Citrus Sinensis ID: 015259

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410

MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL

ccccccccEEEEEEEcccccccccccccccccccccccccccHHHHHHHccccEEEEcEEcHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHccccccEEEEEEccEEccccHHHHHHHHHHccccEEEEEEEEccccccccEEEEEcccccEEEEEEEccccccccEEEEEEEEccHHHHHHHHccccccccccHHHccHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccccEEEccEEEccccEEccccEEcccEEEccccEEccccEEcccEEccccEEccccEEEccEEccccEEccccEEcccccccccccEEEEccccEEccccEEEccEEccccEEcccccccccc

ccccccccEEEEEEEcccccccccccccccccccccccccccEEEEEHHHHHEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEccEEccccHHHHHHHHHHccccEEEEEEEEccccccccEEEEEcccccEEEEEEEccccccccEEEcEEEEEcHHHHHHHHcccccccccccHcccccHHHHcccccccccccEEEHHHHHHHHHccccEEEEEccccHHHcccccHHHHHHHHHHHHHHHcccHHHcccccccccEEEccEEEccccEEccccEEcccEEEcccEEEcccEEEEEEEEEcccEEccccEEEEEEEEcccEcccEEEEEccccccccccEEEEcccEEEccEEEEEccEEcccccccccccccEcc

MGSSEDDKVVAVIMVggptkgtrfrplslnipkplfplggqpmvhhpisackriylvgfyeEREFALYVSSIsnelripvrylredkphgsagalynfrdlimednpshifllncdvccsfplpemldahrnyggMGTILVIKVSAESAsqfgelvadpdtnellhytekpetfvsdlincgvyvftpDIFNAIQGvssqrkdrenlrrVSSFEALQSATRNLTTDFVrldqdilsplagkkqlytYETMDFWEqiktpgmslkcsgLYLAQFrltspnllasgdgtknatiigdvyvhpsakihptakigpnvsisanaRIGAGVRLISCIILDGVEIMENAVVTNAIVGWKssigrwsrvqaegdfnaKLGITILgeavgvedEVVVTNSivlpnktlnvSVHQEIIL

MGSSEDDKVVAVIMvggptkgtrfrplsLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQgvssqrkdrenlRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNsivlpnktlnvsvhqeiil

********VVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGV*********************ATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVH*****

******D****VIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGV************VSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL

******DKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRIYLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGV********N*RRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQE*IL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		410	2.2.26 [Sep-21-2011]
Q86HG0		412	Mannose-1-phosphate guany	yes	no	0.926	0.922	0.421	3e-97
Q7SXP8		422	Mannose-1-phosphate guany	yes	no	0.953	0.926	0.443	8e-97
Q6GMK8		422	Mannose-1-phosphate guany	no	no	0.953	0.926	0.432	9e-94
Q0VFM6		421	Mannose-1-phosphate guany	yes	no	0.941	0.916	0.421	1e-93
Q66KG5		426	Mannose-1-phosphate guany	N/A	no	0.953	0.917	0.428	5e-92
Q6DKE9		421	Mannose-1-phosphate guany	N/A	no	0.946	0.921	0.432	2e-91
Q5XIC1		420	Mannose-1-phosphate guany	yes	no	0.953	0.930	0.417	4e-89
Q922H4		420	Mannose-1-phosphate guany	yes	no	0.953	0.930	0.415	8e-89
B0CM52		420	Mannose-1-phosphate guany	N/A	no	0.953	0.930	0.413	7e-88
Q96IJ6		420	Mannose-1-phosphate guany	yes	no	0.953	0.930	0.413	7e-88

>sp\|Q86HG0\|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1	Back alignment and function desciption

 Score =  355 bits (911), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/425 (42%), Positives = 264/425 (62%), Gaps = 45/425 (10%)

Query: 11  AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISAC------KRIYLVGFYEERE 64
           A+I+VGGP+KGTRFRPLSL++PK LFP+ G+PM++H I AC      K I L+GF++E  
Sbjct: 8   AIILVGGPSKGTRFRPLSLDVPKLLFPIAGKPMIYHHIEACSKVENMKEIILIGFFQESV 67

Query: 65  FALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLP 124
            + ++S  S +L + +RY+ E+K  G+AG LY+FRD+I+E  PS IF+L+ D+CC+FPL 
Sbjct: 68  LSKFISETSKQLNVAIRYINEEKVLGTAGGLYHFRDIILEGGPSEIFVLHSDICCAFPLN 127

Query: 125 EMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVY 184
           ++L  H+ +G   TI+  ++ +  A+Q+G LV D  T ELLHY EKPETFVS+LINCGVY
Sbjct: 128 DLLQFHKQHGRSCTIMGTEIESAYANQYGCLVRDEKTAELLHYAEKPETFVSNLINCGVY 187

Query: 185 VFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDF------------VRLDQ 232
            F+P  F+ I                 +   L+++ +N+TTD+            +RL+Q
Sbjct: 188 CFSPQFFDVIG---------------KTMIDLKTSGQNITTDYPEITRKGFDVERLRLEQ 232

Query: 233 DILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATI 292
           DI  PLAG   +  Y  + FW QIK  G S+ C  LYL  F  T P +L  G+      I
Sbjct: 233 DIFVPLAGTGFISVYPYVGFWRQIKNAGSSVYCQELYLNHFAKTKPEVLKKGN-----NI 287

Query: 293 IGDVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGW 352
           IG+V +  +A + P+A IGP+V I  N +IG GVR+I  IILD  EI ++A +  +I+GW
Sbjct: 288 IGNVIIDSTASVDPSAIIGPDVYIGPNVKIGKGVRVIHSIILDQTEIKDHACIIYSIIGW 347

Query: 353 KSSIGRWSRVQAEGDF-------NAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVH 405
           +S IG W+R++   ++       + + G+TI G       E++V+N IV+P+K L+ + +
Sbjct: 348 QSLIGVWARIEGIPNYTPFLYSQDKRRGVTIFGAGAQANGEIIVSNCIVMPHKQLDRNYN 407

Query: 406 QEIIL 410
            EIIL
Sbjct: 408 NEIIL 412

Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 3

>sp\|Q7SXP8\|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1	Back alignment and function description

>sp\|Q6GMK8\|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1	Back alignment and function description

>sp\|Q0VFM6\|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1	Back alignment and function description

>sp\|Q66KG5\|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1	Back alignment and function description

>sp\|Q6DKE9\|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1	Back alignment and function description

>sp\|Q5XIC1\|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1	Back alignment and function description

>sp\|Q922H4\|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=2 SV=1	Back alignment and function description

>sp\|B0CM52\|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1	Back alignment and function description

