FlaH; Reviewed	96.38
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	96.37
PRK07993		334	DNA polymerase III subunit delta'; Validated	96.36
PF00004		132	AAA: ATPase family associated with various cellula	96.36
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	96.36
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	96.35
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	96.32
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	96.31
PRK05580		679	primosome assembly protein PriA; Validated	96.31
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	96.29
PRK08939		306	primosomal protein DnaI; Reviewed	96.26
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	96.26
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	96.25
COG0593		408	DnaA ATPase involved in DNA replication initiation	96.24
PRK13833		323	conjugal transfer protein TrbB; Provisional	96.24
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	96.2
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	96.2
KOG0701		1606	consensus dsRNA-specific nuclease Dicer and relate	96.19
COG3972		660	Superfamily I DNA and RNA helicases [General funct	96.18
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	96.18
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	96.17
TIGR00595		505	priA primosomal protein N'. All proteins in this f	96.16
PRK00440		319	rfc replication factor C small subunit; Reviewed	96.16
PRK06090		319	DNA polymerase III subunit delta'; Validated	96.16
PRK07471		365	DNA polymerase III subunit delta'; Validated	96.14
PRK06964		342	DNA polymerase III subunit delta'; Validated	96.11
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	96.1
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	96.1
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	96.09
PF02456		369	Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR	96.09
PHA00729		226	NTP-binding motif containing protein	96.09
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	96.07
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	96.06
KOG2028		554	consensus ATPase related to the helicase subunit o	96.05
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	96.04
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	96.03
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	96.02
PRK11823		446	DNA repair protein RadA; Provisional	96.02
COG4626		546	Phage terminase-like protein, large subunit [Gener	96.0
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	95.99
PRK09112		351	DNA polymerase III subunit delta'; Validated	95.98
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	95.98
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	95.98
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	95.96
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	95.93
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	95.88
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	95.85
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	95.85
PRK14873		665	primosome assembly protein PriA; Provisional	95.84
COG3973		747	Superfamily I DNA and RNA helicases [General funct	95.84
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	95.82
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	95.81
PRK04195		482	replication factor C large subunit; Provisional	95.81
PRK13342		413	recombination factor protein RarA; Reviewed	95.8
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	95.79
PRK07940		394	DNA polymerase III subunit delta'; Validated	95.78
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	95.77
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	95.76
PRK06067		234	flagellar accessory protein FlaH; Validated	95.69
PRK10867		433	signal recognition particle protein; Provisional	95.69
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	95.67
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	95.66
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	95.66
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	95.62
TIGR00064		272	ftsY signal recognition particle-docking protein F	95.6
PRK05973		237	replicative DNA helicase; Provisional	95.59
PF05729		166	NACHT: NACHT domain	95.59
COG1198		730	PriA Primosomal protein N' (replication factor Y)	95.58
PRK08699		325	DNA polymerase III subunit delta'; Validated	95.55
PRK07399		314	DNA polymerase III subunit delta'; Validated	95.54
PRK13341		725	recombination factor protein RarA/unknown domain f	95.52
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	95.51
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	95.51
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	95.51
PF02572		172	CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase	95.46
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	95.46
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.45
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	95.45
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	95.38
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	95.35
TIGR00767		415	rho transcription termination factor Rho. Members	95.34
cd03115		173	SRP The signal recognition particle (SRP) mediates	95.34
PRK13851		344	type IV secretion system protein VirB11; Provision	95.32
PRK06620		214	hypothetical protein; Validated	95.3
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	95.29
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	95.29
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	95.27
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	95.26
PRK08058		329	DNA polymerase III subunit delta'; Validated	95.26
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	95.25
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	95.24
PRK09376		416	rho transcription termination factor Rho; Provisio	95.12
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	95.08
TIGR00959		428	ffh signal recognition particle protein. This mode	95.07
PRK08506		472	replicative DNA helicase; Provisional	95.05
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	95.03
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	95.02
KOG0298		1394	consensus DEAD box-containing helicase-like transc	94.98
PRK06904		472	replicative DNA helicase; Validated	94.98
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	94.95
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	94.94
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	94.92
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	94.91
COG5008		375	PilU Tfp pilus assembly protein, ATPase PilU [Cell	94.84
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	94.81
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	94.79
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	94.79
PRK04841		903	transcriptional regulator MalT; Provisional	94.78
PHA00012		361	I assembly protein	94.63
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	94.61
PHA00350		399	putative assembly protein	94.6
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	94.58
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	94.58
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	94.51
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	94.48
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	94.45
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	94.39
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	94.39
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	94.3
PRK10436		462	hypothetical protein; Provisional	94.28
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	94.28
cd01128		249	rho_factor Transcription termination factor rho is	94.26
COG2109		198	BtuR ATP:corrinoid adenosyltransferase [Coenzyme m	94.26
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	94.2
CHL00176		638	ftsH cell division protein; Validated	94.18
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	94.16
PRK08840		464	replicative DNA helicase; Provisional	94.15
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	94.12
PF12846		304	AAA_10: AAA-like domain	94.1
PRK08006		471	replicative DNA helicase; Provisional	94.06
PRK07004		460	replicative DNA helicase; Provisional	94.05
PHA03372		668	DNA packaging terminase subunit 1; Provisional	94.0
PRK04328		249	hypothetical protein; Provisional	93.93
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	93.87
TIGR00665		434	DnaB replicative DNA helicase. This model describe	93.86
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	93.86
TIGR02533		486	type_II_gspE general secretory pathway protein E.	93.86
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	93.84
PRK10689		1147	transcription-repair coupling factor; Provisional	93.83
PRK05748		448	replicative DNA helicase; Provisional	93.82
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	93.81
PRK09165		497	replicative DNA helicase; Provisional	93.8
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	93.79
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	93.79
PRK10865		857	protein disaggregation chaperone; Provisional	93.73
TIGR02784		1141	addA_alphas double-strand break repair helicase Ad	93.64
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	93.6
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	93.58
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	93.55
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	93.54
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	93.54
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	93.51
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	93.51
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	93.45
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	93.36
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	93.35
PRK08760		476	replicative DNA helicase; Provisional	93.34
KOG1807		1025	consensus Helicases [Replication, recombination an	93.32
PRK09087		226	hypothetical protein; Validated	93.25
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	93.24
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	93.22
PRK14701		1638	reverse gyrase; Provisional	93.11
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	93.08
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	93.04
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	92.93
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	92.88
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	92.83
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	92.82
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	92.79
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	92.77
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	92.69
CHL00095		821	clpC Clp protease ATP binding subunit	92.67
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	92.63
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	92.6
PRK05564		313	DNA polymerase III subunit delta'; Validated	92.59
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	92.55
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	92.49
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	92.48
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	92.44
TIGR02237		209	recomb_radB DNA repair and recombination protein R	92.4
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	92.36
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	92.35
PRK10416		318	signal recognition particle-docking protein FtsY;	92.2
PRK13897		606	type IV secretion system component VirD4; Provisio	92.17
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	92.16
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	92.15
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	92.04
COG1485		367	Predicted ATPase [General function prediction only	92.02
PRK05917		290	DNA polymerase III subunit delta'; Validated	92.01
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	91.96
PRK13764		602	ATPase; Provisional	91.92
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	91.92

