Citrus Sinensis ID: 015398

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------
MGLVQHEGGPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAKSDLNGGQVSSSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADVAVSSASGGNESSGKETEAAKPEPPQHAPLVDCIRTRWARAVCNWIGDPPSIV
ccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEEEEEcccHHHHHHHHHHHcccHHccccEEHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHEEEEEcEEcccccccccccccccEEEcccccccEEEEEEcccccccccccccccccccEEEEEEcccEEEEEEcccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccHHHccccccccEEEHHHHHHHHHHHHccccccccccccccccEEEEEEEcccccccccccEEEEEccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEcccccccc
ccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHccEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccEEccccEEEccccccccHEHHHHHHHccccccccccccccccEEEEEccccEEEEEccccHHcccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccHHHHHccHHccccEEEEcHHHHHHcccHHcccccccccccccccEEEEEEEcccccccccccEEEEEccccccccccccccEEEccccccHHHHHcccccccccccccccccccccccccccccccHHHHHEcccccEEEEccccccccc
mglvqheggpcGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEglsiesgsdMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRgldyvqadrddptpslvtapfghASQEIVNLLLCgqavpnvfdgrmdlgggmclkGISTSVEVGFLTLLESLnfckvgqhlkcpkwpiwvvgsesHYTVLFALDTSVQDENELEERESHIRKAfdaqdksggggfisvEGFQQVIRdtnirlprekldhlcgsgfIVWSEFWQVILDLDKslgglkdstglmgkkvfdlyhfngiaksdlnggqvsssggdtplqrprltklrvsvpprwtpeefMADVAVssasggnessgketeaakpeppqhaplvdcIRTRWARAVCnwigdppsiv
MGLVQHEGGPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEglsiesgsdmQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAKSDLNGGQVSssggdtplqrprltKLRVSVPPRWTPEEFMADVAVSSASGGNESSGketeaakpeppqhapLVDCIRTRWARAVCNWigdppsiv
MGLVQHEGGPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVIldldkslgglkdsTGLMGKKVFDLYHFNGIAKSDLNGGQVSSSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADVAVSSASGGNESSGKETEAAKPEPPQHAPLVDCIRTRWARAVCNWIGDPPSIV
********GPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADR****PSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDT***************************GGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAK*********************************************************************PLVDCIRTRWARAVCNWIG******
MGLVQ*EGGPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLD****************VFDLYHFNGIAKS********SSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADV**************************APLVDCIRTRWARAVCNWIGDPPS**
********GPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQ**********HIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAKSDLNG**********PLQRPRLTKLRVSVPPRWTPEEFMADVAV***********************HAPLVDCIRTRWARAVCNWIGDPPSIV
MGLVQHEGGPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAKSDLNGGQVSSSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADV*******************KPEPPQHAPLVDCIRTRWARAVCNWIGDPPS**
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLVQHEGGPCGVLAAIQVILQFLILVALVKSMGEILFSCGSNKRAVLAKALEGLSIESGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAKSDLNGGQVSSSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADVAVSSASGGNESSGKETEAAKPEPPQHAPLVDCIRTRWARAVCNWIGDPPSIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query407 2.2.26 [Sep-21-2011]
Q0IIH8445 Protein FAM188A OS=Bos ta yes no 0.808 0.739 0.299 1e-37
Q4R528445 Protein FAM188A OS=Macaca N/A no 0.808 0.739 0.294 9e-37
Q9H8M7445 Protein FAM188A OS=Homo s yes no 0.808 0.739 0.294 9e-37
Q9CV28444 Protein FAM188A OS=Mus mu yes no 0.808 0.740 0.292 1e-35
Q6NX27441 Protein FAM188A OS=Xenopu yes no 0.729 0.673 0.306 3e-34
A0AUR5446 Protein FAM188A OS=Danio yes no 0.808 0.737 0.293 7e-34
Q4G0A6757 Protein FAM188B OS=Homo s no no 0.508 0.273 0.351 1e-30
A1A4L4763 Protein FAM188B OS=Bos ta no no 0.506 0.269 0.375 2e-30
Q5RF72757 Protein FAM188B OS=Pongo yes no 0.508 0.273 0.351 2e-30
Q3UQI9744 Protein FAM188B OS=Mus mu no no 0.508 0.278 0.355 3e-30
>sp|Q0IIH8|F188A_BOVIN Protein FAM188A OS=Bos taurus GN=FAM188A PE=2 SV=1 Back     alignment and function desciption
 Score =  157 bits (397), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 191/404 (47%), Gaps = 75/404 (18%)

Query: 2   GLVQHEGGPCGVLAAIQVILQFLILVA-----------------LVKSMGEILFS--CGS 42
            L Q EGGPC V+A +Q  L   +L +                 L  ++ +IL S  C +
Sbjct: 42  ALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCPEEERKELLCHTLCDILESAGCDN 101