>sp\|Q96IJ6\|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		410
255540799		415	mannose-1-phosphate guanyltransferase, p	0.997	0.985	0.887	0.0
224135729		415	predicted protein [Populus trichocarpa]	0.997	0.985	0.884	0.0
297842235		415	ADP-glucose pyrophosphorylase family pro	0.997	0.985	0.853	0.0
15222037		415	ADP-glucose pyrophosphorylase-like prote	0.997	0.985	0.850	0.0
224121622		417	predicted protein [Populus trichocarpa]	0.997	0.980	0.858	0.0
5882732		411	Similar to gb\|AF135422 GDP-mannose pyrop	0.985	0.982	0.851	0.0
94962375		415	putative GDP-mannose pyrophosphorylase [	0.997	0.985	0.865	0.0
225457154		415	PREDICTED: mannose-1-phosphate guanyltra	0.997	0.985	0.867	0.0
225452650		415	PREDICTED: mannose-1-phosphate guanyltra	0.997	0.985	0.834	0.0
296087766		418	unnamed protein product [Vitis vinifera]	0.997	0.978	0.828	0.0

>gi\|255540799\|ref\|XP_002511464.1\| mannose-1-phosphate guanyltransferase, putative [Ricinus communis] gi\|223550579\|gb\|EEF52066.1\| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/416 (88%), Positives = 387/416 (93%), Gaps = 7/416 (1%)

Query: 1   MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRI------ 54
           MGSS D+KVVAVIMVGGPTKGTRFRPLSLN+ KPLFPL GQPMVHHPISACKRI      
Sbjct: 1   MGSS-DEKVVAVIMVGGPTKGTRFRPLSLNVAKPLFPLAGQPMVHHPISACKRIPNLAQI 59

Query: 55  YLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLN 114
           YLVGFYEEREFALYVSSISNEL+IPVRYLREDKPHGSAG LYNFRDLIMED+PSHIFLLN
Sbjct: 60  YLVGFYEEREFALYVSSISNELKIPVRYLREDKPHGSAGGLYNFRDLIMEDSPSHIFLLN 119

Query: 115 CDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETF 174
           CDVCCSFPLPEMLDAHR YGGMGTILVIKVSAESASQFGEL+ADP T ELLHYTEKPETF
Sbjct: 120 CDVCCSFPLPEMLDAHRRYGGMGTILVIKVSAESASQFGELIADPVTKELLHYTEKPETF 179

Query: 175 VSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDI 234
           VSDLINCGVYVFTPDIF AIQGVSSQRKDR NLRRVSSFEALQS TR+L TDFVRLDQDI
Sbjct: 180 VSDLINCGVYVFTPDIFTAIQGVSSQRKDRANLRRVSSFEALQSTTRSLPTDFVRLDQDI 239

Query: 235 LSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIG 294
           LSPLAGKKQ YTYET DFWEQIKTPGMSLKCS LYLAQFR TSP+LLASGDG+K+ATI+G
Sbjct: 240 LSPLAGKKQFYTYETSDFWEQIKTPGMSLKCSALYLAQFRYTSPHLLASGDGSKSATIVG 299

Query: 295 DVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKS 354
           DVY+HPSAK+HPTAKIGPNVSISANAR+G G RLISCIILD VE+MENAVV +AI+GWKS
Sbjct: 300 DVYIHPSAKVHPTAKIGPNVSISANARVGPGARLISCIILDDVEVMENAVVIHAILGWKS 359

Query: 355 SIGRWSRVQAEGDFNAKLGITILGEAVGVEDEVVVTNSIVLPNKTLNVSVHQEIIL 410
           SIGRWSRVQA GDFN+KLGITILGEAV VEDEVVV NSIVLPNKTLNVSV +EIIL
Sbjct: 360 SIGRWSRVQAAGDFNSKLGITILGEAVCVEDEVVVVNSIVLPNKTLNVSVQEEIIL 415

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224135729\|ref\|XP_002322146.1\| predicted protein [Populus trichocarpa] gi\|222869142\|gb\|EEF06273.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297842235\|ref\|XP_002888999.1\| ADP-glucose pyrophosphorylase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297334840\|gb\|EFH65258.1\| ADP-glucose pyrophosphorylase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|15222037|ref|NP_177629.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] gi|30699054|ref|NP_849886.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] gi|12323882|gb|AAG51908.1|AC013258_2 putative GDP-mannose pyrophosphorylase; 64911-67597 [Arabidopsis thaliana] gi|13937224|gb|AAK50104.1|AF372967_1 At1g74910/F9E10_24 [Arabidopsis thaliana] gi|21700877|gb|AAM70562.1| At1g74910/F9E10_24 [Arabidopsis thaliana] gi|332197525|gb|AEE35646.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana] gi|332197527|gb|AEE35648.1| ADP-glucose pyrophosphorylase-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|224121622\|ref\|XP_002318629.1\| predicted protein [Populus trichocarpa] gi\|222859302\|gb\|EEE96849.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|5882732\|gb\|AAD55285.1\|AC008263_16 Similar to gb\|AF135422 GDP-mannose pyrophosphorylase A (GMPPA) from Homo sapiens. ESTs gb\|AA712990, gb\|N65247, gb\|N38149, gb\|T04179, gb\|Z38092, gb\|T76473, gb\|N96403, gb\|AA394551 and gb\|AA728527 come from this gene [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|94962375\|gb\|ABF48494.1\| putative GDP-mannose pyrophosphorylase [Linum usitatissimum]	Back alignment and taxonomy information

>gi\|225457154\|ref\|XP_002283703.1\| PREDICTED: mannose-1-phosphate guanyltransferase alpha isoform 1 [Vitis vinifera] gi\|297733847\|emb\|CBI15094.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225452650\|ref\|XP_002281959.1\| PREDICTED: mannose-1-phosphate guanyltransferase alpha-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296087766\|emb\|CBI35022.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		410
TAIR\|locus:2027201		415	AT1G74910 [Arabidopsis thalian	0.997	0.985	0.829	2e-184
TAIR\|locus:2049188		406	AT2G04650 [Arabidopsis thalian	0.968	0.977	0.759	2.1e-164
DICTYBASE\|DDB_G0271858		412	gmppA "mannose-1-phosphate gua	0.953	0.949	0.417	1.7e-84
ZFIN\|ZDB-GENE-040426-1550		422	gmppab "GDP-mannose pyrophosph	0.839	0.815	0.461	2.2e-82
ZFIN\|ZDB-GENE-040704-37		422	gmppaa "GDP-mannose pyrophosph	0.836	0.812	0.449	2.6e-79
UNIPROTKB\|E1BEN4		420	GMPPA "Uncharacterized protein	0.953	0.930	0.417	1.1e-78
RGD\|1560644		420	Gmppa "GDP-mannose pyrophospho	0.953	0.930	0.413	1.3e-77
ASPGD\|ASPL0000047492		439	AN1911 [Emericella nidulans (t	0.963	0.899	0.4	2.1e-77
MGI\|MGI:1916330		420	Gmppa "GDP-mannose pyrophospho	0.953	0.930	0.410	2.1e-77
UNIPROTKB\|I3LUP1		419	GMPPA "Uncharacterized protein	0.951	0.930	0.415	3.4e-77