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=1.5e-65  Score=419.57  Aligned_cols=378  Identities=68%  Similarity=1.065  Sum_probs=366.3

Q ss_pred             hhhccCcccCCCCHHHHHHHHHCCCCCCcHHHHhhhhhhhcCCcEEEeCCCCCcchHHhHHHHHHccccCCCceeEEEEc
Q 015129           36 DEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVQCQALVLA  115 (413)
Q Consensus        36 ~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~~Q~~~~~~i~~~~~~li~~~tGsGKT~~~~~~~~~~~~~~~~~~~~liv~  115 (413)
                      .....+|+++|+.+++.+.+.+.||+.|...|+.|++++++|++++..+..|+|||.++-+.+++.+.-.....+++++.
T Consensus        23 ~~v~~~F~~Mgl~edlLrgiY~yGfekPS~IQqrAi~~IlkGrdViaQaqSGTGKTa~~si~vlq~~d~~~r~tQ~lils  102 (400)
T KOG0328|consen   23 VKVIPTFDDMGLKEDLLRGIYAYGFEKPSAIQQRAIPQILKGRDVIAQAQSGTGKTATFSISVLQSLDISVRETQALILS  102 (400)
T ss_pred             cccccchhhcCchHHHHHHHHHhccCCchHHHhhhhhhhhcccceEEEecCCCCceEEEEeeeeeecccccceeeEEEec
Confidence            36688999999999999999999999999999999999999999999999999999999888888887777767999999