Query: 43  NKRAVLAKALEGLSIE-----SGSDMQKVIRVDAYTSQAT------------------AL 79
           +    L   L G + E     SGS  Q   +V+  ++ A                   +L
Sbjct: 102 SGSYCLVSWLRGKTTEETASLSGSPAQSSCQVEHSSALAVEELGFERFHALIQKRSFRSL 161

Query: 80  QKLEEAL----PVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIV 135
            +L +A+     ++ ++ G +LFL S LL++G++ ++ + +D +  L+   +GH SQ ++
Sbjct: 162 AELRDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDSSEPLIDPVYGHGSQSLI 221

Query: 136 NLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIW 195
           NLLL G AV NV+DG  +   GM L GI     VGFLTL+E+L +CKVG +LK PK+PIW
Sbjct: 222 NLLLTGHAVSNVWDGDREC-SGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW 280

Query: 196 VVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTN 255
           +VGSE+H TV FA D ++       E+   + + +D +D     GFI     + V++  +
Sbjct: 281 IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDN----GFIPDSLLEDVMKALD 336

Query: 256 -------IRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHF 308
                  I L + KLD   G G I+   F Q                G  G + F +YH+
Sbjct: 337 LVSDPEYINLMKNKLDPE-GLGIILLGPFLQEFF----------PDQGSSGPESFTVYHY 385

Query: 309 NGIAKSDLN------GGQVSSSGGDTPLQRPRLTKLRVSVPPRW 346
           NG+ +S+ N       G     G + PL +   T ++  +  +W
Sbjct: 386 NGLKQSNYNEKVMYVEGTAVVMGFEDPLLQTDDTPIKRCLQTKW 429
May have pro-apoptotic function.
Bos taurus (taxid: 9913)
>sp|Q4R528|F188A_MACFA Protein FAM188A OS=Macaca fascicularis GN=FAM188A PE=2 SV=1 Back     alignment and function description
>sp|Q9H8M7|F188A_HUMAN Protein FAM188A OS=Homo sapiens GN=FAM188A PE=1 SV=1 Back     alignment and function description
>sp|Q9CV28|F188A_MOUSE Protein FAM188A OS=Mus musculus GN=Fam188a PE=1 SV=2 Back     alignment and function description
>sp|Q6NX27|F188A_XENTR Protein FAM188A OS=Xenopus tropicalis GN=fam188a PE=2 SV=1 Back     alignment and function description
>sp|A0AUR5|F188A_DANRE Protein FAM188A OS=Danio rerio GN=fam188a PE=2 SV=1 Back     alignment and function description
>sp|Q4G0A6|F188B_HUMAN Protein FAM188B OS=Homo sapiens GN=FAM188B PE=2 SV=2 Back     alignment and function description
>sp|A1A4L4|F188B_BOVIN Protein FAM188B OS=Bos taurus GN=FAM188B PE=2 SV=1 Back     alignment and function description
>sp|Q5RF72|F188B_PONAB Protein FAM188B OS=Pongo abelii GN=FAM188B PE=2 SV=1 Back     alignment and function description
>sp|Q3UQI9|F188B_MOUSE Protein FAM188B OS=Mus musculus GN=Fam188b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query407
224085107 610 predicted protein [Populus trichocarpa] 0.997 0.665 0.733 0.0
255583348 603 protein with unknown function [Ricinus c 0.997 0.673 0.742 0.0
296081168 616 unnamed protein product [Vitis vinifera] 0.997 0.659 0.716 0.0
356535800 609 PREDICTED: protein FAM188A-like isoform 0.997 0.666 0.714 0.0
356535798 612 PREDICTED: protein FAM188A-like isoform 0.997 0.663 0.710 0.0
356576053 612 PREDICTED: protein FAM188A-like [Glycine 0.997 0.663 0.712 0.0
449443752 607 PREDICTED: protein FAM188A-like [Cucumis 0.997 0.668 0.703 1e-180
357443681 666 Protein FAM188A [Medicago truncatula] gi 0.931 0.569 0.766 1e-178
449475579 597 PREDICTED: LOW QUALITY PROTEIN: protein 0.997 0.680 0.703 1e-174
297846770 600 ubiquitin interaction motif-containing p 0.985 0.668 0.639 1e-167
>gi|224085107|ref|XP_002307495.1| predicted protein [Populus trichocarpa] gi|222856944|gb|EEE94491.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/465 (73%), Positives = 368/465 (79%), Gaps = 59/465 (12%)

Query: 1   MGLVQHEGGPCGVLAAIQV-ILQFLILV-------------------------------- 27
           MGLVQHEGGPCGVLA IQ  +L+ L+                                  
Sbjct: 147 MGLVQHEGGPCGVLATIQAFVLKHLLFFPNEIGKVTSNVPQNLGSGGLSKSQYVASDNFS 206