TAIR\|locus:2027201 AT1G74910 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1789 (634.8 bits), Expect = 2.0e-184, P = 2.0e-184
 Identities = 345/416 (82%), Positives = 377/416 (90%)

Query:     1 MGSSEDDKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKRI------ 54
             MGSS ++KVVAVIMVGGPTKGTRFRPLSLNIPKPLFP+ GQPMVHHPISACKRI      
Sbjct:     1 MGSSMEEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI 60

Query:    55 YLVGFYEEREFALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLN 114
             YLVGFYEEREFALYVS+ISNEL++PVRYLREDKPHGSAG LY+FR+LIMED+PSHIFLLN
Sbjct:    61 YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDSPSHIFLLN 120

Query:   115 CDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETF 174
             CDVCCSFPLP+ML+AHR YGG+GT+LVIKVS ESASQFGELVADP TNELLHYTEKPETF
Sbjct:   121 CDVCCSFPLPKMLEAHRGYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF 180

Query:   175 VSDLINCGVYVFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDI 234
             VSD INCGVYVFTP+IFNAI  VS+QRKDR  L+RVSSFEALQ ATR + TDFVRLDQDI
Sbjct:   181 VSDRINCGVYVFTPEIFNAIGDVSTQRKDRATLKRVSSFEALQPATR-IPTDFVRLDQDI 239

Query:   235 LSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIG 294
             LSPLAGKK+LYTYETMDFWEQIK+PGMSL+CSGLYL+QFRLTSP LLASGDGT++A +IG
Sbjct:   240 LSPLAGKKRLYTYETMDFWEQIKSPGMSLRCSGLYLSQFRLTSPQLLASGDGTRSAIVIG 299

Query:   295 DVYVHPSAKIHPTAKIGPNVSISANARIGAGVRLISCIILDGVEIMENAVVTNAIVGWKS 354
             DVY+HPSAK+HPTAKIGPNVSISANAR+G GVRL+SCIILD VEIMENAVVTNAIVGWKS
Sbjct:   300 DVYIHPSAKVHPTAKIGPNVSISANARVGPGVRLMSCIILDDVEIMENAVVTNAIVGWKS 359

Query:   355 SIGRWSRVQAEGDFNAKLGITILXXXXXXXXXXXXTNSIVLPNKTLNVSVHQEIIL 410
             SIGRWSRVQAEG +N+KLG+TIL            T+SIVLPNKTLNVSV  EIIL
Sbjct:   360 SIGRWSRVQAEGVYNSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL 415

GO:0005737 "cytoplasm" evidence=ISM

GO:0009058 "biosynthetic process" evidence=IEA;ISS

GO:0016740 "transferase activity" evidence=IEA

GO:0016779 "nucleotidyltransferase activity" evidence=IEA;ISS

GO:0005777 "peroxisome" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP

GO:0005829 "cytosol" evidence=IDA

TAIR\|locus:2049188 AT2G04650 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0271858 gmppA "mannose-1-phosphate guanylyltransferase alpha" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1550 gmppab "GDP-mannose pyrophosphorylase Ab" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040704-37 gmppaa "GDP-mannose pyrophosphorylase Aa" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BEN4 GMPPA "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1560644 Gmppa "GDP-mannose pyrophosphorylase A" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000047492 AN1911 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