Q ss_pred             CcHHHHHHHHHHHHHhhcccCcEEEEEEcCcchHHHHHHHHcCCcEEEEccHHHHHHHHcCCCCCCcceEEEeccchHHh
Q 015129          116 PTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEML  195 (413)
Q Consensus       116 P~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iii~T~~~l~~~~~~~~~~~~~~~~iV~DE~h~~~  195 (413)
                      ||++|+.|..+.+..++...++.+..+.||.+..++.+.+.-+.+++.+||++.+++++...+....++++|+||++.++
T Consensus       103 PTRELa~Qi~~vi~alg~~mnvq~hacigg~n~gedikkld~G~hvVsGtPGrv~dmikr~~L~tr~vkmlVLDEaDemL  182 (400)
T KOG0328|consen  103 PTRELAVQIQKVILALGDYMNVQCHACIGGKNLGEDIKKLDYGQHVVSGTPGRVLDMIKRRSLRTRAVKMLVLDEADEML  182 (400)
T ss_pred             ChHHHHHHHHHHHHHhcccccceEEEEecCCccchhhhhhcccceEeeCCCchHHHHHHhccccccceeEEEeccHHHHH
Confidence            99999999999999999999999999999999999988888899999999999999999999999999999999999999


Q ss_pred             ccCcHHHHHHHHhhCCCCceEEEEEeeCCHhHHHHHHHhcCCCEEEEecCCcccccCeEEEEEEeccccchHHHHHHHHH
Q 015129          196 SRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYE  275 (413)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~i~~SaT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  275 (413)
                      +.++..++..+.+.+|+..|++++|||++.+..+....|+.+|+.+.+...+.+.+++++++..+..++++.+.|.++..
T Consensus       183 ~kgfk~Qiydiyr~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd  262 (400)
T KOG0328|consen  183 NKGFKEQIYDIYRYLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYD  262 (400)
T ss_pred             HhhHHHHHHHHHHhCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcccceEEEEccHHHHHHHHHHhhhCCCeeEEecCCCCHHHHHHHHHHHhcCCCcEEEEcCCCCCCCCCCCCcEEEEcc
Q 015129          276 TLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYD  355 (413)
Q Consensus       276 ~~~~~~~lif~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~~~~f~~~~~~vli~t~~~~~G~d~~~~~~vi~~~  355 (413)
                      ...-..++||||++..+..+.+.+++.+..+...||+|++++|.++++.|++|+.+||++|++.++|+|+|.++.||+||
T Consensus       263 ~LtItQavIFcnTk~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGiDv~qVslviNYD  342 (400)
T KOG0328|consen  263 TLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGIDVQQVSLVINYD  342 (400)
T ss_pred             hhehheEEEEecccchhhHHHHHHHhhCceeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccCCcceeEEEEecC
Confidence            98889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCChhhHHHhhhhccCCCCcceEEEEeccCcHHHHHHHHHHhccccccCCchhhhcC
Q 015129          356 LPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  413 (413)
Q Consensus       356 ~~~s~~~~~Q~~GR~~R~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  413 (413)
                      .|.+.+.|+||+||.||.|+.|.++-|+..+|.+.++.++++|.....++|+|+.+++
T Consensus       343 LP~nre~YIHRIGRSGRFGRkGvainFVk~~d~~~lrdieq~yst~i~emp~nvad~i  400 (400)
T KOG0328|consen  343 LPNNRELYIHRIGRSGRFGRKGVAINFVKSDDLRILRDIEQYYSTQIDEMPMNVADLI  400 (400)
T ss_pred             CCccHHHHhhhhccccccCCcceEEEEecHHHHHHHHHHHHHHhhhcccccchhhhcC
Confidence            9999999999999999999999999999999999999999999999999999999875

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>KOG0383 consensus Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification]	Back alignment and domain information

>COG3972 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PHA00012 I assembly protein	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA00350 putative assembly protein	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism]	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PHA03372 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG1807 consensus Helicases [Replication, recombination and repair]	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>COG1485 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

Homologous Structure Templates