Query: 28  ---------ALVKSMGEILFSCGSNKRAVLAK----------------ALEGLSIESGSD 62
                    ALVKSMGEILF CG NKRAV+A                  LEGL+IES SD
Sbjct: 207 SLTEDAKARALVKSMGEILFMCGDNKRAVIATLNAVGLDTEGFAKNEVTLEGLTIESASD 266

Query: 63  MQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSL 122
           +QK++R+D YTSQ TALQKL  ALPVF+SRMGA+LFLISALLSRGLD +QADRDDP   L
Sbjct: 267 LQKILRIDTYTSQTTALQKLHTALPVFQSRMGALLFLISALLSRGLDSIQADRDDPNLPL 326

Query: 123 VTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCK 182
           VTAPFGHASQEIVNLLLCGQAVPNVFDGRMD GGGM LKGIS SVEVGFLTLLESLNFCK
Sbjct: 327 VTAPFGHASQEIVNLLLCGQAVPNVFDGRMDFGGGMFLKGISMSVEVGFLTLLESLNFCK 386

Query: 183 VGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFI 242
           VGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERES IR+AFDAQD+SGGGGFI
Sbjct: 387 VGQHLKCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESQIRRAFDAQDQSGGGGFI 446

Query: 243 SVEGFQQVIRDTNIRLPREKLDHLCGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKV 302
           SVEGF QV+R+  IRLP EKLDHLC +GFIVWSEFWQVILDLDKSLGGLKDS+GLMGKKV
Sbjct: 447 SVEGFHQVLREVGIRLPSEKLDHLCSTGFIVWSEFWQVILDLDKSLGGLKDSSGLMGKKV 506

Query: 303 FDLYHFNGIAKSDLNGGQVSSSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADVAVSSASG 362
           FDL HFNGIAKSD+NG   ++SGG+T +QRPRLTKLRVSVPPRWTPEEFMADV V+S  G
Sbjct: 507 FDLCHFNGIAKSDINGSH-ATSGGETLVQRPRLTKLRVSVPPRWTPEEFMADVVVTSGPG 565

Query: 363 GNESSGKETEAAKPEPPQHAPLVDCIRTRWARAVCNWIGDPPSIV 407
           G ESSGK+TE  KPEP QHAPLVDCIRTRW+RAVCNW+GDPPSIV
Sbjct: 566 GKESSGKDTEVTKPEPSQHAPLVDCIRTRWSRAVCNWVGDPPSIV 610

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255583348|ref|XP_002532435.1| protein with unknown function [Ricinus communis] gi|223527855|gb|EEF29950.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|296081168|emb|CBI18194.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356535800|ref|XP_003536431.1| PREDICTED: protein FAM188A-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356535798|ref|XP_003536430.1| PREDICTED: protein FAM188A-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356576053|ref|XP_003556149.1| PREDICTED: protein FAM188A-like [Glycine max] Back     alignment and taxonomy information
>gi|449443752|ref|XP_004139641.1| PREDICTED: protein FAM188A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357443681|ref|XP_003592118.1| Protein FAM188A [Medicago truncatula] gi|355481166|gb|AES62369.1| Protein FAM188A [Medicago truncatula] Back     alignment and taxonomy information
>gi|449475579|ref|XP_004154494.1| PREDICTED: LOW QUALITY PROTEIN: protein FAM188A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297846770|ref|XP_002891266.1| ubiquitin interaction motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297337108|gb|EFH67525.1| ubiquitin interaction motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query407
TAIR|locus:2031113599 AT1G43690 "AT1G43690" [Arabido 0.918 0.624 0.680 4.1e-147
UNIPROTKB|Q0IIH8445 FAM188A "Protein FAM188A" [Bos 0.685 0.626 0.318 6.9e-42
UNIPROTKB|F1RW87445 FAM188A "Uncharacterized prote 0.614 0.561 0.333 1.8e-41
UNIPROTKB|Q9H8M7445 FAM188A "Protein FAM188A" [Hom 0.614 0.561 0.333 3.7e-41
MGI|MGI:1914210444 Fam188a "family with sequence 0.614 0.563 0.329 7.5e-41
RGD|1309605444 Fam188a "family with sequence 0.614 0.563 0.329 7.5e-41
UNIPROTKB|E1BU55445 FAM188A "Uncharacterized prote 0.614 0.561 0.333 5.1e-40
ZFIN|ZDB-GENE-061110-13446 fam188a "family with sequence 0.685 0.625 0.295 1.6e-37
UNIPROTKB|F1P6N8272 FAM188A "Uncharacterized prote 0.518 0.775 0.363 2.4e-35
FB|FBgn0030973560 CG7332 [Drosophila melanogaste 0.388 0.282 0.355 2.9e-35
TAIR|locus:2031113 AT1G43690 "AT1G43690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1360 (483.8 bits), Expect = 4.1e-147, Sum P(2) = 4.1e-147
 Identities = 270/397 (68%), Positives = 312/397 (78%)

Query:    28 ALVKSMGEILFSCGSNKRAVLA--------------KALEG-LSIESGSDMQKVIRVDAY 72
             ALV+SM EILF CG N RAV+A              +A+ G L IES SD+QK++R + +
Sbjct:   209 ALVRSMCEILFMCGDNNRAVIASFTNFEDSSSNQKDEAMAGGLPIESASDLQKILRFETF 268

Query:    73 TSQATALQKLEEALPVFRSRMGAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQ 132
             T+QA+A  KLE  +  F+SRMGA+LFLISALLSRGLD VQADRDDP   LVTAPFGHASQ
Sbjct:   269 TTQASAQNKLEGTITAFQSRMGALLFLISALLSRGLDSVQADRDDPNLPLVTAPFGHASQ 328

Query:   133 EIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKW 192
             EIVNLLLCG+AVPNVFDGRMDLGGGM LKGIS +V+VGFLTLLESLNFCKVGQ+LKCPKW
Sbjct:   329 EIVNLLLCGEAVPNVFDGRMDLGGGMFLKGISKNVDVGFLTLLESLNFCKVGQNLKCPKW 388

Query:   193 PIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIR 252
             PIWV+GSESHYTVLFALD SVQ+ENELE RES IR+AFDA+D+SGGGGFI+VE F QV +
Sbjct:   389 PIWVIGSESHYTVLFALDPSVQEENELELRESQIRRAFDARDQSGGGGFITVEAFHQVAQ 448

Query:   253 DTNIRLPREKLDHLCGSGFIVWSEFWQVIXXXXXXXXXXXXXTGLMGKKVFDLYHFNGIA 312
             +TNIRLP +KLD +C +GFIVWSE WQVI             TGLMGKKVFD+YHFNGIA
Sbjct:   449 ETNIRLPIKKLDDICATGFIVWSELWQVILELDQNLGGIKDATGLMGKKVFDIYHFNGIA 508

Query:   313 KSDLNGG--QVSSSGGDTPLQRPRLTKLRVSVPPRWTPEEFMADVAVSSASGGNESSGKE 370
             KSD+NGG   ++  GG  P+QRPRLTKL VSVPP+WTPEE+M      S      SS K+
Sbjct:   509 KSDINGGGQAMAVEGGMVPMQRPRLTKLNVSVPPKWTPEEYMTCALPPS------SSEKD 562

Query:   371 TEAAKPEPPQHAPLVDCIRTRWARAVCNWIGDPPSIV 407
             +E  +P+P QHAPLVDCIRTRW+RA C+W GDPPSIV
Sbjct:   563 SEVNQPKPVQHAPLVDCIRTRWSRAACSWSGDPPSIV 599
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
UNIPROTKB|Q0IIH8 FAM188A "Protein FAM188A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RW87 FAM188A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8M7 FAM188A "Protein FAM188A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914210 Fam188a "family with sequence similarity 188, member A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309605 Fam188a "family with sequence similarity 188, member A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU55 FAM188A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061110-13 fam188a "family with sequence similarity 188, member A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6N8 FAM188A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0030973 CG7332 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.V.288.1
hypothetical protein (610 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query407
pfam13898341 pfam13898, DUF4205, Domain of unknown function (DU 2e-58
>gnl|CDD|222441 pfam13898, DUF4205, Domain of unknown function (DUF4205) Back     alignment and domain information 
 Score =  193 bits (492), Expect = 2e-58
 Identities = 94/249 (37%), Positives = 138/249 (55%), Gaps = 29/249 (11%)

Query: 2   GLVQHEGGPCGVLAAIQV-ILQFLIL---------------------VALVKSMGEILFS 39
           GLVQ++GGPCGVLAA+Q  IL++L+                       ALV ++ +IL+ 
Sbjct: 33  GLVQNKGGPCGVLAAVQAYILKYLLFGRAPRDCNSGSMLQPSSAERQRALVAALADILWR 92

Query: 40  CGSNKRAVLAKALEGLSIESGSD--MQKVI-RVDAYT--SQATALQKLEEALPVFRSR-M 93
            G  KRA +A                  +  ++  +T          L E L  F +   
Sbjct: 93  AGEAKRATVALPCGRSQFSPAGRYKQDNLTEKLMLFTFTKLEELQAFLYEHLSQFETGGH 152

Query: 94  GAMLFLISALLSRGLDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMD 153
           G +LFL SA+LSRG++ +++D D PT  L+    G+ +QE+VNLLL G+AV NVF+G  +
Sbjct: 153 GCILFLYSAILSRGVERIRSDLDVPTGQLI-GAHGYCTQELVNLLLTGRAVSNVFNGVDE 211

Query: 154 LGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHLKCPKWPIWVVGSESHYTVLFALDTSV 213
               + L+GI T  E+GFL+L E    C+VG +LK P++PIWVV SESHY+VLF L+  +
Sbjct: 212 GNDNLTLRGILTRSEIGFLSLFEHYQSCQVGSYLKTPRFPIWVVCSESHYSVLFCLNPEL 271

Query: 214 QDENELEER 222
             + ++E R
Sbjct: 272 LSDWKMERR 280

The proteins in this family are uncharacterized but often named FAM188B. Length = 341

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 407
KOG2871449 consensus Uncharacterized conserved protein [Funct 100.0
PF13898342 DUF4205: Domain of unknown function (DUF4205) 100.0
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.07
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.86
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.84
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.72
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.69
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.68
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.66
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.54
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.49
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.46
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.39
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.26
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.22
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.22
cd0005267 EH Eps15 homology domain; found in proteins implic 98.2
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.19
PTZ00183158 centrin; Provisional 98.12
PTZ00184149 calmodulin; Provisional 98.1
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.04
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.0
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 97.98
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.88
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.87
PTZ00183158 centrin; Provisional 97.87
PF1465866 EF-hand_9: EF-hand domain 97.85
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.84
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.82
PTZ00184149 calmodulin; Provisional 97.75
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.75
PLN02964 644 phosphatidylserine decarboxylase 97.61
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 97.59
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.56
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 97.53
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 97.17
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.05
KOG0036 463 consensus Predicted mitochondrial carrier protein 95.97
PLN02964 644 phosphatidylserine decarboxylase 95.9
KOG0038189 consensus Ca2+-binding kinase interacting protein 95.87
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 95.64
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.63
KOG0377631 consensus Protein serine/threonine phosphatase RDG 95.53
KOG0036 463 consensus Predicted mitochondrial carrier protein 95.39
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 95.26
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 94.98
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 94.45
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 94.36
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 94.26
PRK12309391 transaldolase/EF-hand domain-containing protein; P 93.95
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 93.57
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 93.25
KOG4065144 consensus Uncharacterized conserved protein [Funct 93.11
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 92.7
KOG4251362 consensus Calcium binding protein [General functio 92.06
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 90.89
KOG0038189 consensus Ca2+-binding kinase interacting protein 89.9
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 89.17
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 87.65
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 86.9
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 85.17
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 83.72
>KOG2871 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=8.1e-95  Score=716.84  Aligned_cols=351  Identities=39%  Similarity=0.620  Sum_probs=312.4

Q ss_pred             ceeccCCCchhhHHHHHHH-HHHHH----------------HHHHHHHHHHHHHh--ccCCCceEEE-ee----------
Q 015398            2 GLVQHEGGPCGVLAAIQVI-LQFLI----------------LVALVKSMGEILFS--CGSNKRAVLA-KA----------   51 (407)
Q Consensus         2 gLvQ~~GGPCgVlA~VQA~-LK~lL----------------~~~L~~Ala~IL~~--a~~~~~~~v~-l~----------   51 (407)
                      ||+|++||||||+|+|||| ||+++                ++.|..++|||+-.  |...+.+++. +.          
T Consensus        37 ~lvq~eggpcavia~vqafllk~ilm~~e~~~~s~~~g~~~~el~~h~lsd~~~s~~~~~~~~~~Lv~lL~g~tte~~AS  116 (449)
T KOG2871|consen   37 ALVQPEGGPCAVIAPVQAFLLKAILMRAEWLQTSFCSGAPKEELLYHLLSDILASRLCSVVQGYVLVYLLRGRTTEEVAS  116 (449)
T ss_pred             cccccCCCceeeehhHHHHHHHHHhcCccccccccccCchHHHHHHHhhhhHhHhhhhhhccceEEEEeeccCchhhhhh
Confidence            7999999999999999999 99999                78899999999998  4434344333 20          


Q ss_pred             ------------cC-----Ccccc-------ccccceeEEEEcccCCHHHHHHHHHHhchhhcCCchhHHHHHHHHHhcc
Q 015398           52 ------------LE-----GLSIE-------SGSDMQKVIRVDAYTSQATALQKLEEALPVFRSRMGAMLFLISALLSRG  107 (407)
Q Consensus        52 ------------~~-----~~~~~-------~~~~~~e~l~~~~~~s~~~l~~~l~~~i~~f~~~~GvllFLySvILSRG  107 (407)
                                  .|     .+.+.       +++.||++++...|++...+.+.+...+..|++.+||+|||||++||||
T Consensus       117 lt~~~~~SS~q~eeA~~s~~L~ie~~~~~~ls~~~~~~~l~~~~f~~~a~~~~~~~~~~~~~~~t~GvLLFLySalLTrg  196 (449)
T KOG2871|consen  117 LTGPLAASSDQVEEALFSAALEIERTISDKLSVTMFHPSLDEVFFDHSACYFHDSVTEYFTEEETPGVLLFLYSALLTRG  196 (449)
T ss_pred             ccCccccchHHHHHHHHhcchhhhhhhhcccCHHHHhHhhhheeccchHHHHHHHHHHHHhhhcccchHHHHHHHHHhhh
Confidence                        00     11122       3467888999999999999999999999999999999999999999999


Q ss_pred             hhHHhhcCCCCCCCcccCCCCcchHHhhhhhhcCcccccccCCceecCCceeeeccccCcceeeeeecccCCccccccCC
Q 015398          108 LDYVQADRDDPTPSLVTAPFGHASQEIVNLLLCGQAVPNVFDGRMDLGGGMCLKGISTSVEVGFLTLLESLNFCKVGQHL  187 (407)
Q Consensus       108 ie~V~~dmd~p~~~Li~~~~G~csQeLVNLLLTGrAvsnVfdg~~~~gg~~~l~Gi~~rs~iGfLt~~E~~~~~~VGs~l  187 (407)
                      +++||+|+||++.|||+++|||+||+|||||||||||||||||++|+|| |+|+||+++++|||||++|.+|||+||+++
T Consensus       197 le~V~aDiddas~plits~~g~gsq~iVnLLLtGrAvpnV~dg~~dvgg-m~l~gI~e~~dvgfltlle~l~~ckvgs~l  275 (449)
T KOG2871|consen  197 LEKVRADIDDASEPLITSSYGHGSQSIVNLLLTGRAVPNVWDGVVDVGG-MKLYGIPEQGDVGFLTLLELLRYCKVGSAL  275 (449)
T ss_pred             HHHhhhccccCCCCcccCCCCcchHHHHHHHHccccccccccCccccCc-ceeeccccccchhHHHHHHHHHHHHHHHhh
Confidence            9999999999999999999999999999999999999999999999998 999999999999999999999999999999


Q ss_pred             CCCCCceEEEeeCCceEEEEecCcCccccchHHHHHHHHHHHHHhcCCCCCCcceehhhHHHHHHHhc-CCCCHHHHhcc
Q 015398          188 KCPKWPIWVVGSESHYTVLFALDTSVQDENELEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTN-IRLPREKLDHL  266 (407)
Q Consensus       188 K~P~~PIWv~~s~~hysVLF~~~~~l~~~~~~~~~~~e~rraFd~fD~~~gnGfIs~~~L~~vL~~Lg-l~l~~eel~~m  266 (407)
                      |+|++||||++|++||||||++|+.++.+..   .++++||+|+.+|++ |||||+++.|++||.++| ....++++..|
T Consensus       276 k~pr~Piwv~gSeth~tvlfs~d~~l~~~~~---~s~q~rR~f~a~d~~-d~nfis~s~~~~vm~~~N~~vse~a~v~l~  351 (449)
T KOG2871|consen  276 KQPRQPIWVLGSETHLTVLFSCDGHLVVPEN---PSEQLRRNFHAYDPE-DNNFISCSGLQIVMTALNRLVSEPAYVMLM  351 (449)
T ss_pred             cCCCCceeEecCCCceEEEEecCccccCCCC---CCHHHHhhhhccCcc-CCCeeecHHHHHHHHHhcccccCHHHHHHh
Confidence            9999999999999999999999999998832   247899999999999 799999999999999999 56778889888


Q ss_pred             ------cCCCceehHHHHHHHhhhccccCCCCCccccCccceeEEEeeCCcccccCCCCeeeccCCCccccccccccccc
Q 015398          267 ------CGSGFIVWSEFWQVILDLDKSLGGLKDSTGLMGKKVFDLYHFNGIAKSDLNGGQVSSSGGDTPLQRPRLTKLRV  340 (407)
Q Consensus       267 ------dg~GiIl~~eF~~~~l~~e~s~~~~~~~~~~~~~~~F~lyhYNG~~~s~~~~~~~~~~g~~~~~~~~~~~~~~v  340 (407)
                            ++.|||+.++|+.+|||.+-+          ++|++|++|||||+.+||.|||+||++||++..          
T Consensus       352 ~~~l~pE~~~iil~~d~lg~~~p~tgs----------~g~~~f~~~h~nGi~gsn~ggka~~veGg~~l~----------  411 (449)
T KOG2871|consen  352 RQPLDPESLGIILLEDFLGEFFPTTGS----------SGPGAFAGYHYNGISGSNVGGKAMYVEGGAALP----------  411 (449)
T ss_pred             cCccChhhcceEEeccccccccCcccc----------CCCcceeeeeccCccCCCCCCceEEeecccccC----------
Confidence                  899999999999999998875          589999999999999999999999999988554          