MGI\|MGI:1916330 Gmppa "GDP-mannose pyrophosphorylase A" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LUP1 GMPPA "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q86HG0	GMPPA_DICDI	2, ., 7, ., 7, ., 1, 3	0.4211	0.9268	0.9223	yes	no
Q922H4	GMPPA_MOUSE	2, ., 7, ., 7, ., 1, 3	0.4154	0.9536	0.9309	yes	no
Q4I1Y5	MPG1_GIBZE	2, ., 7, ., 7, ., 1, 3	0.3225	0.8512	0.9587	yes	no
O60064	YBB2_SCHPO	2, ., 7, ., 7, ., 1, 3	0.3865	0.9219	0.9130	yes	no
Q7SXP8	GMPAB_DANRE	2, ., 7, ., 7, ., 1, 3	0.4439	0.9536	0.9265	yes	no
Q6BN12	MPG1_DEBHA	2, ., 7, ., 7, ., 1, 3	0.3210	0.8560	0.9696	yes	no
Q96IJ6	GMPPA_HUMAN	2, ., 7, ., 7, ., 1, 3	0.4131	0.9536	0.9309	yes	no
Q70SJ2	MPG1_KLULA	2, ., 7, ., 7, ., 1, 3	0.3275	0.8585	0.9750	yes	no
Q9Y725	MPG11_CANGA	2, ., 7, ., 7, ., 1, 3	0.3300	0.8585	0.9750	yes	no
Q0VFM6	GMPPA_XENTR	2, ., 7, ., 7, ., 1, 3	0.4212	0.9414	0.9168	yes	no
Q5XIC1	GMPPA_RAT	2, ., 7, ., 7, ., 1, 3	0.4178	0.9536	0.9309	yes	no
P41940	MPG1_YEAST	2, ., 7, ., 7, ., 1, 3	0.3275	0.8585	0.9750	yes	no
Q752H4	MPG1_ASHGO	2, ., 7, ., 7, ., 1, 3	0.3226	0.8585	0.9750	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.7	0.921
3rd Layer	2.7.7.13	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		410
cd06428		257	cd06428, M1P_guanylylT_A_like_N, N-terminal domain	1e-144
COG1208		358	COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph	1e-64
cd06425		233	cd06425, M1P_guanylylT_B_like_N, N-terminal domain	8e-51
cd04181		217	cd04181, NTP_transferase, NTP_transferases catalyz	8e-49
pfam00483		247	pfam00483, NTP_transferase, Nucleotidyl transferas	1e-31
TIGR03992		393	TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph	1e-30
cd04189		236	cd04189, G1P_TT_long, G1P_TT_long represents the l	9e-28
cd06915		223	cd06915, NTP_transferase_WcbM_like, WcbM_like is a	2e-25
cd06426		220	cd06426, NTP_transferase_like_2, NTP_trnasferase_l	7e-24
cd05824		80	cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate	1e-22
TIGR02091		361	TIGR02091, glgC, glucose-1-phosphate adenylyltrans	6e-22
COG0448		393	COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb	8e-21
cd02507		216	cd02507, eIF-2B_gamma_N_like, The N-terminal of eI	1e-19
PRK05293		380	PRK05293, glgC, glucose-1-phosphate adenylyltransf	3e-18
cd04198		214	cd04198, eIF-2B_gamma_N, The N-terminal domain of	7e-16
COG1209		286	COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel	1e-15
TIGR01208		353	TIGR01208, rmlA_long, glucose-1-phosphate thymidyl	2e-15
COG1207		460	COG1207, GlmU, N-acetylglucosamine-1-phosphate uri	3e-14
cd06422		221	cd06422, NTP_transferase_like_1, NTP_transferase_l	1e-13
cd02524		253	cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr	2e-13
cd02540		229	cd02540, GT2_GlmU_N_bac, N-terminal domain of bact	1e-12
cd03356		79	cd03356, LbH_G1P_AT_C_like, Left-handed parallel b	3e-12
cd02541		267	cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca	3e-11
PRK00892		343	PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco	1e-10
cd04652		81	cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit,	1e-09
COG1044		338	COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	2e-09
cd02523		229	cd02523, PC_cytidylyltransferase, Phosphocholine c	2e-09
PRK00844		407	PRK00844, glgC, glucose-1-phosphate adenylyltransf	1e-08
TIGR01853		324	TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo	1e-08
cd04197		217	cd04197, eIF-2B_epsilon_N, The N-terminal domain o	2e-08
TIGR01099		260	TIGR01099, galU, UTP-glucose-1-phosphate uridylylt	2e-08
cd02538		240	cd02538, G1P_TT_short, G1P_TT_short is the short f	9e-08
COG1210		291	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell	9e-08
cd03352		205	cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl	1e-07
cd03351		254	cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin	2e-07
cd03353		193	cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph	2e-07
PRK05289		262	PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr	2e-07
TIGR01852		254	TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei	8e-07
cd03352		205	cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl	2e-06
cd03351		254	cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin	2e-06
COG1043		260	COG1043, LpxA, Acyl-[acyl carrier protein]	2e-06
PRK12461		255	PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr	4e-06
TIGR01173		451	TIGR01173, glmU, UDP-N-acetylglucosamine diphospho	5e-06
pfam12804		178	pfam12804, NTP_transf_3, MobA-like NTP transferase	5e-06
TIGR01173		451	TIGR01173, glmU, UDP-N-acetylglucosamine diphospho	7e-06
TIGR01852		254	TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei	1e-05
cd03360		197	cd03360, LbH_AT_putative, Putative Acyltransferase	4e-05
cd02508		200	cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory	4e-05
cd05636		163	cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho	5e-05
cd04651		104	cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly	6e-05
PRK14354		458	PRK14354, glmU, bifunctional N-acetylglucosamine-1	7e-05
cd00208		78	cd00208, LbetaH, Left-handed parallel beta-Helix (	7e-05
COG1044		338	COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	1e-04
PRK14355		459	PRK14355, glmU, bifunctional N-acetylglucosamine-1	1e-04
TIGR03570		193	TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia	1e-04
PRK09451		456	PRK09451, glmU, bifunctional N-acetylglucosamine-1	2e-04
PRK02862		429	PRK02862, glgC, glucose-1-phosphate adenylyltransf	2e-04
COG1043		260	COG1043, LpxA, Acyl-[acyl carrier protein]	3e-04
PRK14355		459	PRK14355, glmU, bifunctional N-acetylglucosamine-1	4e-04
PRK00725		425	PRK00725, glgC, glucose-1-phosphate adenylyltransf	4e-04
cd05787		79	cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit	4e-04
cd02516		218	cd02516, CDP-ME_synthetase, CDP-ME synthetase is i	5e-04
cd04645		153	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra	5e-04
pfam00132		36	pfam00132, Hexapep, Bacterial transferase hexapept	7e-04
COG4750		231	COG4750, LicC, CTP:phosphocholine cytidylyltransfe	7e-04
cd00710		167	cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (	7e-04
cd03356		79	cd03356, LbH_G1P_AT_C_like, Left-handed parallel b	0.001
PRK09451		456	PRK09451, glmU, bifunctional N-acetylglucosamine-1	0.001
PRK14358		481	PRK14358, glmU, bifunctional N-acetylglucosamine-1	0.001
TIGR02623		254	TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti	0.002
PRK15480		292	PRK15480, PRK15480, glucose-1-phosphate thymidylyl	0.002
cd04745		155	cd04745, LbH_paaY_like, paaY-like: This group is c	0.002
COG2266		177	COG2266, COG2266, GTP:adenosylcobinamide-phosphate	0.002
pfam00132		36	pfam00132, Hexapep, Bacterial transferase hexapept	0.003
cd00208		78	cd00208, LbetaH, Left-handed parallel beta-Helix (	0.004
cd04183		231	cd04183, GT2_BcE_like, GT2_BcbE_like is likely inv	0.004

>gnl\|CDD\|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase	Back alignment and domain information

 Score =  410 bits (1055), Expect = e-144
 Identities = 137/265 (51%), Positives = 179/265 (67%), Gaps = 14/265 (5%)

Query: 11  AVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISAC------KRIYLVGFYEERE 64
           AVI+VGGP KGTRFRPLSL++PKPLFP+ G+PM+HH I AC      K + L+GFY E  
Sbjct: 1   AVILVGGPQKGTRFRPLSLDVPKPLFPVAGKPMIHHHIEACAKVPDLKEVLLIGFYPESV 60

Query: 65  FALYVSSISNELRIPVRYLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLP 124
           F+ ++S    E  +P+RYL+E KP G+AG LY+FRD I+  NPS  F+LN DVCC FPL 
Sbjct: 61  FSDFISDAQQEFNVPIRYLQEYKPLGTAGGLYHFRDQILAGNPSAFFVLNADVCCDFPLQ 120

Query: 125 EMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDTNELLHYTEKPETFVSDLINCGVY 184
           E+L+ H+ +G  GTIL  + S E AS +G +V DP T E+LHY EKPETFVSDLINCGVY
Sbjct: 121 ELLEFHKKHGASGTILGTEASREQASNYGCIVEDPSTGEVLHYVEKPETFVSDLINCGVY 180

Query: 185 VFTPDIFNAIQGVSSQRKDRENLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAGKKQL 244
           +F+P+IF+ I+     R+    L             R    + +RL+QD+L+PLAG  +L
Sbjct: 181 LFSPEIFDTIKKAFQSRQQEAQLG--------DDNNREGRAEVIRLEQDVLTPLAGSGKL 232

Query: 245 YTYETMDFWEQIKTPGMSLKCSGLY 269
           Y Y+T DFW QIKT G ++  + LY
Sbjct: 233 YVYKTDDFWSQIKTAGSAIYANRLY 257

N-terminal domain of the M1P-guanylyltransferase A-isoform like proteins: The proteins of this family are likely to be a isoform of GDP-mannose pyrophosphorylase. Their sequences are highly conserved with mannose-1-phosphate guanyltransferase, but generally about 40-60 bases longer. GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes including cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 257

