Citrus Sinensis ID: 015384

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKCEEAFVSKRKMGFDPSKKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYKNRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKLEKWLEEAGKPLSSQVITRKQNVSASLTEDSCFWAHVEEALIQCELLRNGQEEESTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLYQQYH
cEEEcccHHHHHHHHHHHHHHHHccccccccccEEEccccccccHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccccccccHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHcHHHHccc
cEEEccccHHHHHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHccccccEEEEEEcccccccccccccHHcccccccccccccHHHHHHcccHHHHHHHHHEHcccccccccccccHHHcHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHcccccHHHHHHHHHHHHcccccccHHHHHHHcccHHHcc
mivtghclggsVASLFTLWLLEsinrpgtkrplcitfgapligdkgLQQAISQNLMWNSDFLHvaasqdldpeAVSEVLVAMDLEiarnkppneqwhmIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIglnrrqqsgdsnpliAKLEKCEEAFVSkrkmgfdpskklnKRKEDMAKLEWYKKVSksedkgyydsyknrgskkdlHVVTFKKSLTNYWKEMVAEVErmpqkeeasfrtrwlyggtnyrrmveplDIADYYkengkkdykangrseHYIKLEKWLEEagkplssqVITRKqnvsasltedSCFWAHVEEALIQCELLRNGQEEESTRKKLIEFEEYVMEQIKEYavspeiflggssFMQWWKDYEQIVGTSYKSQLTDFMKsrlyqqyh
mivtghclggSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEiarnkppneqwHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKCEEAFvskrkmgfdpskklnkrkedmaklewykkvsksedkgyydsyknrgskkdlhvvtFKKSLTNYWKEMVAEvermpqkeeasfrtrwlyggtnyrrMVEPLDIADYYKEngkkdykangrsEHYIKLEKWLEEAGKPLSSQVITRKQNVSASLTEDSCFWAHVEEALIQCEllrngqeeesTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLYQQYH
MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKCEEAFVSKRKMGFDPSKKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYKNRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKLEKWLEEAGKPLSSQVITRKQNVSASLTEDSCFWAHVEEALIQCELLRNGQEEESTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLYQQYH
**VTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLN***********************************************WY**********YY*********KDLHVVTFKKSLTNYWKEMVAEVER******ASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKLEKWLEEAG******VITRKQNVSASLTEDSCFWAHVEEALIQCELLRN********KKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFM*********
MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTV***********IECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKC********************RKEDMAKLEWYKKVSKSEDKGYYDSYKNRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKD***NGRSEHYIKLEKW**************************SCFWAHVEEAL******************LIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRL*****
MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKCEEAFVSKRKMGFDPSKKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYKNRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKLEKWLEEAGKPLSSQVITRKQNVSASLTEDSCFWAHVEEALIQCELLRNGQEEESTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLYQQYH
MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKCEEAFVSKRKMGFDPSKKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYKNRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKLEKWLEEAG****************SLTEDSCFWAHVEEALIQCELLRNGQEEESTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLY****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLNRRQQSGDSNPLIAKLEKCEEAFVSKRKMGFDPSKKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYKNRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKLEKWLEEAGKPLSSQVITRKQNVSASLTEDSCFWAHVEEALIQCELLRNGQEEESTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLYQQYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
224109964 581 predicted protein [Populus trichocarpa] 0.970 0.681 0.498 1e-108
255552710 600 hypothetical protein RCOM_0852460 [Ricin 0.985 0.67 0.481 1e-105
224144407 605 predicted protein [Populus trichocarpa] 0.997 0.672 0.474 1e-103
356573402 740 PREDICTED: uncharacterized protein LOC10 0.982 0.541 0.476 1e-102
224105745470 predicted protein [Populus trichocarpa] 0.914 0.793 0.458 2e-96
359488866 577 PREDICTED: uncharacterized protein LOC10 0.977 0.691 0.454 2e-96
359477232 612 PREDICTED: uncharacterized protein LOC10 0.970 0.647 0.456 3e-96
359488733 576 PREDICTED: uncharacterized protein LOC10 0.977 0.692 0.466 6e-96
359477238 612 PREDICTED: uncharacterized protein LOC10 0.970 0.647 0.454 8e-95
356550192 582 PREDICTED: uncharacterized protein LOC10 0.975 0.683 0.475 1e-94
>gi|224109964|ref|XP_002333172.1| predicted protein [Populus trichocarpa] gi|222835003|gb|EEE73452.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 220/441 (49%), Positives = 287/441 (65%), Gaps = 45/441 (10%)