Q ss_pred             cCCCCCChhhhhhhhhcccCCCCCCCCCCcccCCCCCCCCCChhhhhhhhcCCceEeeecCC-CCCCC
Q 015398          341 SVPPRWTPEEFMADVAVSSASGGNESSGKETEAAKPEPPQHAPLVDCIRTRWARAVCNWIGD-PPSIV  407 (407)
Q Consensus       341 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~~cl~tkW~~~~~~W~~~-~Psi~  407 (407)
                         + .                          +.+.+-+..+||++|||||||+|+|+|+.+ .|||+
T Consensus       412 ---~-~--------------------------~~k~~st~NtPlvrcirTKW~~a~iswh~g~~psL~  449 (449)
T KOG2871|consen  412 ---D-V--------------------------VAKEESTLNTPLVRCIRTKWPEAEISWHVGMLPSLN  449 (449)
T ss_pred             ---C-c--------------------------cchhhhcccchHHHHHhccCCceeEEeecCCCccCC
Confidence               1 1                          012223566799999999999999999955 79985

>PF13898 DUF4205: Domain of unknown function (DUF4205) Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query407
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-04
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 4e-04
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
 Score = 46.7 bits (111), Expect = 6e-07
 Identities = 13/65 (20%), Positives = 22/65 (33%), Gaps = 7/65 (10%)

Query: 219 LEERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLC------GSGFI 272
           +      I + F+  D       IS E F+ +       L  E+ D L         G +
Sbjct: 19  VTSHYHAITQEFENFDTMKTN-TISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRL 77

Query: 273 VWSEF 277
            + +F
Sbjct: 78  KYPDF 82
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query407
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.14
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.05
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.95
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.95
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.91
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.9
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.87
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.87
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.87
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.87
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.86
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.86
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.86
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.85
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.85
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.83
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.83
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.82
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.82
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.81
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.8
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.8
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.8
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.79
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.78
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.77
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.77
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.77
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.76
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.75
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.74
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.73
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.72
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.72
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.71
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.7
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.7
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.7
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.7
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.69
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.69
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.69
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.69
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.68
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.67
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.67
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.66
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.66
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.66
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.66
1c07_A95 Protein (epidermal growth factor receptor pathway 98.66
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.66
3fwb_A161 Cell division control protein 31; gene gating, com 98.65
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.64
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.64
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.63
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.63
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.62
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.62
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.62
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.61
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.61
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.61
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.61
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.61
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.61
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.61
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.6
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.6
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.59
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.58
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.58
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.58
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.58
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.58
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.57
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.57
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.57
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.57
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.57
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.56
3li6_A66 Calcium-binding protein; calcium signaling protein 98.55
1y1x_A191 Leishmania major homolog of programmed cell death 98.55
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.55
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.55
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.55
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.55
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.55
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.54
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.54
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.54
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.54
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.53
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.53
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.53
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.52
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.52
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.51
3fwb_A161 Cell division control protein 31; gene gating, com 98.5
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.5
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.5
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.49
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.49
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.49
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.47
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.47
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.47
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.47
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.46
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.45
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.45
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.44
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.43
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.43
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.43
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.42
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.42
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.42
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.42
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.42
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.41
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.4
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.4
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.4
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.4
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.4
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.39
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.39
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.38
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.38
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.38
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.37
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.37
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.37
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.37
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.36
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.34
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.34
1y1x_A191 Leishmania major homolog of programmed cell death 98.34
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.33
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.33
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.33
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.32
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.32
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.32
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.3
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.3
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.29
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.29
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.29
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.28
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.27
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.27
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.27
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.26
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.24
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.23
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.23
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.23
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.22
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.22
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.21
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.2
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.19
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.18
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.16
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.14
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.14
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.14
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.12
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.12
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.12
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.11
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.1
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.09
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.08
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.08
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.07
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.06
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.06
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.04
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.02
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.01
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.01
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.01
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.0
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.0
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 97.99
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 97.99
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.98
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.98
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 97.97
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 97.97
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 97.96
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.95
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.94
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 97.93
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.93
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.93
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.91
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 97.91
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.89
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.87
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.87
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 97.87
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.86
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.83
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 97.82
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 97.81
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 97.81
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.81
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 97.8
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 97.78
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.78
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.77
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 97.76
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.74
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 97.73
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 97.7
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.68
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 97.67
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.67
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.66
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 97.65
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 97.65
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 97.65
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.64
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 97.6
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 97.58
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 97.55
2hps_A186 Coelenterazine-binding protein with bound coelent; 97.55
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 97.55
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.35
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.31
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.31
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.27
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.27
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 96.88
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.74
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.58
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.44
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 95.36
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 95.35
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 95.27
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.19
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 95.1
3a4u_B143 Multiple coagulation factor deficiency protein 2; 94.61
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 94.58
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 94.54
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 94.38
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 94.3
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 94.25
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 94.2
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 94.09
1nub_A229 Basement membrane protein BM-40; extracellular mod 93.51
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 93.5
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 92.28
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 90.74
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 89.96
3li6_A66 Calcium-binding protein; calcium signaling protein 88.15
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 81.42
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.14  E-value=2.7e-11  Score=99.82  Aligned_cols=60  Identities=27%  Similarity=0.434  Sum_probs=55.6