>gnl\|CDD\|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>gnl\|CDD\|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>gnl\|CDD\|215940 pfam00483, NTP_transferase, Nucleotidyl transferase	Back alignment and domain information

>gnl\|CDD\|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>gnl\|CDD\|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>gnl\|CDD\|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>gnl\|CDD\|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>gnl\|CDD\|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose	Back alignment and domain information

>gnl\|CDD\|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU	Back alignment and domain information

>gnl\|CDD\|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>gnl\|CDD\|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

>gnl\|CDD\|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>gnl\|CDD\|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>gnl\|CDD\|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>gnl\|CDD\|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>gnl\|CDD\|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>gnl\|CDD\|233272 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>gnl\|CDD\|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>gnl\|CDD\|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>gnl\|CDD\|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>gnl\|CDD\|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>gnl\|CDD\|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>gnl\|CDD\|223973 COG1043, LpxA, Acyl-[acyl carrier protein]	Back alignment and domain information

>gnl\|CDD\|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|221780 pfam12804, NTP_transf_3, MobA-like NTP transferase domain	Back alignment and domain information

>gnl\|CDD\|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>gnl\|CDD\|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>gnl\|CDD\|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>gnl\|CDD\|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>gnl\|CDD\|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>gnl\|CDD\|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>gnl\|CDD\|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>gnl\|CDD\|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223973 COG1043, LpxA, Acyl-[acyl carrier protein]	Back alignment and domain information

>gnl\|CDD\|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>gnl\|CDD\|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production	Back alignment and domain information

>gnl\|CDD\|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>gnl\|CDD\|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats)	Back alignment and domain information

>gnl\|CDD\|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site

Back alignment and domain information

>gnl\|CDD\|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>gnl\|CDD\|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase	Back alignment and domain information

>gnl\|CDD\|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>gnl\|CDD\|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>gnl\|CDD\|225175 COG2266, COG2266, GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats)	Back alignment and domain information

>gnl\|CDD\|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>gnl\|CDD\|133026 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		410
KOG1460		407	consensus GDP-mannose pyrophosphorylase [Carbohydr	100.0
KOG1322		371	consensus GDP-mannose pyrophosphorylase/mannose-1-	100.0
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	100.0
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	100.0
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	100.0
PLN02241		436	glucose-1-phosphate adenylyltransferase	100.0
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	100.0
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	100.0
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	100.0
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
KOG1461		673	consensus Translation initiation factor 2B, epsilo	100.0
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
KOG1462		433	consensus Translation initiation factor 2B, gamma	100.0
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	100.0
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
COG1209		286	RfbA dTDP-glucose pyrophosphorylase [Cell envelope	100.0
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
TIGR01105		297	galF UTP-glucose-1-phosphate uridylyltransferase,	100.0
cd06428		257	M1P_guanylylT_A_like_N N-terminal domain of M1P_gu	100.0
PRK15480		292	glucose-1-phosphate thymidylyltransferase RfbA; Pr	100.0
cd06425		233	M1P_guanylylT_B_like_N N-terminal domain of the M1	100.0
PRK10122		297	GalU regulator GalF; Provisional	100.0
PF00483		248	NTP_transferase: Nucleotidyl transferase This Pros	100.0
cd02538		240	G1P_TT_short G1P_TT_short is the short form of glu	100.0
TIGR01207		286	rmlA glucose-1-phosphate thymidylyltransferase, sh	100.0
TIGR02623		254	G1P_cyt_trans glucose-1-phosphate cytidylyltransfe	100.0
cd04189		236	G1P_TT_long G1P_TT_long represents the long form o	100.0
PRK13389		302	UTP--glucose-1-phosphate uridylyltransferase subun	100.0
cd06422		221	NTP_transferase_like_1 NTP_transferase_like_1 is a	100.0
cd02541		267	UGPase_prokaryotic Prokaryotic UGPase catalyses th	100.0
TIGR01099		260	galU UTP-glucose-1-phosphate uridylyltransferase.	100.0
cd06915		223	NTP_transferase_WcbM_like WcbM_like is a subfamily	99.98
cd06426		220	NTP_transferase_like_2 NTP_trnasferase_like_2 is a	99.98
cd02524		253	G1P_cytidylyltransferase G1P_cytidylyltransferase	99.97
cd04181		217	NTP_transferase NTP_transferases catalyze the tran	99.97
COG1210		291	GalU UDP-glucose pyrophosphorylase [Cell envelope	99.97
cd04197		217	eIF-2B_epsilon_N The N-terminal domain of epsilon	99.95
cd02523		229	PC_cytidylyltransferase Phosphocholine cytidylyltr	99.95
cd04183		231	GT2_BcE_like GT2_BcbE_like is likely involved in t	99.94
cd02508		200	ADP_Glucose_PP ADP-glucose pyrophosphorylase is in	99.94
cd04198		214	eIF-2B_gamma_N The N-terminal domain of gamma subu	99.93
cd02507		216	eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma	99.92
cd02509		274	GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf	99.91
cd02540		229	GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	99.91
COG1213		239	Predicted sugar nucleotidyltransferases [Cell enve	99.89
PRK05450		245	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.89
cd02517		239	CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th	99.88
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	99.88
PRK13368		238	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.84
PLN02917		293	CMP-KDO synthetase	99.77
COG4750		231	LicC CTP:phosphocholine cytidylyltransferase invol	99.77
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	99.77
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	99.74
COG0836		333	{ManC} Mannose-1-phosphate guanylyltransferase [Ce	99.68
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.66
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.6
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	99.6
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.59
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.58
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.57
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.57
PLN02296		269	carbonate dehydratase	99.57
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	99.55
KOG1461		673	consensus Translation initiation factor 2B, epsilo	99.55
TIGR00466		238	kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe	99.55
PLN02472		246	uncharacterized protein	99.55
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	99.54
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.54
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.53
PRK13627		196	carnitine operon protein CaiE; Provisional	99.53
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.53
PRK13627		196	carnitine operon protein CaiE; Provisional	99.53
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.52
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	99.52
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.51
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.51
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	99.51
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.51
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.51
PRK09382		378	ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp	99.51
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.51
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.5
cd02513		223	CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-	99.5
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	99.5
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.5
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.49
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.49
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	99.49
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.49
PF12804		160	NTP_transf_3: MobA-like NTP transferase domain; PD	99.49
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	99.48
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	99.48
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	99.48
TIGR00454		183	conserved hypothetical protein TIGR00454. At this	99.48
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.47
PRK00155		227	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.47
PLN02296		269	carbonate dehydratase	99.47
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.47
cd02516		218	CDP-ME_synthetase CDP-ME synthetase is involved in	99.47
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.47
TIGR00453		217	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.46
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	99.45
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.44
TIGR03310		188	matur_ygfJ molybdenum hydroxylase accessory protei	99.44
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	99.44
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	99.43
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	99.43
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.43
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	99.43
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	99.42
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	99.42
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	99.42
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	99.42
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.42
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	99.42
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	99.41
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.4
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.4
PRK00317		193	mobA molybdopterin-guanine dinucleotide biosynthes	99.39
KOG1462		433	consensus Translation initiation factor 2B, gamma	99.39
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.39
PLN02472		246	uncharacterized protein	99.39
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	99.38
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	99.38
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	99.38
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	99.38
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	99.37
COG0746		192	MobA Molybdopterin-guanine dinucleotide biosynthes	99.37
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	99.36
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	99.36
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	99.36
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	99.34
PRK13385		230	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.34
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	99.34
PLN02728		252	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.33
PRK00560		196	molybdopterin-guanine dinucleotide biosynthesis pr	99.33
cd04182		186	GT_2_like_f GT_2_like_f is a subfamily of the glyc	99.33
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.32
COG1212		247	KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase	99.32
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.32
COG2266		177	GTP:adenosylcobinamide-phosphate guanylyltransfera	99.31
TIGR03584		222	PseF pseudaminic acid CMP-transferase. The sequenc	99.29
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	99.28
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	99.28
PRK02726		200	molybdopterin-guanine dinucleotide biosynthesis pr	99.26
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	99.25
cd02503		181	MobA MobA catalyzes the formation of molybdopterin	99.25
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	99.25
PRK10502		182	putative acyl transferase; Provisional	99.24
TIGR03202		190	pucB xanthine dehydrogenase accessory protein pucB	99.24
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	99.24
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	99.24
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	99.24
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.23
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.23
PLN02694		294	serine O-acetyltransferase	99.23
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	99.22
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	99.22
TIGR02665		186	molyb_mobA molybdopterin-guanine dinucleotide bios	99.22
PRK11132		273	cysE serine acetyltransferase; Provisional	99.21
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	99.21
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.2
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	99.2
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	99.2
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	99.17
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	99.17
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	99.17
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	99.16
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	99.15
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	99.13
COG1211		230	IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt	99.13
PF01128		221	IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly	99.12
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	99.1
PRK10092		183	maltose O-acetyltransferase; Provisional	99.1
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	99.09
PRK10502		182	putative acyl transferase; Provisional	99.09
PRK10191		146	putative acyl transferase; Provisional	99.08
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	99.08
PLN02357		360	serine acetyltransferase	99.07
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	99.05
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	99.05
PRK14500		346	putative bifunctional molybdopterin-guanine dinucl	99.05
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	99.05
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	99.04
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	99.04
PLN02739		355	serine acetyltransferase	99.04
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	99.03
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	99.02
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	99.02
PRK10191		146	putative acyl transferase; Provisional	99.01
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	99.0
PRK11132		273	cysE serine acetyltransferase; Provisional	99.0
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	98.99
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.97
COG2068		199	Uncharacterized MobA-related protein [General func	98.97
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.97
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	98.97
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	98.94
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	98.94
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.93
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	98.92
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	98.91
PLN02241		436	glucose-1-phosphate adenylyltransferase	98.9
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	98.89
PLN02357		360	serine acetyltransferase	98.88
KOG3121		184	consensus Dynactin, subunit p25 [Cytoskeleton]	98.88
PLN02694		294	serine O-acetyltransferase	98.86
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	98.84
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.84
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	98.84
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.83
PLN02739		355	serine acetyltransferase	98.8
cd04180		266	UGPase_euk_like Eukaryotic UGPase-like includes UD	98.78
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	98.77
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	98.77
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.76
PRK10092		183	maltose O-acetyltransferase; Provisional	98.75
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	98.75
cd04193		323	UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala	98.73
cd02518		233	GT2_SpsF SpsF is a glycosyltrnasferase implicated	98.72
KOG1460		407	consensus GDP-mannose pyrophosphorylase [Carbohydr	98.7
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	98.68
COG1083		228	NeuA CMP-N-acetylneuraminic acid synthetase [Cell	98.63
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.61
KOG1322		371	consensus GDP-mannose pyrophosphorylase/mannose-1-	98.5
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	98.5
PLN02474		469	UTP--glucose-1-phosphate uridylyltransferase	98.49
KOG4042		190	consensus Dynactin subunit p27/WS-3, involved in t	98.49
KOG3121		184	consensus Dynactin, subunit p25 [Cytoskeleton]	98.49
PTZ00339		482	UDP-N-acetylglucosamine pyrophosphorylase; Provisi	98.4
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	98.37
KOG4750		269	consensus Serine O-acetyltransferase [Amino acid t	98.37
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	98.33
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	98.32
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	98.31
KOG4042		190	consensus Dynactin subunit p27/WS-3, involved in t	98.25
PF02348		217	CTP_transf_3: Cytidylyltransferase; InterPro: IPR0	98.24
cd00897		300	UGPase_euk Eukaryotic UGPase catalyses the synthes	98.11
COG1861		241	SpsF Spore coat polysaccharide biosynthesis protei	97.99
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	97.97
KOG4750		269	consensus Serine O-acetyltransferase [Amino acid t	97.9
PRK13412		974	fkp bifunctional fucokinase/L-fucose-1-P-guanylylt	97.82
COG4801		277	Predicted acyltransferase [General function predic	97.74
PF00132		36	Hexapep: Bacterial transferase hexapeptide (six re	97.69
COG4801		277	Predicted acyltransferase [General function predic	97.66
PF00132		36	Hexapep: Bacterial transferase hexapeptide (six re	97.61
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	97.57
PRK00576		178	molybdopterin-guanine dinucleotide biosynthesis pr	97.51
PF01704		420	UDPGP: UTP--glucose-1-phosphate uridylyltransferas	97.46
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	97.29
COG4284		472	UDP-glucose pyrophosphorylase [Carbohydrate transp	97.25
PLN02435		493	probable UDP-N-acetylglucosamine pyrophosphorylase	97.12
cd06424		315	UGGPase UGGPase catalyzes the synthesis of UDP-Glu	96.48
PLN02830		615	UDP-sugar pyrophosphorylase	96.29
KOG2638		498	consensus UDP-glucose pyrophosphorylase [Carbohydr	96.0
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	95.26
PF00535		169	Glycos_transf_2: Glycosyl transferase family 2; In	94.87
cd00761		156	Glyco_tranf_GTA_type Glycosyltransferase family A	92.77
TIGR03552		195	F420_cofC 2-phospho-L-lactate guanylyltransferase	92.6
cd04195		201	GT2_AmsE_like GT2_AmsE_like is involved in exopoly	90.94
cd06423		180	CESA_like CESA_like is the cellulose synthase supe	89.69
cd04186		166	GT_2_like_c Subfamily of Glycosyltransferase Famil	89.55
KOG2978		238	consensus Dolichol-phosphate mannosyltransferase [	89.37
PLN02726		243	dolichyl-phosphate beta-D-mannosyltransferase	89.23
cd04188		211	DPG_synthase DPG_synthase is involved in protein N	88.62
cd06439		251	CESA_like_1 CESA_like_1 is a member of the cellulo	88.36
cd06427		241	CESA_like_2 CESA_like_2 is a member of the cellulo	87.46
TIGR01556		281	rhamnosyltran L-rhamnosyltransferase. Rhamnolipids	85.7
cd04196		214	GT_2_like_d Subfamily of Glycosyltransferase Famil	85.32
cd06442		224	DPM1_like DPM1_like represents putative enzymes si	85.22
PRK13412		974	fkp bifunctional fucokinase/L-fucose-1-P-guanylylt	84.79
PF04519		101	Bactofilin: Polymer-forming cytoskeletal; InterPro	84.7
cd04185		202	GT_2_like_b Subfamily of Glycosyltransferase Famil	84.67
PRK11204		420	N-glycosyltransferase; Provisional	84.49
cd02510		299	pp-GalNAc-T pp-GalNAc-T initiates the formation of	84.3
cd02520		196	Glucosylceramide_synthase Glucosylceramide synthas	84.3
cd04187		181	DPM1_like_bac Bacterial DPM1_like enzymes are rela	84.03
cd04179		185	DPM_DPG-synthase_like DPM_DPG-synthase_like is a m	83.91
PRK10714		325	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi	83.64
cd06435		236	CESA_NdvC_like NdvC_like proteins in this family a	82.58
PF13641		228	Glyco_tranf_2_3: Glycosyltransferase like family 2	80.55
COG1664		146	CcmA Integral membrane protein CcmA involved in ce	80.28

>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=1.3e-62  Score=428.14  Aligned_cols=395  Identities=65%  Similarity=1.065  Sum_probs=358.5

Q ss_pred             ceEEEEEecCCCCCCccccCCCCCCccccccCCccchhhhHhhccc------EEEecccchHHHHHHHHhhcccCCccEE
Q 015259            8 KVVAVIMVGGPTKGTRFRPLSLNIPKPLFPLGGQPMVHHPISACKR------IYLVGFYEEREFALYVSSISNELRIPVR   81 (410)
Q Consensus         8 ~~~aiIlaaG~~~g~Rl~~lt~~~pK~llpi~g~pli~~~l~~l~~------i~vv~~~~~~~i~~~~~~~~~~~~~~i~   81 (410)
                      +++||||-|||++|+||+||+.+.||||.|++|+|||+|-|+.+.+      |++++.|.++.+.+|+.....+++..++
T Consensus         2 ~~~AVIlVGGP~kGTRFRPLSf~vPKPLfpiaG~pmI~Hhi~ac~qi~~l~eI~LvGFy~e~~f~~fis~~~~e~~~pvr   81 (407)
T KOG1460|consen    2 KVKAVILVGGPQKGTRFRPLSFNVPKPLFPIAGVPMIHHHISACKQISGLAEILLVGFYEERVFTDFISAIQQEFKVPVR   81 (407)
T ss_pred             ceEEEEEecCCCCCccccccccCCCCCccccCCcchhhhhHHHHhcccchhheeEEecccchHHHHHHHHHHhhcccchh
Confidence            5899999999999999999999999999999999999999999998      9999999999999999988888888999


Q ss_pred             EeeCCCCCCcHHHHHHhHHHhcccCCCcEEEEcCCcccCCChHHHHHHHHhcCCceEEEEEecCcccccccceEEEcCCC
Q 015259           82 YLREDKPHGSAGALYNFRDLIMEDNPSHIFLLNCDVCCSFPLPEMLDAHRNYGGMGTILVIKVSAESASQFGELVADPDT  161 (410)
Q Consensus        82 ~i~~~~~~g~~~~l~~~~~~l~~~~~~~~lvl~~D~i~~~~l~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~v~~d~~~  161 (410)
                      |+.++.+.|+++.|+..++.+-+..++.+++++||..++.+|+++++.|++.+..++++.++.+++++..||.+..|+.+
T Consensus        82 YL~E~~plGtaGgLyhFrdqIl~g~ps~vFvlnaDVCcsfPl~~ml~ahr~~g~~~tll~tkvs~e~asnfG~lV~dP~t  161 (407)
T KOG1460|consen   82 YLREDNPLGTAGGLYHFRDQILAGSPSAVFVLNADVCCSFPLQDMLEAHRRYGGIGTLLVTKVSREQASNFGCLVEDPST  161 (407)
T ss_pred             hhccCCCCCcccceeehhhHHhcCCCceEEEEecceecCCcHHHHHHHHhhcCCceEEEEEEecHhHhhccCeeeecCCc
Confidence            99999999999999999999876778899999999999999999999999999999999999999999999999999889


Q ss_pred             CcEEEEecCCCCccccceeeeEEEEcHHHHHHhhhcccccccch-hhhccchhHhhhhhccCCCCCeeeeccchhccccC
Q 015259          162 NELLHYTEKPETFVSDLINCGVYVFTPDIFNAIQGVSSQRKDRE-NLRRVSSFEALQSATRNLTTDFVRLDQDILSPLAG  240 (410)
Q Consensus       162 ~~v~~i~ekp~~~~~~l~~~Giy~~~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~l~~d~l~~l~~  240 (410)
                      ++|+++.|||.+..++.+++|+|+|++++|+.+.+...+.++.. ...      ++..... -+.++..|+.|++..|+.
T Consensus       162 ~evlHYveKPsTfvSd~InCGvYlF~~eif~~i~~v~~q~~~~~~~~~------~~~~l~~-g~~d~irLeqDvlspLag  234 (407)
T KOG1460|consen  162 GEVLHYVEKPSTFVSDIINCGVYLFTPEIFNAIAEVYRQRQDLLEVEK------DLPLLQP-GPADFIRLEQDVLSPLAG  234 (407)
T ss_pred             CceEEeecCcchhhhcccceeEEEecHHHHHHHHHHHHHHHhhhhhhh------cccccCC-CccceEEeechhhhhhcC
Confidence            99999999999999999999999999999999988765543211 000      0000111 245788899999999999


Q ss_pred             CCceeEEeccceeeecCCccchhhhhHHHHhhhhhcCCCcccCCCCCCCcEEccCeEECCCCEECCCcEECCCcEECCCc
Q 015259          241 KKQLYTYETMDFWEQIKTPGMSLKCSGLYLAQFRLTSPNLLASGDGTKNATIIGDVYVHPSAKIHPTAKIGPNVSISANA  320 (410)
Q Consensus       241 ~~~i~~~~~~g~~~~i~t~~~~~~an~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~~~~ig~~~  320 (410)
                      ++++|+|.+.++|..+.|+..-+.|+..|+++|+...+..+.++.+. .++|.++++|+|+|.+++.++|++|+.||+++
T Consensus       235 ~k~lY~y~t~~fW~QiKtagsal~as~lYLs~yk~t~p~~Lak~pgt-~a~IigdVyIhPsakvhptAkiGPNVSIga~v  313 (407)
T KOG1460|consen  235 SKQLYAYETTDFWSQIKTAGSALYASRLYLSQYKRTHPARLAKGPGT-QAEIIGDVYIHPSAKVHPTAKIGPNVSIGANV  313 (407)
T ss_pred             CCceEEEecccHHHHhccccceeehhhhHHHHHhhcCchhhcCCCCC-CceEEeeeEEcCcceeCCccccCCCceecCCc
Confidence            99999999999999999999999999999999999888888764333 37899999999999999999999999999999


Q ss_pred             EECCCCEEeeeEECCCCEECCCCEEEeeEECCCCEECCCcEEccCCCCCcceee----eEECCCCEECCCcEEcceEEcC
Q 015259          321 RIGAGVRLISCIILDGVEIMENAVVTNAIVGWKSSIGRWSRVQAEGDFNAKLGI----TILGEAVGVEDEVVVTNSIVLP  396 (410)
Q Consensus       321 ~i~~~~~i~~~~i~~~~~i~~~~~i~~~~i~~~~~i~~~~~i~~~~~~~~~~~~----~~i~~~~~i~~~~~v~~~~v~~  396 (410)
                      +||+++++.+|+|.++|.|.+|+++-+|+||.++.||..+++.+....+.+...    +++|+.+.+++.+.+.+|++.|
T Consensus       314 rvg~GvRl~~sIIl~d~ei~enavVl~sIigw~s~iGrWaRVe~~pv~~s~~~~~~a~Tilga~v~v~dev~v~~s~vlp  393 (407)
T KOG1460|consen  314 RVGPGVRLRESIILDDAEIEENAVVLHSIIGWKSSIGRWARVEGIPVEPSPNLPFAALTILGADVSVEDEVIVLNSIVLP  393 (407)
T ss_pred             eecCCceeeeeeeccCcEeeccceEEeeeecccccccceeeecccccccCCCCCcceeEEecccceecceeEEeeeeEec
Confidence            999999999999999999999999999999999999999999997666655544    9999999999999999999999


Q ss_pred             CcEEcccCCCcccC
Q 015259          397 NKTLNVSVHQEIIL  410 (410)
Q Consensus       397 ~~~v~~~~~~~~~~  410 (410)
                      +..+..+++++|++
T Consensus       394 ~k~l~vs~~~eIil  407 (407)
T KOG1460|consen  394 NKELNVSVQDEIIL  407 (407)
T ss_pred             CCccceeeecceeC
Confidence            99999999999985

>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit	Back alignment and domain information

>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase	Back alignment and domain information

>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>PRK10122 GalU regulator GalF; Provisional	Back alignment and domain information

>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry	Back alignment and domain information

>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase	Back alignment and domain information

>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional	Back alignment and domain information

>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose	Back alignment and domain information

>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule	Back alignment and domain information

>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose	Back alignment and domain information

>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	Back alignment and domain information

>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide	Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>PLN02917 CMP-KDO synthetase	Back alignment and domain information

>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site

Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>TIGR00454 conserved hypothetical protein TIGR00454	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed	Back alignment and domain information

>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism]	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional	Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>TIGR03584 PseF pseudaminic acid CMP-transferase	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism]	Back alignment and domain information

>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate []	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>COG2068 Uncharacterized MobA-related protein [General function prediction only]	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton]	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc	Back alignment and domain information

>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat	Back alignment and domain information

>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>PLN02474 UTP--glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton]	Back alignment and domain information

>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2	Back alignment and domain information

>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose	Back alignment and domain information

>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose	Back alignment and domain information

>PLN02830 UDP-sugar pyrophosphorylase	Back alignment and domain information

>KOG2638 consensus UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold	Back alignment and domain information

>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC	Back alignment and domain information

>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis	Back alignment and domain information

>cd06423 CESA_like CESA_like is the cellulose synthase superfamily	Back alignment and domain information

>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>KOG2978 consensus Dolichol-phosphate mannosyltransferase [General function prediction only]	Back alignment and domain information

>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase	Back alignment and domain information

>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation	Back alignment and domain information

>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily	Back alignment and domain information

>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily	Back alignment and domain information

>TIGR01556 rhamnosyltran L-rhamnosyltransferase	Back alignment and domain information

>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1	Back alignment and domain information

>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional	Back alignment and domain information

>PF04519 Bactofilin: Polymer-forming cytoskeletal; InterPro: IPR007607 This family contains several uncharacterised hypothetical proteins	Back alignment and domain information

>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>PRK11204 N-glycosyltransferase; Provisional	Back alignment and domain information

>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans	Back alignment and domain information

>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis	Back alignment and domain information

>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1	Back alignment and domain information

>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily	Back alignment and domain information

>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional	Back alignment and domain information

>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase	Back alignment and domain information

>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A	Back alignment and domain information

>COG1664 CcmA Integral membrane protein CcmA involved in cell shape determination [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		410
2ggo_A		401	Crystal Structure Of Glucose-1-Phosphate Thymidylyl		7e-09
3juj_A		281	The Crystal Structure Of Apo- Udp-Glucose Pyrophosp		2e-05
4aaw_A		459	S.Pneumoniae Glmu In Complex With An Antibacterial		3e-05
1hm9_A		468	Crystal Structure Of S.Pneumoniae N-Acetylglucosami		3e-05
3hl3_A		269	2.76 Angstrom Crystal Structure Of A Putative Gluco		6e-05
1g95_A		459	Crystal Structure Of S.Pneumoniae Glmu, Apo Form Le		2e-04
1mc3_A		296	Crystal Structure Of Rffh Length = 296		5e-04
1h5s_D		293	Thymidylyltransferase Complexed With Tmp Length = 2		5e-04
3spt_A		501	Crystal Structure Of Glmu From Mycobacterium Tuberc		7e-04
3d8v_A		495	Crystal Structure Of Glmu From Mycobacterium Tuberc		7e-04
3foq_A		503	Crystal Structure Of N-Acetylglucosamine-1-Phosphat		7e-04
1h5r_B		293	Thymidylyltransferase Complexed With Thimidine And		8e-04
1h5t_A		293	Thymidylyltransferase Complexed With Thymidylyldiph		8e-04
1h5s_A		293	Thymidylyltransferase Complexed With Tmp Length = 2		8e-04

>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401