Query: 1   MIVTGHCLGGSVASLFTLWLLESINRPGT--KRPLCITFGAPLIGDKGLQQAISQNLMWN 58
           +IVTGH LGGS+ASLFTLWLL++I R     K PLCITFG+PL+GD+GLQ+AIS++  WN
Sbjct: 136 LIVTGHSLGGSIASLFTLWLLDNIKRTSNRNKLPLCITFGSPLLGDQGLQRAISEHSKWN 195

Query: 59  SDFLHVAASQDLDPEA------------------VSEV---------LVAMDLEIARNKP 91
           S FLHVAA++DL P                     SE+         +V+M L    N+ 
Sbjct: 196 SCFLHVAANKDLFPRIFTTSQPSPRCKPFGTFFFCSELGCNCVDDPEVVSMLLRSTINQV 255

Query: 92  PNEQWHMIDYGAVVKRLMSTVRFKGISQLSEMIECPLQAGIVLQLQAIGLN----RRQQS 147
             E+  + DY  +VKRL S +  +  SQL + +   L+ GI+LQL+AIG+     ++QQ+
Sbjct: 256 SAEEMGIDDYSGIVKRLKSRLILREDSQLGQPVLPSLRLGIILQLKAIGVEITAEQQQQN 315

Query: 148 GDSNPLIAKLEKCEEAFVSKRKMGFDPSKKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYK 207
              N LI++LE  E     + K G D  +KLN+ K  MA LEWYKK  K++  GYYDSYK
Sbjct: 316 NSINDLISELESHENRMAQQMK-GIDGIEKLNRVKIKMACLEWYKKDCKAKGIGYYDSYK 374

Query: 208 NRGSKKDLHVVTFKKSLTNYWKEMVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIA 267
           N     D  V   KK LTNYW+ +V + ER PQKE A  R  WLY GTNYRRMVEPLDIA
Sbjct: 375 NLYFCSDNDVTKHKKVLTNYWRNLVEDAERKPQKEGAYMRETWLYAGTNYRRMVEPLDIA 434

Query: 268 DYYKENGKKDYKANGRSEHYIKLEKWLEE-----AGKPLSSQVITRKQNVSASLTEDSCF 322
           +YY++ GK+DY+ NGRS+HYI LE+W +E     AG P       +KQNV+ SLTEDSCF
Sbjct: 435 EYYRQEGKRDYQTNGRSKHYILLEQWQKEHTEKLAGAPNDK----KKQNVAGSLTEDSCF 490

Query: 323 WAHVEEALIQCELLRNGQ--EEESTRKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWW 380
           W +VEEALI C+ L++G   E++S R++L  FE+YVM+QI  YAVSP+IFL  SSFM WW
Sbjct: 491 WMNVEEALISCKQLKDGSNVEKQSARERLNMFEQYVMDQINNYAVSPDIFLEKSSFMNWW 550