Q ss_pred             HHHHHHHHHhcCCCCCCcceehhhHHHHHHHhcCCCCHHHHhcc------cCCCceehHHHHHHHhh
Q 015398          223 ESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHL------CGSGFIVWSEFWQVILD  283 (407)
Q Consensus       223 ~~e~rraFd~fD~~~gnGfIs~~~L~~vL~~Lgl~l~~eel~~m------dg~GiIl~~eF~~~~l~  283 (407)
                      .++++++|+.||++ ++|+|+.++|+.+|+.+|..+++++++.|      +++|.|+|+||+++|.|
T Consensus        35 ~~el~~~F~~~D~d-~~G~I~~~El~~~l~~lg~~~~~~ei~~l~~~~D~d~dG~I~~~EF~~~m~P  100 (100)
T 2lv7_A           35 LEEIREAFKVFDRD-GNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGP  100 (100)
T ss_dssp             HHHHHHHHHHTCSS-CSSCBCHHHHHHHHHHHTCCCCTTTHHHHHHHHCSSCSSSBCHHHHHHHTCC
T ss_pred             HHHHHHHHHHHcCC-CCCcCCHHHHHHHHHHhCCCCCHHHHHHHHHHHCCCCCCeEeHHHHHHHhCc
Confidence            46899999999999 79999999999999999999999999887      89999999999998754
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 407
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 2e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 6e-05
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-04
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 3e-04
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 6e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.002
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 0.002
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 0.002
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.003
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 0.003
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Human (Homo sapiens), cardiac isoform [TaxId: 9606]

 Score = 43.0 bits (101), Expect = 2e-06
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 7/72 (9%)

Query: 217 NEL-EERESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHLC------GS 269
            +L EE+++  + AFD        G IS +   +V+R        E+L  +       GS
Sbjct: 7   EQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGS 66

Query: 270 GFIVWSEFWQVI 281
           G + + EF  ++
Sbjct: 67  GTVDFDEFLVMM 78
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query407
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.18
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.16
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.1
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.1
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.1
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.09
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.07
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.07
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.05
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.05
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.04
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.94
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.92
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.9
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.9
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.89
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.86
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.85
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.85
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.85
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.78
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.77
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.77
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.77
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.74
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.74
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.71
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.71
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.7
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.69
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.66
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.66
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.64
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.62
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.62
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.62
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.61
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.59
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.58
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.57
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.55
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.55
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.54
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.53
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.53
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.51
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.5
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.48
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.45
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.44
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.44
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.4
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.39
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.38
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.37
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.35
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.35
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.33
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.3
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.28
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.27
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.25
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.24
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.21
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.21
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.16
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.14
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.13
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.12
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.11
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.1
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.03
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.0
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 97.92
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 97.92
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.91
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.9
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.85
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.83
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.82
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.79
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.72
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.67
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.66
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 97.65
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.63
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.52
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.48
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.43
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.36
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.33
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.29
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.24
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.23
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.18
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.18
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.18
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.16
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.11
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.0
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 96.93
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 96.92
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 96.77
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 96.75
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.41
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.9
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 95.46
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 94.85
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 94.01
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 92.91
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 88.79
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 85.17
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 84.34
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 80.52
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Troponin C
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.18  E-value=1.5e-11  Score=94.85  Aligned_cols=59  Identities=27%  Similarity=0.522  Sum_probs=55.3

Q ss_pred             HHHHHHHHHhcCCCCCCcceehhhHHHHHHHhcCCCCHHHHhcc------cCCCceehHHHHHHHh
Q 015398          223 ESHIRKAFDAQDKSGGGGFISVEGFQQVIRDTNIRLPREKLDHL------CGSGFIVWSEFWQVIL  282 (407)
Q Consensus       223 ~~e~rraFd~fD~~~gnGfIs~~~L~~vL~~Lgl~l~~eel~~m------dg~GiIl~~eF~~~~l  282 (407)
                      +++++++|+.||.+ ++|||+.++|+.+|+.||..+++++++.|      +++|.|+|+||+++|-
T Consensus         8 eeel~~~F~~fD~~-~~G~I~~~el~~~l~~lg~~~~~~e~~~~~~~~D~d~dg~I~~~EF~~~m~   72 (75)
T d1jc2a_           8 EEELANCFRIFDKN-ADGFIDIEELGEILRATGEHVIEEDIEDLMKDSDKNNDGRIDFDEFLKMME   72 (75)
T ss_dssp             HHHHHHHHHHHCCS-TTSSEEHHHHHHHHHHSSSCCCHHHHHHHHHHHCSSSCSEECHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCC-CcCeEcHHHHHHHHHhcCCCccHHHHHHHHHHhCCCCCCcEeHHHHHHHHH
Confidence            36899999999999 79999999999999999999999999988      7899999999998874
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure