Citrus Sinensis ID: 015302
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 409 | ||||||
| 225424120 | 403 | PREDICTED: myristoyl-acyl carrier protei | 0.958 | 0.972 | 0.761 | 1e-174 | |
| 449465918 | 428 | PREDICTED: palmitoyl-acyl carrier protei | 0.968 | 0.925 | 0.726 | 1e-168 | |
| 297737746 | 1078 | unnamed protein product [Vitis vinifera] | 0.897 | 0.340 | 0.769 | 1e-165 | |
| 255570713 | 397 | palmitoyl-acyl carrier protein thioester | 0.951 | 0.979 | 0.697 | 1e-164 | |
| 356574254 | 396 | PREDICTED: myristoyl-acyl carrier protei | 0.960 | 0.992 | 0.710 | 1e-161 | |
| 434090942 | 405 | acyl-ACP thioesterase [Jatropha curcas] | 0.963 | 0.972 | 0.675 | 1e-159 | |
| 356534332 | 397 | PREDICTED: myristoyl-acyl carrier protei | 0.960 | 0.989 | 0.694 | 1e-157 | |
| 224108387 | 411 | predicted protein [Populus trichocarpa] | 0.911 | 0.907 | 0.652 | 1e-153 | |
| 224118740 | 385 | predicted protein [Populus trichocarpa] | 0.911 | 0.968 | 0.605 | 1e-130 | |
| 56201537 | 408 | putative acyl-(acyl carrier protein) thi | 0.799 | 0.801 | 0.657 | 1e-128 |
| >gi|225424120|ref|XP_002280147.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 617 bits (1591), Expect = e-174, Method: Compositional matrix adjust.
Identities = 303/398 (76%), Positives = 334/398 (83%), Gaps = 6/398 (1%)
Query: 13 CPIRCSAASNNHDPNKQKLNNISYSGNSTRST-KVDLHSQTTGVASTFVASVAAEKEGCR 71
C IRCS + HDPNKQKLNNI G ST T KVDL SQT G A+T + SV++ E
Sbjct: 10 CSIRCSNRDHPHDPNKQKLNNIKVHGTSTMPTAKVDLLSQTVG-AATALTSVSSIAENGH 68
Query: 72 INEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQE 131
I + Q+RQNIPTKKQFVDPYR GLI+EGGVGY QTVV+RSYEVGPDKTATLESILNL QE
Sbjct: 69 ITKEQLRQNIPTKKQFVDPYRQGLIVEGGVGYSQTVVIRSYEVGPDKTATLESILNLLQE 128
Query: 132 TALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKN 191
TALNHVWMSGLL NGFGATHGMMRNNLIWVVSRMQV++DHYPIWGEVVEIDTWVGASGKN
Sbjct: 129 TALNHVWMSGLLGNGFGATHGMMRNNLIWVVSRMQVQLDHYPIWGEVVEIDTWVGASGKN 188
Query: 192 GMRRDWLIRSQATGHIFARATRYIITWVMMNQQTRRLSKIPAEVRAEISPWFIDKQAIIE 251
GMRRDWLIRS ATG IFARAT TWVMMNQQTRRLSK+P EVRAEISPWFI+KQAI E
Sbjct: 189 GMRRDWLIRSHATGQIFARATS---TWVMMNQQTRRLSKMPEEVRAEISPWFIEKQAIKE 245
Query: 252 DVPEKISKLDDTAKYVNSDLKPKRSDLDMNHHVNNVKYVRWMLETIPDRILESNQLSGIT 311
DVPEKI KLDD AKYVNS+LKPKRSDLDMNHHVNNVKYVRWMLETIPD+ LES+QLS I
Sbjct: 246 DVPEKIVKLDDKAKYVNSNLKPKRSDLDMNHHVNNVKYVRWMLETIPDQFLESHQLSSII 305
Query: 312 LEYRRECGGSDVVQSLCQPDEDGILKDGVKQDTASIRLLNGFSLASEIVDGGGLI-ASFE 370
LEYRRECG SD+VQSLC+PDE ILK+G +Q I+LLNGF +ASEI+DG GL+ SF
Sbjct: 306 LEYRRECGSSDIVQSLCEPDEAAILKEGGQQQPNEIKLLNGFPMASEILDGHGLLNGSFH 365
Query: 371 KGPLRFTHLLQAKGETQNEEIVRGRTTWKKKPSSMPFS 408
KG L +TH+LQ KG + EEIVRGRT W+ K S++ F+
Sbjct: 366 KGTLGYTHVLQTKGGRKYEEIVRGRTKWRTKHSAISFT 403
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449465918|ref|XP_004150674.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] gi|449519404|ref|XP_004166725.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297737746|emb|CBI26947.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255570713|ref|XP_002526311.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] gi|223534392|gb|EEF36100.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356574254|ref|XP_003555265.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|434090942|gb|AGB56141.1| acyl-ACP thioesterase [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|356534332|ref|XP_003535710.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224108387|ref|XP_002314829.1| predicted protein [Populus trichocarpa] gi|222863869|gb|EEF01000.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224118740|ref|XP_002317894.1| predicted protein [Populus trichocarpa] gi|222858567|gb|EEE96114.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|56201537|dbj|BAD73184.1| putative acyl-(acyl carrier protein) thioesterase [Oryza sativa Japonica Group] gi|56201806|dbj|BAD73256.1| putative acyl-(acyl carrier protein) thioesterase [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 409 | ||||||
| TAIR|locus:2201786 | 412 | FATB "AT1G08510" [Arabidopsis | 0.628 | 0.623 | 0.522 | 2e-75 | |
| TAIR|locus:2090285 | 362 | FaTA "AT3G25110" [Arabidopsis | 0.577 | 0.651 | 0.483 | 3.3e-63 | |
| TAIR|locus:2123256 | 367 | AT4G13050 "AT4G13050" [Arabido | 0.577 | 0.643 | 0.483 | 4.2e-61 | |
| UNIPROTKB|Q3ADW4 | 252 | CHY_0816 "Acyl carrier protein | 0.464 | 0.753 | 0.271 | 2.5e-15 | |
| TIGR_CMR|CHY_0816 | 252 | CHY_0816 "acyl carrier protein | 0.464 | 0.753 | 0.271 | 2.5e-15 |
| TAIR|locus:2201786 FATB "AT1G08510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 722 (259.2 bits), Expect = 2.0e-75, Sum P(2) = 2.0e-75
Identities = 139/266 (52%), Positives = 188/266 (70%)
Query: 63 VAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATL 122
+AAEK+ ++ R ++ VDP+ G I++ G+ +RQ +RSYE+G D++A++
Sbjct: 104 LAAEKQWMMLDWKPRRSDM-----LVDPFGIGRIVQDGLVFRQNFSIRSYEIGADRSASI 158
Query: 123 ESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEID 182
E+++N QETALNHV +GLL +GFG+T M + NLIWVV+RMQV +D YP WG+VVE+D
Sbjct: 159 ETVMNHLQETALNHVKTAGLLGDGFGSTPEMFKKNLIWVVTRMQVVVDKYPTWGDVVEVD 218
Query: 183 TWVGASGKNGMRRDWLIRSQATGHIFARATRYIITWVMMNQQTRRLSKIPAEVRAEISPW 242
TWV SGKNGMRRDWL+R TG RA+ WVMMN+ TRRLSKIP EVR EI P+
Sbjct: 219 TWVSQSGKNGMRRDWLVRDCNTGETLTRASS---VWVMMNKLTRRLSKIPEEVRGEIEPY 275
Query: 243 FIDKQAIIEDVPEKISKLDD-TAKYVNSDLKPKRSDLDMNHHVNNVKYVRWMLETIPDRI 301
F++ ++ + K++K+DD TA YV S L P+ SDLD+N HVNNVKY+ W+LE+ P I
Sbjct: 276 FVNSDPVLAEDSRKLTKIDDKTADYVRSGLTPRWSDLDVNQHVNNVKYIGWILESAPVGI 335
Query: 302 LESNQLSGITLEYRRECGGSDVVQSL 327
+E +L +TLEYRRECG V+QSL
Sbjct: 336 MERQKLKSMTLEYRRECGRDSVLQSL 361
|
|
| TAIR|locus:2090285 FaTA "AT3G25110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2123256 AT4G13050 "AT4G13050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ADW4 CHY_0816 "Acyl carrier protein thioesterase, homolog" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0816 CHY_0816 "acyl carrier protein thioesterase, homolog" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 409 | |||
| PLN02370 | 419 | PLN02370, PLN02370, acyl-ACP thioesterase | 1e-107 | |
| pfam01643 | 249 | pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase | 5e-96 | |
| COG3884 | 250 | COG3884, FatA, Acyl-ACP thioesterase [Lipid metabo | 3e-23 | |
| cd00586 | 110 | cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase ( | 1e-11 | |
| COG0824 | 137 | COG0824, FcbC, Predicted thioesterase [General fun | 1e-04 |
| >gnl|CDD|215210 PLN02370, PLN02370, acyl-ACP thioesterase | Back alignment and domain information |
|---|
Score = 321 bits (824), Expect = e-107
Identities = 153/319 (47%), Positives = 204/319 (63%), Gaps = 37/319 (11%)
Query: 87 FVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNG 146
+DP+ G I++ G+ +RQ +RSYE+G D+TA++E+++N QETALNHV +GLL +G
Sbjct: 124 LIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHLQETALNHVKTAGLLGDG 183
Query: 147 FGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGH 206
FG+T M + NLIWVV+RMQV +D YP WG+VV++DTWV ASGKNGMRRDWL+R TG
Sbjct: 184 FGSTPEMSKRNLIWVVTRMQVLVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVRDCKTGE 243
Query: 207 IFARATRYIITWVMMNQQTRRLSKIPAEVRAEISPWFIDKQAIIEDVPEKISKLDD-TAK 265
RA+ WVMMN+ TRRLSKIP EVR EI P+F++ ++ + K+ KLDD TA
Sbjct: 244 TLTRASS---VWVMMNKLTRRLSKIPEEVRGEIEPYFLNSDPVVNEDSRKLPKLDDKTAD 300
Query: 266 YVNSDLKPKRSDLDMNHHVNNVKYVRWMLETIPDRILESNQLSGITLEYRRECGGSDVVQ 325
Y+ L P+ SDLD+N HVNNVKY+ W+LE+ P I+ES++L+ ITLEYRRECG V+Q
Sbjct: 301 YIRKGLTPRWSDLDVNQHVNNVKYIGWILESAPPPIMESHELAAITLEYRRECGRDSVLQ 360
Query: 326 SLCQPDEDGILKDGVKQDTASIRLLNGFSLASEIVDGGGLIASFEKGPLRFTHLLQAKGE 385
SL TA V G G+ G + HLL+ +
Sbjct: 361 SL----------------TA--------------VSGTGIGNLGTAGDVECQHLLRLE-- 388
Query: 386 TQNEEIVRGRTTWKKKPSS 404
EIVRGRT W+ K ++
Sbjct: 389 -DGAEIVRGRTEWRPKHAT 406
|
Length = 419 |
| >gnl|CDD|216622 pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase | Back alignment and domain information |
|---|
| >gnl|CDD|226401 COG3884, FatA, Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238329 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >gnl|CDD|223894 COG0824, FcbC, Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 409 | |||
| PLN02370 | 419 | acyl-ACP thioesterase | 100.0 | |
| PF01643 | 261 | Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 | 100.0 | |
| COG3884 | 250 | FatA Acyl-ACP thioesterase [Lipid metabolism] | 100.0 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 99.93 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 99.9 | |
| TIGR00051 | 117 | acyl-CoA thioester hydrolase, YbgC/YbaW family. Th | 99.89 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 99.88 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 99.8 | |
| PF13279 | 121 | 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E | 99.79 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 99.68 | |
| PRK10800 | 130 | acyl-CoA thioesterase YbgC; Provisional | 99.26 | |
| COG0824 | 137 | FcbC Predicted thioesterase [General function pred | 99.24 | |
| TIGR00051 | 117 | acyl-CoA thioester hydrolase, YbgC/YbaW family. Th | 99.22 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 99.2 | |
| TIGR02799 | 126 | thio_ybgC tol-pal system-associated acyl-CoA thioe | 99.19 | |
| PF13279 | 121 | 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E | 99.16 | |
| cd00586 | 110 | 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat | 98.87 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 98.83 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 98.69 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 98.63 | |
| PF01643 | 261 | Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 | 98.48 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 98.43 | |
| PLN02370 | 419 | acyl-ACP thioesterase | 98.22 | |
| PRK10694 | 133 | acyl-CoA esterase; Provisional | 98.01 | |
| cd03440 | 100 | hot_dog The hotdog fold was initially identified i | 97.88 | |
| PF12590 | 129 | Acyl-thio_N: Acyl-ATP thioesterase; InterPro: IPR0 | 97.83 | |
| cd03442 | 123 | BFIT_BACH Brown fat-inducible thioesterase (BFIT). | 97.74 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 97.57 | |
| TIGR00369 | 117 | unchar_dom_1 uncharacterized domain 1. Most protei | 97.41 | |
| COG1607 | 157 | Acyl-CoA hydrolase [Lipid metabolism] | 97.4 | |
| COG3884 | 250 | FatA Acyl-ACP thioesterase [Lipid metabolism] | 97.24 | |
| TIGR02286 | 114 | PaaD phenylacetic acid degradation protein PaaD. S | 97.21 | |
| PF03061 | 79 | 4HBT: Thioesterase superfamily; InterPro: IPR00668 | 97.15 | |
| cd03443 | 113 | PaaI_thioesterase PaaI_thioesterase is a tetrameri | 96.27 | |
| PRK10293 | 136 | acyl-CoA esterase; Provisional | 96.25 | |
| PRK11688 | 154 | hypothetical protein; Provisional | 96.09 | |
| COG5496 | 130 | Predicted thioesterase [General function predictio | 95.95 | |
| PRK10254 | 137 | thioesterase; Provisional | 95.78 | |
| COG2050 | 141 | PaaI HGG motif-containing thioesterase, possibly i | 95.61 | |
| KOG3328 | 148 | consensus HGG motif-containing thioesterase [Gener | 95.1 | |
| cd03449 | 128 | R_hydratase (R)-hydratase [(R)-specific enoyl-CoA | 94.83 | |
| PLN02322 | 154 | acyl-CoA thioesterase | 93.14 | |
| PF14539 | 132 | DUF4442: Domain of unknown function (DUF4442); PDB | 92.35 | |
| cd01288 | 131 | FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier | 92.04 | |
| PLN02647 | 437 | acyl-CoA thioesterase | 92.01 | |
| cd00556 | 99 | Thioesterase_II Thioesterase II (TEII) is thought | 91.62 | |
| PLN02864 | 310 | enoyl-CoA hydratase | 91.28 | |
| cd03455 | 123 | SAV4209 SAV4209 is a Streptomyces avermitilis prot | 90.73 | |
| PRK13691 | 166 | (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro | 90.46 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 90.09 | |
| cd03447 | 126 | FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t | 89.31 | |
| cd03441 | 127 | R_hydratase_like (R)-hydratase [(R)-specific enoyl | 89.13 | |
| TIGR01750 | 140 | fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd | 88.94 | |
| cd03454 | 140 | YdeM YdeM is a Bacillus subtilis protein that belo | 87.8 | |
| cd03446 | 140 | MaoC_like MoaC_like Similar to the MaoC (monoamine | 87.65 | |
| PRK13692 | 159 | (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro | 87.25 | |
| cd03453 | 127 | SAV4209_like SAV4209_like. Similar in sequence to | 86.53 | |
| PRK00006 | 147 | fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review | 86.44 | |
| cd00493 | 131 | FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr | 86.28 | |
| PRK04424 | 185 | fatty acid biosynthesis transcriptional regulator; | 85.44 | |
| cd03451 | 146 | FkbR2 FkbR2 is a Streptomyces hygroscopicus protei | 84.96 | |
| PF13452 | 132 | MaoC_dehydrat_N: N-terminal half of MaoC dehydrata | 81.91 | |
| PRK08190 | 466 | bifunctional enoyl-CoA hydratase/phosphate acetylt | 80.34 | |
| PF13622 | 255 | 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A | 80.16 |
| >PLN02370 acyl-ACP thioesterase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-70 Score=559.09 Aligned_cols=311 Identities=50% Similarity=0.887 Sum_probs=274.6
Q ss_pred cccccceeeeehhhhhhccccccchhhccccCCCcccccccccccccccCceeEEEEEEeeecccCCCCCcCHHHHHHHH
Q 015302 50 SQTTGVASTFVASVAAEKEGCRINEVQIRQNIPTKKQFVDPYRHGLIIEGGVGYRQTVVVRSYEVGPDKTATLESILNLF 129 (409)
Q Consensus 50 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~~~~~g~~y~~~~~VR~~EvD~~g~v~~~~~l~yl 129 (409)
||...++||||. ||||||+++||++.|+ ++|+|+|++|+||+||++|+++|+||+||||.+|++++.+++|||
T Consensus 94 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~y~~~f~Ir~yEvD~~g~lsl~~L~n~l 166 (419)
T PLN02370 94 SMLLAAITTIFL--AAEKQWMMLDWKPRRS-----DMLIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHL 166 (419)
T ss_pred HHHHHHHHHHHH--hhhhhhhhhcccCCCC-----cccccccccCceeccCcEEEEEEEEeeEEECCCCCCCHHHHHHHH
Confidence 677889999998 9999999999999998 899999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhhccccCCCCcchhhccCCeEEEEEEeEEEEeecCCCCCEEEEEEEEeeeCCceEEEEEEEEEcCCCcEEE
Q 015302 130 QETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFA 209 (409)
Q Consensus 130 QEaa~~h~~~~g~l~~Gfg~~~~m~~~gl~WVV~r~~Ie~~r~p~~gD~V~I~Twv~~~gr~~~~Rdf~I~d~~~Gevia 209 (409)
||+|.+|+...|.+++||+..++|.+.|++|||++++|+|+|||+|||+|+|+||+.+.+++++.|+|+|+|..+|++++
T Consensus 167 Qd~A~~Hs~~lGll~~Gfg~~~~m~~~gl~WVLtr~~I~~~R~P~~gD~V~V~Twv~~~~k~~~~Rdf~I~D~~~Ge~la 246 (419)
T PLN02370 167 QETALNHVKTAGLLGDGFGSTPEMSKRNLIWVVTRMQVLVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVRDCKTGETLT 246 (419)
T ss_pred HHHHHHHHHHhCccccccccHHHHHhCCceEEEEEEEEEeCcCCCCCCEEEEEEEEeeCCCCEEEEEEEEEECCCCeEEE
Confidence 99999999877777778876568999999999999999999999999999999999999999999999999855899999
Q ss_pred EEEEccEEEEEEEcCCCceecCCHHHHHhcCccccccccccccCcccccCCCcc-ccccccceeeccccCccCCccchHH
Q 015302 210 RATRYIITWVMMNQQTRRLSKIPAEVRAEISPWFIDKQAIIEDVPEKISKLDDT-AKYVNSDLKPKRSDLDMNHHVNNVK 288 (409)
Q Consensus 210 rAtS~~~~WV~mD~~tRRp~riPeevre~i~p~~~~~~~~~~~~~~ki~kl~~~-~~~~~~~~~vr~sDlD~NgHVNN~~ 288 (409)
+|+| +||+||++||||+|||+++++.+.+|..+.....++.++|++++++. +++....++|||+|||+||||||++
T Consensus 247 ~A~S---vWV~mD~~TRRpvRIP~Evr~~i~~y~~~~~~~i~~~~~kl~~l~~~~~~~~~~~~~VRysDLD~NgHVNNvk 323 (419)
T PLN02370 247 RASS---VWVMMNKLTRRLSKIPEEVRGEIEPYFLNSDPVVNEDSRKLPKLDDKTADYIRKGLTPRWSDLDVNQHVNNVK 323 (419)
T ss_pred EEEE---EEEEEECCCCcccCCCHHHHHhhhhcccccccccccccccCCccccccccceeeeeeecHHHCcccCccccHH
Confidence 9999 99999999999999999999888888765433333456788877642 3344456999999999999999999
Q ss_pred HHHHHHHhCCcchhcccceEEEEEEEecccCCCCeEEEEEEEcCCceeeeceeccccceeeccCcccceeeecCCCcccc
Q 015302 289 YVRWMLETIPDRILESNQLSGITLEYRRECGGSDVVQSLCQPDEDGILKDGVKQDTASIRLLNGFSLASEIVDGGGLIAS 368 (409)
Q Consensus 289 Yl~w~~ealp~~~~~~~~l~~i~I~Y~~E~~~gd~v~~~t~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~g~~~~~~ 368 (409)
|++|++|++|.++++.|.+++++|+|++||.+||.|++.+.+.+++. |. .
T Consensus 324 Yi~Wild~lP~e~l~~~~l~~i~I~Y~kE~~~gd~V~s~~~~~~~~~--------------------------~~----~ 373 (419)
T PLN02370 324 YIGWILESAPPPIMESHELAAITLEYRRECGRDSVLQSLTAVSGTGI--------------------------GN----L 373 (419)
T ss_pred HHHHHHhhCchhhhhcceEEEEEEEEcccCCCCCEEEEEEeeccccc--------------------------cc----c
Confidence 99999999999999999999999999999999999999988654321 00 0
Q ss_pred cCCCceEEEEEEEecCCCCcceEEEeEeeeecCCC
Q 015302 369 FEKGPLRFTHLLQAKGETQNEEIVRGRTTWKKKPS 403 (409)
Q Consensus 369 ~~~~~~~~~hllr~~~~~~~~ei~rgrT~W~~k~~ 403 (409)
.++....|.|++|.++| .|+++|+|+|+||.+
T Consensus 374 ~~~~~~~~~h~~~~~dG---~e~a~a~t~Wr~~~~ 405 (419)
T PLN02370 374 GTAGDVECQHLLRLEDG---AEIVRGRTEWRPKHA 405 (419)
T ss_pred cCCCcceEEEEEEcCCC---eEEEEEEEEEEECCc
Confidence 01122569999997766 899999999999964
|
|
| >PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] | Back alignment and domain information |
|---|
| >COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >PRK10800 acyl-CoA thioesterase YbgC; Provisional | Back alignment and domain information |
|---|
| >COG0824 FcbC Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A | Back alignment and domain information |
|---|
| >cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >PLN02370 acyl-ACP thioesterase | Back alignment and domain information |
|---|
| >PRK10694 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >cd03440 hot_dog The hotdog fold was initially identified in the E | Back alignment and domain information |
|---|
| >PF12590 Acyl-thio_N: Acyl-ATP thioesterase; InterPro: IPR021113 This entry represents the N-terminal domain of acyl-ATP thioesterases from bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >TIGR00369 unchar_dom_1 uncharacterized domain 1 | Back alignment and domain information |
|---|
| >COG1607 Acyl-CoA hydrolase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02286 PaaD phenylacetic acid degradation protein PaaD | Back alignment and domain information |
|---|
| >PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases | Back alignment and domain information |
|---|
| >cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria | Back alignment and domain information |
|---|
| >PRK10293 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK11688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5496 Predicted thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10254 thioesterase; Provisional | Back alignment and domain information |
|---|
| >COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway | Back alignment and domain information |
|---|
| >PLN02322 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B | Back alignment and domain information |
|---|
| >cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway | Back alignment and domain information |
|---|
| >PLN02647 acyl-CoA thioesterase | Back alignment and domain information |
|---|
| >cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively | Back alignment and domain information |
|---|
| >PLN02864 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit | Back alignment and domain information |
|---|
| >PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit | Back alignment and domain information |
|---|
| >cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] | Back alignment and domain information |
|---|
| >TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ | Back alignment and domain information |
|---|
| >cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function | Back alignment and domain information |
|---|
| >cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain | Back alignment and domain information |
|---|
| >PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional | Back alignment and domain information |
|---|
| >cd03453 SAV4209_like SAV4209_like | Back alignment and domain information |
|---|
| >PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation | Back alignment and domain information |
|---|
| >PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes | Back alignment and domain information |
|---|
| >PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A | Back alignment and domain information |
|---|
| >PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 409 | ||||
| 4gak_A | 250 | Crystal Structure Of Acyl-Acp Thioesterase From Spi | 8e-14 | ||
| 2ess_A | 248 | Crystal Structure Of An Acyl-Acp Thioesterase (Np_8 | 8e-12 | ||
| 2own_A | 262 | Crystal Structure Of Oleoyl Thioesterase (Putative) | 3e-10 |
| >pdb|4GAK|A Chain A, Crystal Structure Of Acyl-Acp Thioesterase From Spirosoma Linguale Length = 250 | Back alignment and structure |
|
| >pdb|2ESS|A Chain A, Crystal Structure Of An Acyl-Acp Thioesterase (Np_810988.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.90 A Resolution Length = 248 | Back alignment and structure |
| >pdb|2OWN|A Chain A, Crystal Structure Of Oleoyl Thioesterase (Putative) (Np_784467.1) From Lactobacillus Plantarum At 2.00 A Resolution Length = 262 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 409 | |||
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 6e-63 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 6e-63 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 1e-08 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 4e-06 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 4e-06 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 6e-06 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 8e-06 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 8e-04 |
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Length = 248 | Back alignment and structure |
|---|
Score = 201 bits (513), Expect = 6e-63
Identities = 54/241 (22%), Positives = 98/241 (40%), Gaps = 14/241 (5%)
Query: 103 YRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVV 162
V + V + T+ + N A H GFG + +N WV+
Sbjct: 9 GTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFH-----ASDRGFGIAT-LNEDNYTWVL 62
Query: 163 SRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIITWVMMN 222
SR+ +E+D P E + TWV + R++ + + G A W M+N
Sbjct: 63 SRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVIDK-DGKKIGYAR---SVWAMIN 118
Query: 223 QQTRRLSKIPAEVRAEISPWFIDKQAIIEDVPEKISKLDDTAKYVNSDLKPKRSDLDMNH 282
TR+ + + A I + D+ EK S++ T+ + L K SD+D+N
Sbjct: 119 LNTRKPADLLALHGGSIVDYICDEPCP----IEKPSRIKVTSNQPVATLTAKYSDIDING 174
Query: 283 HVNNVKYVRWMLETIPDRILESNQLSGITLEYRRECGGSDVVQSLCQPDEDGILKDGVKQ 342
HVN+++Y+ +L+ P + ++ ++ + Y E D + C + VK+
Sbjct: 175 HVNSIRYIEHILDLFPIELYQTKRIRRFEMAYVAESYFGDELSFFCDEVSENEFHVEVKK 234
Query: 343 D 343
+
Sbjct: 235 N 235
|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Length = 262 | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Length = 156 | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Length = 151 | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Length = 137 | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Length = 150 | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Length = 148 | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Length = 136 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Length = 135 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 409 | |||
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 100.0 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 100.0 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 100.0 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 99.92 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 99.91 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 99.91 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 99.91 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 99.91 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 99.91 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 99.91 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 99.9 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 99.9 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 99.9 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 99.9 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 99.9 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 99.89 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 99.89 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 99.89 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 99.89 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 99.89 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 99.89 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 99.89 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 99.88 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 99.88 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 99.84 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 99.79 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 99.59 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 99.58 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 99.53 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 99.44 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 99.43 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 99.41 | |
| 2own_A | 262 | Putative oleoyl-[acyl-carrier protein] thioestera; | 99.37 | |
| 2gf6_A | 135 | Conserved hypothetical protein; putative thioester | 99.34 | |
| 3r87_A | 135 | Putative uncharacterized protein; unknown function | 99.33 | |
| 2fuj_A | 137 | Conserved hypothetical protein; structural genomic | 99.33 | |
| 2o5u_A | 148 | Thioesterase; putative thioesterese,, hydrolase; 1 | 99.31 | |
| 1lo7_A | 141 | 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c | 99.28 | |
| 2pzh_A | 135 | Hypothetical protein HP_0496; lipid, acyl-COA, bac | 99.27 | |
| 2egj_A | 128 | Hypothetical protein AQ_1494; structural genomics; | 99.26 | |
| 2w3x_A | 147 | CALE7; hydrolase, hotdog fold, thioesterase, enedi | 99.26 | |
| 3hm0_A | 167 | Probable thioesterase; niaid, ssgcid, decode, UW, | 99.26 | |
| 2nuj_A | 163 | Thioesterase superfamily; YP_509914.1, structural | 99.26 | |
| 1z54_A | 132 | Probable thioesterase; hypothetical protein, struc | 99.25 | |
| 2cye_A | 133 | TTHA1846, putative thioesterase; structural genomi | 99.24 | |
| 2ali_A | 158 | Hypothetical protein PA2801; structural genomics, | 99.24 | |
| 4i4j_A | 159 | ACP-polyene thioesterase; structural genomics, PSI | 99.24 | |
| 3ck1_A | 150 | Putative thioesterase; structural genomics, joint | 99.23 | |
| 2gvh_A | 288 | AGR_L_2016P; 15159470, acyl-COA hydrolase, structu | 99.23 | |
| 2oiw_A | 136 | Putative 4-hydroxybenzoyl-COA thioesterase; struct | 99.23 | |
| 2xem_A | 150 | DYNE7, TEBC; biosynthetic protein, polyketide bios | 99.22 | |
| 2oaf_A | 151 | Thioesterase superfamily; YP_508616.1, structural | 99.21 | |
| 4gak_A | 250 | Acyl-ACP thioesterase; MCSG, PSI-biology, structur | 99.2 | |
| 1s5u_A | 138 | Protein YBGC; structural genomics, hypothetical pr | 99.2 | |
| 1njk_A | 156 | Hypothetical protein YBAW; structural genomics, th | 99.19 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.19 | |
| 2hlj_A | 157 | Hypothetical protein; putative thioesterase, struc | 99.19 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 99.18 | |
| 2hx5_A | 152 | Hypothetical protein; thioesterase/thiol ester deh | 99.18 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 99.17 | |
| 2ess_A | 248 | Acyl-ACP thioesterase; NP_810988.1, structural gen | 99.09 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 99.0 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 98.99 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 98.73 | |
| 2eis_A | 133 | Hypothetical protein TTHB207; COA binding motif, N | 98.65 | |
| 3b7k_A | 333 | Acyl-coenzyme A thioesterase 12; hotdog fold, stru | 98.52 | |
| 1vpm_A | 169 | Acyl-COA hydrolase; NP_241664.1, structural genomi | 98.39 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 98.38 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 98.37 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 98.32 | |
| 2v1o_A | 151 | Cytosolic acyl coenzyme A thioester hydrolase; acy | 98.3 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 98.25 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 98.22 | |
| 3bjk_A | 153 | Acyl-COA thioester hydrolase HI0827; hotdog fold, | 98.18 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 98.15 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 98.11 | |
| 3nwz_A | 176 | BH2602 protein; structural genomics, PSI-biology, | 98.08 | |
| 2cwz_A | 141 | Thioesterase family protein; structural genomics, | 98.07 | |
| 1o0i_A | 138 | Hypothetical protein HI1161; structural genomics, | 97.98 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 97.97 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 97.95 | |
| 3lbe_A | 163 | Putative uncharacterized protein SMU.793; hypothet | 97.94 | |
| 3e1e_A | 141 | Thioesterase family protein; structural genomics, | 97.93 | |
| 3d6l_A | 137 | Putative hydrolase; hot DOG fold, thioesterase, ac | 97.92 | |
| 3dkz_A | 142 | Thioesterase superfamily protein; Q7W9W5, borpa, P | 97.9 | |
| 1vh5_A | 148 | Hypothetical protein YDII; PSI, protein structure | 97.88 | |
| 3s4k_A | 144 | Putative esterase RV1847/MT1895; seattle structura | 97.83 | |
| 1y7u_A | 174 | Acyl-COA hydrolase; structural genomics, coenzyme | 97.83 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 97.8 | |
| 2qq2_A | 193 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 97.78 | |
| 2q2b_A | 179 | Cytosolic acyl coenzyme A thioester hydrolase; ACO | 97.76 | |
| 1sh8_A | 154 | Hypothetical protein PA5026; structural genomics, | 97.76 | |
| 4ae7_A | 220 | Thioesterase superfamily member 5; hydrolase, hotd | 97.67 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 97.64 | |
| 3e29_A | 144 | Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, | 97.52 | |
| 4ae8_A | 211 | Thioesterase superfamily member 4; hydrolase, hotd | 97.52 | |
| 1sc0_A | 138 | Hypothetical protein HI1161; structural genomics, | 97.38 | |
| 3gek_A | 146 | Putative thioesterase YHDA; structure genomics, NE | 97.36 | |
| 1wlu_A | 136 | PAAI protein, phenylacetic acid degradation protei | 97.24 | |
| 3f1t_A | 148 | Uncharacterized protein Q9I3C8_pseae; PAR319A, NES | 97.18 | |
| 1ixl_A | 131 | Hypothetical protein PH1136; alpha+beta, hot-DOG-f | 96.95 | |
| 3hdu_A | 157 | Putative thioesterase; structural genomics, joint | 96.78 | |
| 1zki_A | 133 | Hypothetical protein PA5202; structural genomics, | 96.68 | |
| 4ien_A | 163 | Putative acyl-COA hydrolase; hot DOG fold; HET: CO | 96.64 | |
| 3e8p_A | 164 | Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG | 96.6 | |
| 1yoc_A | 147 | Hypothetical protein PA1835; structural genomics, | 96.15 | |
| 3kuv_A | 139 | Fluoroacetyl coenzyme A thioesterase; fluoroacetyl | 96.11 | |
| 2hbo_A | 158 | Hypothetical protein (NP_422103.1); thioesterase/t | 96.06 | |
| 3qoo_A | 138 | Uncharacterized protein; structural genomics, PSI- | 95.9 | |
| 2q78_A | 153 | Uncharacterized protein; structural genomics, join | 95.66 | |
| 2h4u_A | 145 | Thioesterase superfamily member 2; structural geno | 95.59 | |
| 2pim_A | 141 | Phenylacetic acid degradation-related protein; thi | 94.6 | |
| 3bnv_A | 152 | CJ0977; virulence factor, hot-DOG fold, flagel unk | 94.55 | |
| 2prx_A | 160 | Thioesterase superfamily protein; ZP_00837258.1, s | 94.35 | |
| 2fs2_A | 151 | Phenylacetic acid degradation protein PAAI; operon | 93.93 | |
| 1iq6_A | 134 | (R)-hydratase, (R)-specific enoyl-COA hydratase; p | 93.27 | |
| 1t82_A | 155 | Hypothetical acetyltransferase; structural genomic | 93.25 | |
| 3lw3_A | 145 | HP0420 homologue; hotdog-fold, structural genomics | 93.24 | |
| 4i82_A | 137 | Putative uncharacterized protein; PAAI/YDII-like, | 92.57 | |
| 1q6w_A | 161 | Monoamine oxidase regulatory protein, putative; st | 92.16 | |
| 3ir3_A | 148 | HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc | 91.22 | |
| 2b3n_A | 159 | Hypothetical protein AF1124; structural genomics, | 91.19 | |
| 2f41_A | 121 | Transcription factor FAPR; 'HOT-DOG' fold, gene re | 90.08 | |
| 4h4g_A | 160 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 89.38 | |
| 4ffu_A | 176 | Oxidase; structural genomics, protein structure in | 88.59 | |
| 3exz_A | 154 | MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A | 88.42 | |
| 3k67_A | 159 | Putative dehydratase AF1124; hypothetical protein | 88.14 | |
| 3d6x_A | 146 | (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; | 88.02 | |
| 1pn2_A | 280 | Peroxisomal hydratase-dehydrogenase-epimerase; hot | 87.41 | |
| 1q4t_A | 151 | Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A | 87.03 | |
| 2ov9_A | 216 | Hypothetical protein; rhodococcus SP. RHA1, RHA085 | 86.61 | |
| 2gll_A | 171 | FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d | 86.3 | |
| 3kh8_A | 332 | MAOC-like dehydratase; hot DOG domain, lyase; 2.00 | 85.81 | |
| 2qwz_A | 159 | Phenylacetic acid degradation-related protein; put | 85.4 | |
| 2f3x_A | 157 | Transcription factor FAPR; 'HOT-DOG' fold / malony | 85.39 | |
| 3f5o_A | 148 | Thioesterase superfamily member 2; hotdog fold, hy | 83.68 | |
| 1u1z_A | 168 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd | 83.29 | |
| 4i83_A | 152 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; | 82.79 | |
| 3bbj_A | 272 | Putative thioesterase II; structural genomics, joi | 81.91 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 81.14 | |
| 1s9c_A | 298 | Peroxisomal multifunctional enzyme type 2; hot-DOG | 80.91 | |
| 1vh9_A | 149 | P15, hypothetical protein YBDB; structural genomic | 80.59 | |
| 3cjy_A | 259 | Putative thioesterase; YP_496845.1, structural gen | 80.51 | |
| 2c2i_A | 151 | RV0130; hotdog, hydratase, lyase, structural prote | 80.18 |
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.4e-55 Score=417.17 Aligned_cols=246 Identities=22% Similarity=0.440 Sum_probs=210.5
Q ss_pred ceeEEEEEEeeecccCCCCCcCHHHHHHHHHHHHHHHHHhhccccCCCCcchhhccCCeEEEEEEeEEEEeecCCCCCEE
Q 015302 100 GVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGEVV 179 (409)
Q Consensus 100 g~~y~~~~~VR~~EvD~~g~v~~~~~l~ylQEaa~~h~~~~g~l~~Gfg~~~~m~~~gl~WVV~r~~Ie~~r~p~~gD~V 179 (409)
+++|+++|+||+||||++||+++++|++|||+||.+|+.. .|+++. +|.+.|++|||++++|+|.+||+|||.|
T Consensus 5 ~~i~t~~f~Vr~~e~D~~g~v~~~~~l~~~q~a~~~~~~~-----~G~~~~-~l~~~g~~wVv~~~~i~~~r~~~~~d~v 78 (250)
T 4gak_A 5 AFIQTDTFTLRGYECDAFGRMSIPALMNLMQESANRNAID-----YGIGIA-DLAQKGVGWMLMRFCLRIHQYPRYGDTI 78 (250)
T ss_dssp CCCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHH-----HTCSHH-HHHTTTEEEEEEEEEEEESSCCBTTCEE
T ss_pred CceEEEEEEECHHHcCCCCcCCHHHHHHHHHHHHHHHHHH-----cCCCHH-HHHhcCceEEEEEEEEEEecCCCCCCEE
Confidence 5689999999999999999999999999999999999862 377764 7999999999999999999999999999
Q ss_pred EEEEEEeeeCCceEEEEEEEEEcCCCcEEEEEEEccEEEEEEEcCCCceecCCHHHHHhcCccccccccccccCcccccC
Q 015302 180 EIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIITWVMMNQQTRRLSKIPAEVRAEISPWFIDKQAIIEDVPEKISK 259 (409)
Q Consensus 180 ~I~Twv~~~gr~~~~Rdf~I~d~~~GeviarAtS~~~~WV~mD~~tRRp~riPeevre~i~p~~~~~~~~~~~~~~ki~k 259 (409)
+|+||+.+.++.++.|+|.|++ ++|+++++|+| +||+||++||||+|||+++++.+.++..++.+.....+.++..
T Consensus 79 ~V~T~~~~~~~~~~~r~~~i~d-~~g~~l~~a~s---~wv~iD~~trrp~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~ 154 (250)
T 4gak_A 79 QLMTYPTTVDKYFIHRDFRVLA-TDGTLLADARS---TWLVFSMEKRSMVPLPDFIRQLSPPANVDPLPALPLKPDFQTA 154 (250)
T ss_dssp EEEEEEEEECSSEEEEEEEEEE-TTCCEEEEEEE---EEEEEETTTTEEECCCHHHHTCCCCTTCCCCCCCCSSCGGGGC
T ss_pred EEEEEEEEcCCCEEEEEEEEEe-CCCCEEEEEEE---EEEeeccccCCCcCCCHHHHhhcccccccccccccccchhccc
Confidence 9999999999999999999998 79999999999 9999999999999999999998887765432211111222211
Q ss_pred CCccccccccceeeccccCccCCccchHHHHHHHHHhCCcchhcccceEEEEEEEecccCCCCeEEEEEEEcCCceeeec
Q 015302 260 LDDTAKYVNSDLKPKRSDLDMNHHVNNVKYVRWMLETIPDRILESNQLSGITLEYRRECGGSDVVQSLCQPDEDGILKDG 339 (409)
Q Consensus 260 l~~~~~~~~~~~~vr~sDlD~NgHVNN~~Yl~w~~ealp~~~~~~~~l~~i~I~Y~~E~~~gd~v~~~t~~~~~~~~~~~ 339 (409)
+.. .....+++|||+|||+||||||++|++|++|++|.++++.+.+++++|+|++|+++||.|.+.+++++++
T Consensus 155 -~~~-~~~~~~~~vr~~d~D~~gHvNN~~Y~~~~~e~~~~~~~~~~~~~~~~i~y~~e~~~gd~l~~~~~~~~~~----- 227 (250)
T 4gak_A 155 -SFA-TAASKSVQVGWLNIDQNQHVNNVAYVQWLLEGVDSEIVQTREIAEIDLVYRTESHWHDWLSVQSVTETDN----- 227 (250)
T ss_dssp -CCT-TSCCEEEECCGGGBCTTSSBCHHHHHHHHHHTSCHHHHHHCCEEEEEEEECSCCCTTCEEEEEEEEEETT-----
T ss_pred -ccc-cceeEEEEeCHHHcCccCcccHHHHHHHHHHHhhHHHHHhcCeeEEEEEEcccCCCCCEEEEEEEEecCC-----
Confidence 111 1224579999999999999999999999999999999999999999999999999999999999876432
Q ss_pred eeccccceeeccCcccceeeecCCCcccccCCCceEEEEEEEecCCCCcceEEEeEeeee
Q 015302 340 VKQDTASIRLLNGFSLASEIVDGGGLIASFEKGPLRFTHLLQAKGETQNEEIVRGRTTWK 399 (409)
Q Consensus 340 ~~~~~~~~~~~~g~~~~~~~~~g~~~~~~~~~~~~~~~hllr~~~~~~~~ei~rgrT~W~ 399 (409)
...+++.+.++| .++++|+|+||
T Consensus 228 ----------------------------------~~~~~i~~~~dg---~~~~~a~t~Wr 250 (250)
T 4gak_A 228 ----------------------------------SVLHRISQTESG---KDVLLARSRWR 250 (250)
T ss_dssp ----------------------------------EEEEEEEETTTC---CEEEEEEEEEC
T ss_pred ----------------------------------eEEEEEEECCCC---cEEEEEEEEEC
Confidence 123456666655 89999999997
|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} | Back alignment and structure |
|---|
| >2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A | Back alignment and structure |
|---|
| >1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* | Back alignment and structure |
|---|
| >2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A | Back alignment and structure |
|---|
| >2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} | Back alignment and structure |
|---|
| >2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A | Back alignment and structure |
|---|
| >4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 | Back alignment and structure |
|---|
| >2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A | Back alignment and structure |
|---|
| >2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} | Back alignment and structure |
|---|
| >1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* | Back alignment and structure |
|---|
| >3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A | Back alignment and structure |
|---|
| >3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 | Back alignment and structure |
|---|
| >4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* | Back alignment and structure |
|---|
| >1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A | Back alignment and structure |
|---|
| >3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A | Back alignment and structure |
|---|
| >3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A | Back alignment and structure |
|---|
| >2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} | Back alignment and structure |
|---|
| >2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 | Back alignment and structure |
|---|
| >2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} | Back alignment and structure |
|---|
| >2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A | Back alignment and structure |
|---|
| >1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A | Back alignment and structure |
|---|
| >4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 | Back alignment and structure |
|---|
| >3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A | Back alignment and structure |
|---|
| >2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A | Back alignment and structure |
|---|
| >3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* | Back alignment and structure |
|---|
| >1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* | Back alignment and structure |
|---|
| >2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* | Back alignment and structure |
|---|
| >3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} | Back alignment and structure |
|---|
| >2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A | Back alignment and structure |
|---|
| >1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 | Back alignment and structure |
|---|
| >4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S | Back alignment and structure |
|---|
| >1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 | Back alignment and structure |
|---|
| >3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 409 | ||||
| d2essa1 | 149 | d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroi | 2e-21 | |
| d2owna1 | 147 | d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesteras | 2e-18 | |
| d2essa2 | 98 | d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacter | 4e-11 | |
| d2owna2 | 109 | d.38.1.8 (A:150-258) Putative oleoyl-ACP thioester | 1e-08 | |
| d2o5ua1 | 139 | d.38.1.1 (A:5-143) Hypothetical thioesterase PA518 | 2e-08 | |
| d1njka_ | 133 | d.38.1.1 (A:) Hypothetical protein YbaW {Escherich | 2e-07 | |
| d1s5ua_ | 129 | d.38.1.1 (A:) Hypothetical protein YbgC {Escherich | 2e-06 | |
| d2oafa1 | 143 | d.38.1.1 (A:1-143) Hypothetical protein Jann0674 { | 2e-06 | |
| d2oiwa1 | 131 | d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus ste | 3e-06 | |
| d1lo7a_ | 140 | d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {P | 4e-06 | |
| d2nuja1 | 159 | d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 | 2e-05 | |
| d2alia1 | 130 | d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Ps | 3e-05 | |
| d2hx5a1 | 144 | d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {P | 4e-05 | |
| d2cyea1 | 132 | d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 | 6e-04 | |
| d2fuja1 | 118 | d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {X | 0.001 | |
| d2hlja1 | 156 | d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Ps | 0.001 | |
| d2gf6a1 | 134 | d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {A | 0.002 | |
| d1z54a1 | 132 | d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 | 0.004 |
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 149 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: Acyl-ACP thioesterase-like domain: Acyl-ACP thioesterase species: Bacteroides thetaiotaomicron [TaxId: 818]
Score = 87.9 bits (217), Expect = 2e-21
Identities = 31/149 (20%), Positives = 54/149 (36%), Gaps = 10/149 (6%)
Query: 103 YRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVV 162
V + V + T+ + N A H S+ + +N WV+
Sbjct: 8 GTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFH------ASDRGFGIATLNEDNYTWVL 61
Query: 163 SRMQVEIDHYPIWGEVVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIITWVMMN 222
SR+ +E+D P E + TWV + R++ + + I W M+N
Sbjct: 62 SRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVIDKDGKKIG----YARSVWAMIN 117
Query: 223 QQTRRLSKIPAEVRAEISPWFIDKQAIIE 251
TR+ + + A I + D+ IE
Sbjct: 118 LNTRKPADLLALHGGSIVDYICDEPCPIE 146
|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 147 | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 98 | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 109 | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Length = 139 | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Length = 129 | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Length = 143 | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 131 | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Length = 159 | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Length = 144 | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Length = 132 | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Length = 118 | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Length = 156 | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Length = 132 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 409 | |||
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 99.97 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 99.96 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 99.93 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 99.91 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 99.89 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 99.89 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 99.88 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 99.88 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 99.87 | |
| d2alia1 | 130 | Hypothetical protein PA2801 {Pseudomonas aeruginos | 99.87 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 99.87 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 99.86 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 99.85 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 99.85 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 99.85 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 99.84 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 99.84 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 99.79 | |
| d2owna2 | 109 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 99.55 | |
| d2fuja1 | 118 | Hypothetical protein XCC1147 {Xanthomonas campestr | 99.37 | |
| d1njka_ | 133 | Hypothetical protein YbaW {Escherichia coli [TaxId | 99.35 | |
| d2oiwa1 | 131 | GK1870 orthologue {Bacillus stearothermophilus [Ta | 99.33 | |
| d2alia1 | 130 | Hypothetical protein PA2801 {Pseudomonas aeruginos | 99.3 | |
| d1s5ua_ | 129 | Hypothetical protein YbgC {Escherichia coli [TaxId | 99.29 | |
| d2cyea1 | 132 | Probable thioesterase TTHA1846 {Thermus thermophil | 99.29 | |
| d2nuja1 | 159 | Hypothetical protein Jann_1972 {Jannaschia sp. CCS | 99.28 | |
| d2o5ua1 | 139 | Hypothetical thioesterase PA5185 {Pseudomonas aeru | 99.26 | |
| d2essa2 | 98 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 99.26 | |
| d1lo7a_ | 140 | 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. | 99.21 | |
| d1z54a1 | 132 | Probable thioesterase TTHA0908 {Thermus thermophil | 99.2 | |
| d2hlja1 | 156 | Hypothetical protein PP0301 {Pseudomonas putida [T | 99.18 | |
| d2owna1 | 147 | Putative oleoyl-ACP thioesterase LP0708 {Lactobaci | 99.16 | |
| d2hx5a1 | 144 | Hypothetical protein PMT2055 {Prochlorococcus mari | 99.16 | |
| d2gf6a1 | 134 | Hypothetical protein SSO2295 {Archaeon Sulfolobus | 99.14 | |
| d2oafa1 | 143 | Hypothetical protein Jann0674 {Jannaschia sp. ccs1 | 99.13 | |
| d2essa1 | 149 | Acyl-ACP thioesterase {Bacteroides thetaiotaomicro | 98.97 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 98.27 | |
| d2gvha2 | 116 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 98.03 | |
| d1y7ua1 | 164 | Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: | 97.98 | |
| d1vpma_ | 155 | Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta | 97.92 | |
| d2f0xa1 | 136 | Hypothetical protein Them2 {Human (Homo sapiens) [ | 97.85 | |
| d2hboa1 | 142 | Hypothetical protein CC3309 {Caulobacter crescentu | 97.78 | |
| d2gvha1 | 135 | Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter | 97.78 | |
| d1zkia1 | 126 | Hypothetical protein PA5202 {Pseudomonas aeruginos | 97.64 | |
| d1sc0a_ | 137 | Hypothetical protein HI1161 {Haemophilus influenza | 97.61 | |
| d1vh5a_ | 138 | Hypothetical protein YdiI {Escherichia coli [TaxId | 97.53 | |
| d1q4ua_ | 140 | 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp | 97.43 | |
| d2ov9a1 | 203 | Hypothetical protein RHA1_ro05818 {Rhodococcus sp. | 97.43 | |
| d1wlua1 | 116 | Phenylacetic acid degradation protein PaaI {Thermu | 97.41 | |
| d2cwza1 | 138 | Hypothetical protein TTHA0967 {Thermus thermophilu | 97.36 | |
| d1ixla_ | 130 | Hypothetical protein PH1136 {Archaeon Pyrococcus h | 97.34 | |
| d2fs2a1 | 131 | Phenylacetic acid degradation protein PaaI {Escher | 97.19 | |
| d1vh9a_ | 138 | Hypothetical protein YbdB {Escherichia coli [TaxId | 97.17 | |
| d2q78a1 | 130 | Uncharacterized protein TM0581 {Thermotoga maritim | 96.57 | |
| d2f41a1 | 111 | Transcription factor FapR, C-terminal domain {Baci | 96.02 | |
| d1yoca1 | 145 | Hypothetical protein PA1835 {Pseudomonas aeruginos | 91.07 | |
| d1sh8a_ | 153 | Hypothetical protein PA5026 {Pseudomonas aeruginos | 90.91 | |
| d1s9ca2 | 154 | 2-enoyl-coa hydratase domain of multifunctional pe | 89.13 | |
| d1iq6a_ | 132 | (R)-specific enoyl-CoA hydratase {Aeromonas caviae | 89.07 | |
| d1u1za_ | 145 | (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo | 88.94 | |
| d1ylia1 | 142 | Putative acyl-coa thioester hydrolase HI0827 {Haem | 88.5 | |
| d1t82a_ | 143 | Putative thioesterase SO4397 {Shewanella oneidensi | 88.09 | |
| d2b3na1 | 154 | Hypothetical protein AF1124 {Archaeon Archaeoglobu | 85.9 | |
| d1pn2a1 | 148 | 2-enoyl-coa hydratase domain of multifunctional pe | 85.79 | |
| d2bi0a1 | 178 | Hypothetical protein Rv0216/MT0226 {Mycobacterium | 80.64 |
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Thioesterase/thiol ester dehydrase-isomerase superfamily: Thioesterase/thiol ester dehydrase-isomerase family: Acyl-ACP thioesterase-like domain: Acyl-ACP thioesterase species: Bacteroides thetaiotaomicron [TaxId: 818]
Probab=99.97 E-value=5.5e-30 Score=224.35 Aligned_cols=139 Identities=24% Similarity=0.352 Sum_probs=125.7
Q ss_pred cCceeEEEEEEeeecccCCCCCcCHHHHHHHHHHHHHHHHHhhccccCCCCcchhhccCCeEEEEEEeEEEEeecCCCCC
Q 015302 98 EGGVGYRQTVVVRSYEVGPDKTATLESILNLFQETALNHVWMSGLLSNGFGATHGMMRNNLIWVVSRMQVEIDHYPIWGE 177 (409)
Q Consensus 98 ~~g~~y~~~~~VR~~EvD~~g~v~~~~~l~ylQEaa~~h~~~~g~l~~Gfg~~~~m~~~gl~WVV~r~~Ie~~r~p~~gD 177 (409)
++..+|+.++.|+++|||.+||+++..|++||||||.+|+. ..|+++. +|.+.|++|||++++|+|+++|.+||
T Consensus 3 ~~~~i~t~~~~v~~~~~D~~G~~~~~~y~~~~~d~~~~~~~-----~~G~~~~-~l~~~g~~~vv~~~~i~y~~~~~~gd 76 (149)
T d2essa1 3 EENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHAS-----DRGFGIA-TLNEDNYTWVLSRLAIELDEMPYQYE 76 (149)
T ss_dssp TGGGCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHH-----HTTCSHH-HHHHTTEEEEEEEEEEEESCCCBTTC
T ss_pred ccCcEEEEEEEeCHHHCCCCCCcCHHHHHHHHHHHHHHHHH-----HcCcchh-hHhccCceEEEEEEEEEEeeccccCc
Confidence 46689999999999999999999999999999999999986 3478874 78999999999999999999999999
Q ss_pred EEEEEEEEeeeCCceEEEEEEEEEcCCCcEEEEEEEccEEEEEEEcCCCceecCCHHHHHhcCcccccc
Q 015302 178 VVEIDTWVGASGKNGMRRDWLIRSQATGHIFARATRYIITWVMMNQQTRRLSKIPAEVRAEISPWFIDK 246 (409)
Q Consensus 178 ~V~I~Twv~~~gr~~~~Rdf~I~d~~~GeviarAtS~~~~WV~mD~~tRRp~riPeevre~i~p~~~~~ 246 (409)
+|+|.||+...++.++.|+|.|++ ++|+++|+|.+ +||+||++||||+++|+++++.+.++..++
T Consensus 77 ~v~V~t~~~~~~~~~~~~~~~i~~-~~g~~ia~a~~---~~v~id~~t~kp~~ip~~~~~~~~~~~~~~ 141 (149)
T d2essa1 77 KFSVQTWVENVYRLFTDRNFAVID-KDGKKIGYARS---VWAMINLNTRKPADLLALHGGSIVDYICDE 141 (149)
T ss_dssp EEEEEEEEEEECSSEEEEEEEEEC-TTSCEEEEEEE---EEEEEETTTCCBC----CTTSSGGGGBCCC
T ss_pred eeeEEEEEeeeccceEEEEEEEEe-cCCcEEEEEEE---EEEEEECCCCCcCCCCHHHHHHHHhhhccC
Confidence 999999999999999999999997 78999999999 999999999999999999998888776654
|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} | Back information, alignment and structure |
|---|
| >d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} | Back information, alignment and structure |
|---|
| >d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} | Back information, alignment and structure |
|---|
| >d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|