Query: 381 KDYEQIVGTSYKSQLTDFMKS 401
           KD+++I+ TS+ S L  FMK+
Sbjct: 551 KDFQEIIETSHDSPLRGFMKN 571

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255552710|ref|XP_002517398.1| hypothetical protein RCOM_0852460 [Ricinus communis] gi|223543409|gb|EEF44940.1| hypothetical protein RCOM_0852460 [Ricinus communis] Back     alignment and taxonomy information
>gi|224144407|ref|XP_002325280.1| predicted protein [Populus trichocarpa] gi|222862155|gb|EEE99661.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356573402|ref|XP_003554850.1| PREDICTED: uncharacterized protein LOC100797620 [Glycine max] Back     alignment and taxonomy information
>gi|224105745|ref|XP_002313919.1| predicted protein [Populus trichocarpa] gi|222850327|gb|EEE87874.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488866|ref|XP_002275404.2| PREDICTED: uncharacterized protein LOC100266391 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477232|ref|XP_002271293.2| PREDICTED: uncharacterized protein LOC100256873 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488733|ref|XP_003633808.1| PREDICTED: uncharacterized protein LOC100249226 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477238|ref|XP_003631951.1| PREDICTED: uncharacterized protein LOC100855355 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550192|ref|XP_003543472.1| PREDICTED: uncharacterized protein LOC100809557 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
TAIR|locus:2147825537 SAG101 "senescence-associated 0.928 0.705 0.428 1.8e-69
TAIR|locus:2079939541 PAD4 "PHYTOALEXIN DEFICIENT 4" 0.674 0.508 0.283 3.3e-31
TAIR|locus:2097855623 EDS1 "enhanced disease suscept 0.531 0.348 0.275 3.8e-20
TAIR|locus:2097840629 AT3G48080 [Arabidopsis thalian 0.558 0.362 0.266 7.6e-20
TAIR|locus:2147825 SAG101 "senescence-associated gene 101" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 704 (252.9 bits), Expect = 1.8e-69, P = 1.8e-69
 Identities = 181/422 (42%), Positives = 242/422 (57%)

Query:     1 MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSD 60
             +I+TG  LGGSVASL+TLWLLE+I  P  KRPLCITFG+PLIGD  LQQ I +N + NS 
Sbjct:   140 VIITGAALGGSVASLYTLWLLETIE-PTLKRPLCITFGSPLIGDASLQQ-ILENSVRNSC 197

Query:    61 FLHVAASQDLDPEAVSEVLVAMDLEIARNKPPNEQWHMIDYGAVVKRLMSTVRFKGISQL 120
             FLHV ++Q           + MD      KP        D G V   +   V       +
Sbjct:   198 FLHVVSAQ---------TRIKMDFF----KPFGTFLICFDSGCVC--IEDHVA------V 236

Query:   121 SEMIECPLQAGIVLQLQAIGLNRRQQS----GDSNPLIAKLEKCEEAFVSKRKMGFDPS- 175
             +E++     +G+V   Q   LNR  QS     DS  +   + K  E     + + FD   
Sbjct:   237 TELLNGVHDSGLVDYSQV--LNRLDQSMLSLADSRLIPEDVIKGIEKRAEMKNLRFDMMF 294

Query:   176 KKLNKRKEDMAKLEWYKKVSKSEDKGYYDSYKNR---GSKK-DLHVVTFKKS-LTNYWKE 230
             KKLN  K  MA +EWYKK  K    GYYD +K +    SK+ D+++    KS L  +WK 
Sbjct:   295 KKLNDMKISMAYIEWYKKKCKEVKIGYYDRFKTQLAFPSKEFDINIKNHHKSELNRFWKS 354

Query:   231 MVAEVERMPQKEEASFRTRWLYGGTNYRRMVEPLDIADYYKENGKKDYKANGRSEHYIKL 290
             +V EVER PQ + +  + R+L+ G NYRRM+EPLDIA+YY E G+K+Y+  GRS HY+ L
Sbjct:   355 VVEEVERRPQSDASILKRRFLFSGNNYRRMIEPLDIAEYYLE-GRKEYRTTGRSHHYVML 413

Query:   291 EKWLEEAGKPLSSQVITRKQNVSASLTEDSCFWAHVEEALIQCELLRN--GQEE---EST 345
             EKW       +  +   +K+++S  LT DSCFWA VE++LI    L    G  +   E  
Sbjct:   414 EKWFGMESILIEKERC-KKRDLSDLLTFDSCFWAEVEDSLIVINQLNTTVGMRDDVREVL 472

Query:   346 RKKLIEFEEYVMEQIKEYAVSPEIFLGGSSFMQWWKDYEQIVGTSYKSQLTDFMKSRLYQ 405
              +KL+EFE YV E I +  VSPEIFL  SSFM+WWK+Y++I G +  S LT+FM +R Y+
Sbjct:   473 TRKLVEFEGYVWEIITKREVSPEIFLEESSFMKWWKEYKKIKGFN-SSYLTEFMNTRKYE 531

Query:   406 QY 407
              Y
Sbjct:   532 SY 533
GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS
GO:0006629 "lipid metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0004091 "carboxylesterase activity" evidence=IDA
GO:0007568 "aging" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
TAIR|locus:2079939 PAD4 "PHYTOALEXIN DEFICIENT 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097855 EDS1 "enhanced disease susceptibility 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097840 AT3G48080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03940006
hypothetical protein (581 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
pfam01764141 pfam01764, Lipase_3, Lipase (class 3) 7e-11
cd00519229 cd00519, Lipase_3, Lipase (class 3) 4e-10
cd00741153 cd00741, Lipase, Lipase 5e-09
PLN02934515 PLN02934, PLN02934, triacylglycerol lipase 0.004
>gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) Back     alignment and domain information 
 Score = 59.6 bits (145), Expect = 7e-11
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 1   MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNL 55
           ++VTGH LGG++ASL    L E+   P   R    TFG+P +G+    +      
Sbjct: 65  IVVTGHSLGGALASLAAADLAENGLFPS-SRIRVYTFGSPRVGNYAFAELHDSLG 118

Length = 141
>gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|215504 PLN02934, PLN02934, triacylglycerol lipase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 99.77
PLN02324415 triacylglycerol lipase 99.72
PLN02310405 triacylglycerol lipase 99.71
PLN02408365 phospholipase A1 99.71
PLN02934515 triacylglycerol lipase 99.71
PLN02162475 triacylglycerol lipase 99.71
PLN02454414 triacylglycerol lipase 99.69
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 99.69
PLN03037525 lipase class 3 family protein; Provisional 99.69
KOG4569336 consensus Predicted lipase [Lipid transport and me 99.69
PLN02719518 triacylglycerol lipase 99.69
PLN02802509 triacylglycerol lipase 99.68
PLN00413479 triacylglycerol lipase 99.68
PLN02753531 triacylglycerol lipase 99.68
PLN02571413 triacylglycerol lipase 99.67
PLN02761527 lipase class 3 family protein 99.66
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.55
PLN02847633 triacylglycerol lipase 99.32
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 98.03
COG5153425 CVT17 Putative lipase essential for disintegration 97.94
KOG4540425 consensus Putative lipase essential for disintegra 97.94
COG3675332 Predicted lipase [Lipid metabolism] 97.07
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.13
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 95.79
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 93.98
COG3675332 Predicted lipase [Lipid metabolism] 93.86
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 93.28
KOG2564343 consensus Predicted acetyltransferases and hydrola 93.24
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 92.02
PHA02857276 monoglyceride lipase; Provisional 91.85
PRK10749330 lysophospholipase L2; Provisional 91.72
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 91.48
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 91.47
PLN02965255 Probable pheophorbidase 91.37
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 91.31
KOG2088596 consensus Predicted lipase/calmodulin-binding heat 91.3
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 91.24
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 91.02
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 90.72
PLN02824294 hydrolase, alpha/beta fold family protein 90.67
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 90.55
PLN02298330 hydrolase, alpha/beta fold family protein 90.54
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 90.5
PRK10673255 acyl-CoA esterase; Provisional 90.34
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 90.28
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 90.24
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 90.08
PRK10985324 putative hydrolase; Provisional 89.97
PLN02385349 hydrolase; alpha/beta fold family protein 89.94
COG2267298 PldB Lysophospholipase [Lipid metabolism] 89.89
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 89.65
PRK13604307 luxD acyl transferase; Provisional 89.42
TIGR03611257 RutD pyrimidine utilization protein D. This protei 89.02
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 88.81
PRK10349256 carboxylesterase BioH; Provisional 88.77
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 88.74
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 88.67
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 88.57
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 88.53
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 88.38
KOG3724 973 consensus Negative regulator of COPII vesicle form 88.04
PLN02211273 methyl indole-3-acetate methyltransferase 88.02
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 88.0
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 87.93
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 87.85
PRK11071190 esterase YqiA; Provisional 87.82
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 87.47
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 87.29
PRK03592295 haloalkane dehalogenase; Provisional 87.19
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 87.03
PLN02894402 hydrolase, alpha/beta fold family protein 86.62
PRK10566249 esterase; Provisional 86.41
PRK08775343 homoserine O-acetyltransferase; Provisional 86.26
PRK03204286 haloalkane dehalogenase; Provisional 86.08
PRK00870302 haloalkane dehalogenase; Provisional 85.63
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 85.37
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 85.02
PRK07581339 hypothetical protein; Validated 84.72
PLN00021313 chlorophyllase 84.51
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 84.33
KOG1455313 consensus Lysophospholipase [Lipid transport and m 84.16
PRK10162318 acetyl esterase; Provisional 83.82
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 83.76
PRK06489360 hypothetical protein; Provisional 83.47
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 83.01
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 82.88
PLN02578354 hydrolase 82.68
PLN02511388 hydrolase 82.22
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 81.93
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 81.86
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 81.84
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 80.56
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 80.24
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information 
Probab=99.77  E-value=6.9e-19  Score=151.59  Aligned_cols=73  Identities=27%  Similarity=0.502  Sum_probs=60.2

Q ss_pred             CEEeccChhHHHHHHHHHHHHHhcCCCCCCCCeEEEecCCCCCCHHHHHHHHhccCCCCcEEEEEECCCccccCCc
Q 015384            1 MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVS   76 (408)
Q Consensus         1 lv~TGHSLGGAlAsLaal~L~~~~~~~~~~~v~c~TFGsPrVGn~~Fa~~~~~~~~~~~~f~rVVn~~DiVPrlps   76 (408)
                      |+|||||||||+|+|+++++..... .....+.|||||+|++||..|+.++++..  ..+++||||..|+||++|+
T Consensus        66 i~itGHSLGGalA~l~a~~l~~~~~-~~~~~~~~~~fg~P~~~~~~~~~~~~~~~--~~~~~~iv~~~D~Vp~~p~  138 (140)
T PF01764_consen   66 IVITGHSLGGALASLAAADLASHGP-SSSSNVKCYTFGAPRVGNSAFAKWYDSLF--NRNIFRIVNQNDIVPRLPP  138 (140)
T ss_dssp             EEEEEETHHHHHHHHHHHHHHHCTT-TSTTTEEEEEES-S--BEHHHHHHHHHHT--SCGEEEEEETTBSGGGTS-
T ss_pred             chhhccchHHHHHHHHHHhhhhccc-ccccceeeeecCCccccCHHHHHHHHhhC--CCeEEEEEECCCEeeecCC
Confidence            6899999999999999999998732 22578999999999999999999997644  2368999999999999996

Lipases are widely distributed in animals, plants and prokaryotes. This family of lipases have been called Class 3 as they are not closely related to other lipase families.; GO: 0004806 triglyceride lipase activity, 0006629 lipid metabolic process; PDB: 1LGY_A 1DTE_A 1DT5_F 4DYH_B 1DU4_C 4EA6_B 1GT6_B 1EIN_A 1DT3_A 1TIB_A ....
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 8e-10
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 3e-09
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 3e-09
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 2e-08
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 2e-07
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 2e-07
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 2e-07
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 2e-07
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 6e-07
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 6e-06
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 Back     alignment and structure
 Score = 58.4 bits (141), Expect = 8e-10
 Identities = 16/69 (23%), Positives = 25/69 (36%), Gaps = 3/69 (4%)

Query: 2   IVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDF 61
            VTGH LGG+ A L  L L +      +      T G P +G+      +         +
Sbjct: 139 AVTGHSLGGATALLCALDLYQREEGLSSSNLFLYTQGQPRVGNPAFANYVVST---GIPY 195

Query: 62  LHVAASQDL 70
                 +D+
Sbjct: 196 RRTVNERDI 204
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 99.74
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 99.72
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 99.7
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 99.7
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 99.7
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 99.69
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 99.69
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 99.67
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 99.64
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 99.43
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 99.56
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 94.66
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 94.05
3lp5_A250 Putative cell surface hydrolase; structural genom 94.02
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 93.8
4fle_A202 Esterase; structural genomics, PSI-biology, northe 93.42
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 93.29
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 93.16
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 93.16
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 93.14
3h04_A275 Uncharacterized protein; protein with unknown func 93.13
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.13
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 93.09
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 93.03
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 92.93
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 92.84
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 92.8
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 92.74
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 92.7
3llc_A270 Putative hydrolase; structural genomics, joint cen 92.69
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 92.64
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 92.61
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 92.57
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 92.57
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 92.54
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 92.53
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 92.52
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 92.47
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 92.44
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 92.35
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 92.31
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 92.31
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 92.29
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 92.28
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 92.25
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 92.24
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 92.2
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 92.2
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 92.16
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 92.13
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 92.13
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 92.12
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 92.04
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 91.99
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 91.97
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 91.88
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 91.86
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 91.81
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 91.8
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 91.78
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 91.75
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 91.67
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 91.66
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 91.66
1iup_A282 META-cleavage product hydrolase; aromatic compound 91.64
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 91.61
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 91.6
2qub_A615 Extracellular lipase; beta roll, alpha/beta hydrol 91.59
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 91.54
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 91.53
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 91.53
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 91.53
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 91.53
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 91.52
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 91.5
1r3d_A264 Conserved hypothetical protein VC1974; structural 91.46
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 91.45
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 91.45
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 91.41
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 91.4
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 91.39
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 91.37
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 91.37
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 91.34
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 91.32
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 91.3
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 91.28
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 91.26
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 91.17
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 91.08
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 91.0
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 90.95
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 90.9
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 90.87
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 90.83
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 90.8
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 90.77
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 90.57
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 90.53
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 90.53
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 90.52
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 90.48
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 90.47
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 90.45
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 90.39
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 90.35
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 90.28
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 90.27
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 90.26
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 90.18
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 90.14
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 90.14
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 90.11
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 90.09
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 90.08
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 90.07
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 90.04
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 90.03
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 90.02
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 90.0
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 90.0
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 90.0
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 89.97
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 89.94
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 89.91
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 89.85
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 89.84
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 89.73
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 89.71
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 89.63
3bjr_A283 Putative carboxylesterase; structural genomics, jo 89.62
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 89.55
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 89.52
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 89.51
1vkh_A273 Putative serine hydrolase; structural genomics, jo 89.5
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 89.42
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 89.32
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 89.23
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 89.22
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 89.18
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 89.18
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 89.15
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 89.13
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 89.13
3ain_A323 303AA long hypothetical esterase; carboxylesterase 89.09
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 89.08
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 88.69
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 89.0
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 89.0
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 88.97
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 88.94
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 88.94
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 88.87
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 88.78
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 88.78
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 88.74
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 88.68
3tej_A329 Enterobactin synthase component F; nonribosomal pe 88.64
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 88.64
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 88.63
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 88.54
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 88.48
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 88.48
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 88.44
1kez_A300 Erythronolide synthase; polyketide synthase, modul 88.41
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 88.37
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 88.35
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 88.2
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 88.2
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 88.17
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 88.03
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 88.02
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 88.0
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 87.97
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 87.93
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 87.89
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 87.68
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 87.21
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 87.17
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 86.91
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 86.63
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 86.56
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 86.44
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 86.15
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 85.91
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 85.88
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 85.82
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 85.71
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 85.44
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 85.16
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 84.79
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 84.59
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 84.32
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 84.28
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 83.91
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 83.88
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 83.82
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 83.81
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 83.36
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 83.02
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 83.0
3nuz_A398 Putative acetyl xylan esterase; structural genomic 82.93
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 82.87
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 82.84
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 82.67
3d59_A383 Platelet-activating factor acetylhydrolase; secret 82.49
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 82.09
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 82.07
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 81.62
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 81.55
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 81.31
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 80.45
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 80.36
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
Probab=99.74  E-value=2.4e-18  Score=165.48  Aligned_cols=70  Identities=21%  Similarity=0.252  Sum_probs=62.2

Q ss_pred             CEEeccChhHHHHHHHHHHHHHhcCCCCCCCCeEEEecCCCCCCHHHHHHHHhccCCCCcEEEEEECCCccccCCc
Q 015384            1 MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVS   76 (408)
Q Consensus         1 lv~TGHSLGGAlAsLaal~L~~~~~~~~~~~v~c~TFGsPrVGn~~Fa~~~~~~~~~~~~f~rVVn~~DiVPrlps   76 (408)
                      |+|||||||||||+|+++++....   +..++.|||||+|||||..|++++++.   ...++||||..|+||++|+
T Consensus       126 i~vtGHSLGGalA~l~a~~l~~~~---~~~~v~~~tFg~PrvGn~~fa~~~~~~---~~~~~Rvvn~~D~VP~lPp  195 (258)
T 3g7n_A          126 LEAVGHSLGGALTSIAHVALAQNF---PDKSLVSNALNAFPIGNQAWADFGTAQ---AGTFNRGNNVLDGVPNMYS  195 (258)
T ss_dssp             EEEEEETHHHHHHHHHHHHHHHHC---TTSCEEEEEESCCCCBCHHHHHHHHHS---SSEEEEEEETTCBGGGTTC
T ss_pred             EEEeccCHHHHHHHHHHHHHHHhC---CCCceeEEEecCCCCCCHHHHHHHHhc---CCCeEEEEeCCCccCcCCC
Confidence            689999999999999999998873   245789999999999999999999764   2567899999999999996
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d1lgya_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni 2e-04
d1tiba_269 c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces 0.002
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizopus niveus [TaxId: 4844]

 Score = 40.6 bits (94), Expect = 2e-04
 Identities = 18/63 (28%), Positives = 27/63 (42%)

Query: 1   MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSD 60
           +IVTGH LGG+ A L  + L +   R   K     T G P +G+      +    +    
Sbjct: 135 VIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQR 194

Query: 61  FLH 63
            +H
Sbjct: 195 TVH 197
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 99.79
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 99.78
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 99.78
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 99.77
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 99.75
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.66
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 94.6
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 94.45
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 94.25
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 93.53
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 92.8
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 92.73
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 92.4
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 92.05
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 92.01
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 91.97
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 91.9
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 91.43
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 91.41
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 90.71
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 90.36
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 90.19
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 89.65
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 89.58
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 88.89
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 88.33
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 88.16
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 88.15
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 88.1
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 88.02
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 87.81
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 87.79
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 87.55
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 87.07
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 86.79
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 86.54
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 86.01
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 85.9
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 85.89
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 85.6
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 85.34
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 84.02
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 82.12
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 81.14
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 80.19
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizopus niveus [TaxId: 4844]

Probab=99.79  E-value=6.4e-20  Score=174.73  Aligned_cols=74  Identities=27%  Similarity=0.399  Sum_probs=64.5

Q ss_pred             CEEeccChhHHHHHHHHHHHHHhcCCCCCCCCeEEEecCCCCCCHHHHHHHHhccCCCCcEEEEEECCCccccCCch
Q 015384            1 MIVTGHCLGGSVASLFTLWLLESINRPGTKRPLCITFGAPLIGDKGLQQAISQNLMWNSDFLHVAASQDLDPEAVSE   77 (408)
Q Consensus         1 lv~TGHSLGGAlAsLaal~L~~~~~~~~~~~v~c~TFGsPrVGn~~Fa~~~~~~~~~~~~f~rVVn~~DiVPrlps~   77 (408)
                      |+|||||||||||+|+|+++...........+.|||||+|||||..|+++++..   ...++||||.+|+||++|+.
T Consensus       135 i~vtGHSLGGAlA~L~a~~l~~~~~~~~~~~i~~~tFG~PrvGn~~fa~~~~~~---~~~~~Riv~~~D~Vp~lP~~  208 (265)
T d1lgya_         135 VIVTGHSLGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVEST---GIPFQRTVHKRDIVPHVPPQ  208 (265)
T ss_dssp             EEEEEETHHHHHHHHHHHHHHHHCTTCSTTTEEEEEESCCCCBCHHHHHHHHHH---CCCEEEEEETTBSGGGCSCG
T ss_pred             EEEEecccchHHHHHHHHHHHHhCcccCCCcceEEEecCccccCHHHHHHHhhc---CceEEEEEECCCccCccCCC
Confidence            689999999999999999998874333456789999999999999999999764   34678999999999999974
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure