Citrus Sinensis ID: 015475

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAILAARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAGERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEAL
ccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHcccccccccccccccEEEEEEEcccccEEcccccccccccEEEEEEEccccccHHHHHHHHHcccccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHcccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHcccccccEEEEEEccccEEEccccc
cccccccccEEEEEEHHHHHHccccccccccccccccccccEEEEcccccccccccccEEEEHHHHHHHHHHHcccccccccccHHHcEEEEEEEcccccEEccEEEEEEccccEEEEEEccccHHHHHHHHHHcccHHHHHHccccccccHcHEEEEcccccHHcccHHHcEEcccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHccccccccccccccccccccccEccccccccccccccccccccHHHHHcccHHccccHHHEEEEEEccccccccccccccccccccccEEEEccccccEEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHcccccccEEEEcccccEEEEccccc
mgkkqhskdrMFITKTEWatewggakskevrtpfkrlpfyccaltftpfedpvctadgsvfELMSITPyirkygkhpvtgtplkledlipltfhknaegeyhcpvlNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNwkelltdepftkedlitiqnpnaldtkvtlefdhvkkglkvddeelrkmesdptyninVAGDIKQMLQELGtekgqetallggggsKAQKERAAALAAILAARSRIeensksdangeakatKAFSIVDAAsasvhgrsasaaktasSDKTAARIAMHMAGERTPVNAKLVKsryttgaasrsftstaydpvttneFEYIKVeknpkkkgyvQLHTthgdlnielhcditprsCENFITLCERGYYNGVAFHRSIRKRWRIYMGEAL
mgkkqhskdrmfitktewatewggakskeVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKElniktknwkELLTDEPFTKEDLITiqnpnaldtkvtlefdhvkkglkvddeelrkmesdptyninvAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAILAARSrieensksdangeaKATKAFSIVDAASasvhgrsasaaktassdKTAARIAMhmagertpvnaKLVKSRyttgaasrsftstaydpvttNEFEYIKVeknpkkkgYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEAL
MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGskaqkeraaalaailaarsrieeNSKSDANGEAKATKAFSIVDAASASVHGRsasaaktassdktaaRIAMHMAGERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEAL
**********MFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGL***************YNINVAGD***************************************************************************************************************Y********FTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYM****
******S***MFITKTEWATE****************PFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKG********************************************************************************************************************************AKLVKSRYTTGAAS************************PKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEA*
**********MFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETAL***************LAAILAARSR**************ATKAFSIVDAAS*******************AARIAMHMAGERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEAL
*******KDRMFITKTEWATEWGG******RTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQET*****************************************************************TASSDKTAARIAMHMAGERTPVNAKLVKSRYTTGAA********YDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGE*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAILAARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAGERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query406 2.2.26 [Sep-21-2011]
Q9FJX0 595 Peptidyl-prolyl cis-trans yes no 0.960 0.655 0.805 0.0
Q9D787 521 Peptidyl-prolyl cis-trans yes no 0.788 0.614 0.418 2e-79
Q13356 520 Peptidyl-prolyl cis-trans yes no 0.798 0.623 0.410 2e-78
Q5AXT6 580 Peptidyl-prolyl cis-trans yes no 0.837 0.586 0.393 2e-72
Q4WVU5 579 Peptidyl-prolyl cis-trans yes no 0.844 0.592 0.374 3e-66
Q2U5W8 570 Peptidyl-prolyl cis-trans yes no 0.741 0.528 0.363 9e-59
P0C1J1 533 Peptidyl-prolyl cis-trans N/A no 0.625 0.476 0.428 2e-56
P0CP90 573 Peptidyl-prolyl cis-trans yes no 0.810 0.574 0.342 9e-54
P0CP91 573 Peptidyl-prolyl cis-trans N/A no 0.810 0.574 0.342 9e-54
Q4IBK5 588 Peptidyl-prolyl cis-trans yes no 0.825 0.569 0.330 2e-51
>sp|Q9FJX0|PPIL2_ARATH Peptidyl-prolyl cis-trans isomerase-like 2 OS=Arabidopsis thaliana GN=PUB49 PE=2 SV=1 Back     alignment and function desciption
 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/395 (80%), Positives = 355/395 (89%), Gaps = 5/395 (1%)

Query: 1   MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSV 60
           MGKKQHSKDRMFITKTEWATEWGGAKSKE RTPFK LP+YCCALTF PFEDPVCT DGSV
Sbjct: 1   MGKKQHSKDRMFITKTEWATEWGGAKSKENRTPFKSLPYYCCALTFLPFEDPVCTIDGSV 60

Query: 61  FELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVK 120
           FE+ +I PYIRK+GKHPVTG PLK EDLIPL FHKN+EGEYHCPVLNKVFTEFTHIVAVK
Sbjct: 61  FEITTIVPYIRKFGKHPVTGAPLKGEDLIPLIFHKNSEGEYHCPVLNKVFTEFTHIVAVK 120

Query: 121 TTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLK 180
           TTGNVFC+EAIKELNIKTKNWKELLT+EPFT+ DLITIQNPNA+D KVT+EFDHVK GLK
Sbjct: 121 TTGNVFCYEAIKELNIKTKNWKELLTEEPFTRADLITIQNPNAVDGKVTVEFDHVKNGLK 180

Query: 181 VDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAIL 240
           +DDEEL+KM SDP YNINV+GDIK ML +LGT+K +E AL GGGG+KA+ ERAAA+AAIL
Sbjct: 181 IDDEELKKMNSDPAYNINVSGDIKHMLADLGTDKAKEIALHGGGGNKARNERAAAIAAIL 240

Query: 241 AARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAG 300
            +RS+I+E SK++     +  + +S+VDAASASV GRSA AAK  SSDKTAARIAMHMAG
Sbjct: 241 ESRSKIKEVSKAE-----QPKQTYSVVDAASASVFGRSADAAKAGSSDKTAARIAMHMAG 295

Query: 301 ERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDL 360
           +RTPVN+K+VKSRY++GAASRSFTS+A+ PVT N+FE IKVEKNPKKKGYVQ  TTHGDL
Sbjct: 296 DRTPVNSKMVKSRYSSGAASRSFTSSAFTPVTKNDFELIKVEKNPKKKGYVQFQTTHGDL 355

Query: 361 NIELHCDITPRSCENFITLCERGYYNGVAFHRSIR 395
           NIELHCDI PR+CENFITLCERGYYNGVAFHRSIR
Sbjct: 356 NIELHCDIAPRACENFITLCERGYYNGVAFHRSIR 390
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9D787|PPIL2_MOUSE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Mus musculus GN=Ppil2 PE=2 SV=2 Back     alignment and function description
>sp|Q13356|PPIL2_HUMAN Peptidyl-prolyl cis-trans isomerase-like 2 OS=Homo sapiens GN=PPIL2 PE=1 SV=1 Back     alignment and function description
>sp|Q5AXT6|PPIL2_EMENI Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp8 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVU5|PPIL2_ASPFU Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp8 PE=3 SV=2 Back     alignment and function description
>sp|Q2U5W8|PPIL2_ASPOR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp8 PE=3 SV=1 Back     alignment and function description
>sp|P0C1J1|PPIL2_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 Back     alignment and function description
>sp|P0CP90|PPIL2_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 Back     alignment and function description
>sp|P0CP91|PPIL2_CRYNB Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 Back     alignment and function description
>sp|Q4IBK5|PPIL2_GIBZE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
255568603 599 cyclophilin-10, putative [Ricinus commun 0.972 0.659 0.870 0.0
356496987 597 PREDICTED: peptidyl-prolyl cis-trans iso 0.972 0.661 0.865 0.0
356541623 597 PREDICTED: peptidyl-prolyl cis-trans iso 0.972 0.661 0.863 0.0
449525478 592 PREDICTED: peptidyl-prolyl cis-trans iso 0.972 0.667 0.855 0.0
147772861 621 hypothetical protein VITISV_001969 [Viti 0.972 0.636 0.843 0.0
297797629 595 peptidyl-prolyl cis-trans isomerase cycl 0.960 0.655 0.807 0.0
359480543 597 PREDICTED: peptidyl-prolyl cis-trans iso 0.972 0.661 0.843 0.0
15240768 595 Peptidyl-prolyl cis-trans isomerase-like 0.960 0.655 0.805 0.0
17064880 595 peptidylprolyl isomerase (cyclophilin)-l 0.960 0.655 0.802 0.0
357113547 590 PREDICTED: peptidyl-prolyl cis-trans iso 0.963 0.662 0.787 0.0
>gi|255568603|ref|XP_002525275.1| cyclophilin-10, putative [Ricinus communis] gi|223535433|gb|EEF37103.1| cyclophilin-10, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/395 (87%), Positives = 374/395 (94%)

Query: 1   MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSV 60
           MGKKQHSKDRM+ITKTEWATEWGGAKSKEV TPFKRLPFYCCALTFTP+E PVCTADGSV
Sbjct: 1   MGKKQHSKDRMYITKTEWATEWGGAKSKEVHTPFKRLPFYCCALTFTPYESPVCTADGSV 60

Query: 61  FELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVK 120
           FE+M ITPYIRKYGKHPVTG PLK EDLIPL FHKN+EGEYHCPVLNKVFTEFTHIVAVK
Sbjct: 61  FEIMHITPYIRKYGKHPVTGAPLKQEDLIPLNFHKNSEGEYHCPVLNKVFTEFTHIVAVK 120

Query: 121 TTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLK 180
           TTGNVFC+EAIKELNIKTKNW+ELLTDEPF+KEDLITIQNPNALDT+VTL+FDHVK+GLK
Sbjct: 121 TTGNVFCYEAIKELNIKTKNWRELLTDEPFSKEDLITIQNPNALDTRVTLDFDHVKQGLK 180

Query: 181 VDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAIL 240
           VDDEEL+ M SDP YNIN++GDIKQML+ELGTEKG++TAL GGGGSKAQ ERAAAL AIL
Sbjct: 181 VDDEELKHMSSDPAYNINISGDIKQMLEELGTEKGRQTALHGGGGSKAQNERAAALEAIL 240

Query: 241 AARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAG 300
           AARSRI+E+SKSD+NG +K  + +SIVDAASA+VHGRSA+AAK  S DKTAARIAMHMAG
Sbjct: 241 AARSRIKEDSKSDSNGNSKPPQTYSIVDAASAAVHGRSAAAAKATSGDKTAARIAMHMAG 300

Query: 301 ERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDL 360
           ER PVNAKLV+SRYTTGAASRSFTST++DPVT N+FEYIKVEKNPKKKGYVQLHTTHGDL
Sbjct: 301 ERAPVNAKLVRSRYTTGAASRSFTSTSFDPVTKNDFEYIKVEKNPKKKGYVQLHTTHGDL 360

Query: 361 NIELHCDITPRSCENFITLCERGYYNGVAFHRSIR 395
           NIELHCDITPR+CENFITLCE+GYYNGVAFHRSIR
Sbjct: 361 NIELHCDITPRTCENFITLCEQGYYNGVAFHRSIR 395

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356496987|ref|XP_003517346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356541623|ref|XP_003539273.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|449525478|ref|XP_004169744.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147772861|emb|CAN75902.1| hypothetical protein VITISV_001969 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797629|ref|XP_002866699.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] gi|297312534|gb|EFH42958.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359480543|ref|XP_002276839.2| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Vitis vinifera] gi|296087308|emb|CBI33682.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15240768|ref|NP_201554.1| Peptidyl-prolyl cis-trans isomerase-like 2 [Arabidopsis thaliana] gi|75309147|sp|Q9FJX0.1|PPIL2_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase-like 2; Short=PPIase; AltName: Full=Cyclophilin-65; AltName: Full=Plant U-box protein 49; AltName: Full=Rotamase; AltName: Full=U-box domain-containing protein 49 gi|9757874|dbj|BAB08461.1| peptidylprolyl isomerase (cyclophilin)-like [Arabidopsis thaliana] gi|17063170|gb|AAL32981.1| AT5g67530/K9I9_9 [Arabidopsis thaliana] gi|24111273|gb|AAN46760.1| At5g67530/K9I9_9 [Arabidopsis thaliana] gi|45680884|gb|AAS75311.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana] gi|332010973|gb|AED98356.1| Peptidyl-prolyl cis-trans isomerase-like 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|17064880|gb|AAL32594.1| peptidylprolyl isomerase (cyclophilin)-like [Arabidopsis thaliana] gi|20259896|gb|AAM13295.1| peptidylprolyl isomerase (cyclophilin)-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357113547|ref|XP_003558564.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
TAIR|locus:2158636 595 PUB49 "plant U-box 49" [Arabid 0.960 0.655 0.741 5.9e-160
UNIPROTKB|F1NPF4 521 PPIL2 "Uncharacterized protein 0.534 0.416 0.506 2.8e-84
UNIPROTKB|Q13356 520 PPIL2 "Peptidyl-prolyl cis-tra 0.534 0.417 0.502 3.6e-82
UNIPROTKB|F1RL00 522 PPIL2 "Uncharacterized protein 0.517 0.402 0.492 1.2e-81
MGI|MGI:2447857 521 Ppil2 "peptidylprolyl isomeras 0.534 0.416 0.493 1.5e-81
RGD|1309484 521 Ppil2 "peptidylprolyl isomeras 0.534 0.416 0.493 2.5e-81
ZFIN|ZDB-GENE-040426-1096 524 ppil2 "peptidylprolyl isomeras 0.534 0.414 0.511 3.2e-81
UNIPROTKB|E2RE23 523 PPIL2 "Uncharacterized protein 0.534 0.414 0.488 1.1e-80
UNIPROTKB|Q2T9V1 554 PPIL2 "Uncharacterized protein 0.401 0.294 0.530 2.8e-80
UNIPROTKB|E7EW80 489 PPIL2 "Peptidyl-prolyl cis-tra 0.376 0.312 0.496 5.4e-74
TAIR|locus:2158636 PUB49 "plant U-box 49" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1558 (553.5 bits), Expect = 5.9e-160, P = 5.9e-160
 Identities = 293/395 (74%), Positives = 323/395 (81%)

Query:     1 MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSV 60
             MGKKQHSKDRMFITKTEWATEWGGAKSKE RTPFK LP+YCCALTF PFEDPVCT DGSV
Sbjct:     1 MGKKQHSKDRMFITKTEWATEWGGAKSKENRTPFKSLPYYCCALTFLPFEDPVCTIDGSV 60

Query:    61 FELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVK 120
             FE+ +I PYIRK+GKHPVTG PLK EDLIPL FHKN+EGEYHCPVLNKVFTEFTHIVAVK
Sbjct:    61 FEITTIVPYIRKFGKHPVTGAPLKGEDLIPLIFHKNSEGEYHCPVLNKVFTEFTHIVAVK 120

Query:   121 TTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLK 180
             TTGNVFC+EAIKELNIKTKNWKELLT+EPFT+ DLITIQNPNA+D KVT+EFDHVK GLK
Sbjct:   121 TTGNVFCYEAIKELNIKTKNWKELLTEEPFTRADLITIQNPNAVDGKVTVEFDHVKNGLK 180

Query:   181 VDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGXXXXXXXXXXXXXXX 240
             +DDEEL+KM SDP YNINV+GDIK ML +LGT+K +E AL GGGG               
Sbjct:   181 IDDEELKKMNSDPAYNINVSGDIKHMLADLGTDKAKEIALHGGGGNKARNERAAAIAAIL 240

Query:   241 XXXXXXXXNSKSDANGEAKATKAFSIVDAASASVHGRXXXXXXXXXXXXXXXRIAMHMAG 300
                      SK++   + K T  +S+VDAASASV GR               RIAMHMAG
Sbjct:   241 ESRSKIKEVSKAE---QPKQT--YSVVDAASASVFGRSADAAKAGSSDKTAARIAMHMAG 295

Query:   301 ERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDL 360
             +RTPVN+K+VKSRY++GAASRSFTS+A+ PVT N+FE IKVEKNPKKKGYVQ  TTHGDL
Sbjct:   296 DRTPVNSKMVKSRYSSGAASRSFTSSAFTPVTKNDFELIKVEKNPKKKGYVQFQTTHGDL 355

Query:   361 NIELHCDITPRSCENFITLCERGYYNGVAFHRSIR 395
             NIELHCDI PR+CENFITLCERGYYNGVAFHRSIR
Sbjct:   356 NIELHCDIAPRACENFITLCERGYYNGVAFHRSIR 390
GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0016567 "protein ubiquitination" evidence=IEA
UNIPROTKB|F1NPF4 PPIL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q13356 PPIL2 "Peptidyl-prolyl cis-trans isomerase-like 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RL00 PPIL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2447857 Ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309484 Ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1096 ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE23 PPIL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9V1 PPIL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7EW80 PPIL2 "Peptidyl-prolyl cis-trans isomerase-like 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FJX0PPIL2_ARATH5, ., 2, ., 1, ., 80.80500.96050.6554yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
cd01923 159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 1e-24
smart0050463 smart00504, Ubox, Modified RING finger domain 1e-15
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 1e-15
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-14
COG0652 158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 1e-14
cd01925 171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 9e-14
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 4e-13
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 6e-13
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 2e-09
cd01921 166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 2e-08
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 4e-08
PRK10791 164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 8e-07
pfam0456473 pfam04564, U-box, U-box domain 3e-05
pfam04641254 pfam04641, Rtf2, Replication termination factor 2 9e-05
PRK10903 190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-04
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 7e-04
cd01924 176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 0.001
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 0.003
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 0.003
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information 
 Score = 98.6 bits (246), Expect = 1e-24
 Identities = 32/46 (69%), Positives = 39/46 (84%)

Query: 350 YVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIR 395
           YV+LHT  GDLN+ELHCD  P++CENFI LC++GYY+G  FHRSIR
Sbjct: 1   YVRLHTNKGDLNLELHCDKAPKACENFIKLCKKGYYDGTIFHRSIR 46

This group includes the nuclear proteins, Human hCyP-60 and Caenorhabditis elegans MOG-6 which, compared to the archetypal cyclophilin Human cyclophilin A exhibit reduced peptidylprolyl cis- trans isomerase activity and lack a residue important for cyclophilin binding. Human hCyP-60 has been shown to physically interact with the proteinase inhibitor peptide eglin c and; C. elegans MOG-6 to physically interact with MEP-1, a nuclear zinc finger protein. MOG-6 has been shown to function in germline sex determination. Length = 159
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 406
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 100.0
PF04641260 Rtf2: Rtf2 RING-finger 100.0
KOG3039303 consensus Uncharacterized conserved protein [Funct 100.0
KOG3113293 consensus Uncharacterized conserved protein [Funct 99.92
COG0652 158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 99.76
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.71
PRK10791 164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 99.67
cd01923 159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 99.67
cd01925 171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 99.67
PRK10903 190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 99.67
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 99.65
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 99.63
cd01920 155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 99.62
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 99.62
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 99.55
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 99.54
KOG0884 161 consensus Similar to cyclophilin-type peptidyl-pro 99.53
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 99.48
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 99.46
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 99.41
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 99.4
PTZ00060183 cyclophilin; Provisional 99.4
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 99.38
KOG0880 217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 99.33
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 99.25
PTZ00221 249 cyclophilin; Provisional 99.23
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.12
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.96
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.91
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.41
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.27
KOG0289 506 consensus mRNA splicing factor [General function p 98.19
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 97.85
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.83
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 97.7
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.66
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.55
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.45
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.36
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.36
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.29
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.1
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.08
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.06
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.78
PF1463444 zf-RING_5: zinc-RING finger domain 96.75
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.63
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.61
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.28
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.19
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 96.12
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.11
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.02
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 95.98
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.7
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.66
COG5109396 Uncharacterized conserved protein, contains RING Z 95.49
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 95.16
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 95.13
PHA02929238 N1R/p28-like protein; Provisional 95.12
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.11
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.93
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 94.9
KOG2979262 consensus Protein involved in DNA repair [General 94.76
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.28
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 94.12
PHA02929238 N1R/p28-like protein; Provisional 94.03
PF04641260 Rtf2: Rtf2 RING-finger 93.77
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.62
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 92.85
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 92.75
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 92.64
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 92.31
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 91.9
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 91.51
PHA02926242 zinc finger-like protein; Provisional 91.36
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 91.21
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 90.86
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 90.71
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 90.42
KOG0289 506 consensus mRNA splicing factor [General function p 90.32
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 89.96
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 89.69
cd0016245 RING RING-finger (Really Interesting New Gene) dom 89.63
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 86.93
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 86.42
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 85.79
PF06416113 DUF1076: Protein of unknown function (DUF1076); In 83.5
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 83.2
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 82.49
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 82.28
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 82.08
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-102  Score=763.69  Aligned_cols=325  Identities=57%  Similarity=0.947  Sum_probs=300.7

Q ss_pred             CCCCcCCCCCceeeHHHHhhhcCCcccc-cccCCCCCCCCccccCCCCCCCCCeecCCCCEeeHhhHHHHHHhcCCCCCC
Q 015475            1 MGKKQHSKDRMFITKTEWATEWGGAKSK-EVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVT   79 (406)
Q Consensus         1 MGk~~hskdk~yiT~~E~~~~~gg~k~~-~~~~~~~~lpf~~C~LSl~Pl~~PV~t~~G~lf~ke~Il~~Ll~~~~~Pvt   79 (406)
                      |||+||||||||||++||+..|||++.. +.+..|++|||+||+|+++||++|||+.+|.+|+..+|++||+++|+||+|
T Consensus         1 MGKkQHqKDkmylT~tEw~~~~Ggkk~~~~n~~~FkrLP~~hC~lt~~Pfe~PvC~~dg~vFd~~~Ivp~lkk~g~nP~t   80 (518)
T KOG0883|consen    1 MGKKQHQKDKMYLTTTEWKSIYGGKKDTGENRTQFKRLPFNHCSLTMLPFEDPVCTVDGTVFDLTAIVPWLKKHGTNPIT   80 (518)
T ss_pred             CCcccccccceEEeehhhhhhcCCCCCCcccccccccCChhhceeccccccCcccccCCcEEeeehhhHHHHHcCCCCCC
Confidence            9999999999999999999999999985 447899999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCccccccccCCCCccccccccccccCceeEEEEccCCeeehHHHHHHHhhccCCccccCCCCCCCCCCeEEec
Q 015475           80 GTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQ  159 (406)
Q Consensus        80 g~~l~lkDLi~l~f~~n~~~~~~CPvt~k~f~~~t~~v~i~~cG~V~s~~ai~~l~~~~k~~~c~vc~~~f~~~DII~Lq  159 (406)
                      |++|..+|||+|+|++|++++|+|||++++|+.++|||||+++||||||+||++||+++|+|+||++++||+|.|||+||
T Consensus        81 G~kl~~~dLIkL~F~Kns~geyhcPvlfk~FT~~sHIvAv~TTGNvy~~eai~~LNiK~knwkdLltdepFtR~DiItiQ  160 (518)
T KOG0883|consen   81 GQKLDGKDLIKLKFHKNSEGEYHCPVLFKVFTRFSHIVAVRTTGNVYSWEAIEELNIKTKNWKDLLTDEPFTRADIITIQ  160 (518)
T ss_pred             CCccccccceeeeeccCCCCcccCceeeeeecccceEEEEEecCceeeHHHHHHhCcchhhHHHhhccCCcchhceeeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchhhhccchhhhcCcccChHHHhhhcCCCCc-cc-ccchhHHHHHHHhccccccchhhcCCCCchhHHHHHHHHH
Q 015475          160 NPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTY-NI-NVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALA  237 (406)
Q Consensus       160 dp~~~~~~~~~~f~hvk~~~~~~~~~~~~~~~~~~~-~~-~~~~~~~~~l~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~  237 (406)
                      ||++++.+++++|+|||+++++.++++++++.||.+ .+ ++|-+++.+|.+|.+++..         .           
T Consensus       161 dP~~lek~~~~~F~hvk~~lk~~~eeek~~~~dpa~~~~k~~n~e~ks~l~el~k~~~p---------~-----------  220 (518)
T KOG0883|consen  161 DPNNLEKFNMSDFYHVKKNLKTADEEEKKAKKDPALGYIKAMNLETKSTLPELSKEYQP---------K-----------  220 (518)
T ss_pred             CcchhhccchhhHHHHhcccccCcHHHHHhhcCchhhhhhhcchhhhhhhHHHhhhhcc---------c-----------
Confidence            999999999999999999999999999999999994 44 7888999999999987641         0           


Q ss_pred             HHHHHhhhhhhccccccccccccccchhhhhhccccccCCccchhcccCchHHHHHHHhhhhcCCCcccccccccccccc
Q 015475          238 AILAARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAGERTPVNAKLVKSRYTTG  317 (406)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~stg  317 (406)
                      ...                                      +++                + +..+   +++++|+||||
T Consensus       221 ~~~--------------------------------------a~t----------------~-~~~a---D~~naahyStG  242 (518)
T KOG0883|consen  221 KSI--------------------------------------AST----------------M-KRSA---DKINAAHYSTG  242 (518)
T ss_pred             hhh--------------------------------------hhh----------------c-cccc---hhhhhhhcccc
Confidence            000                                      000                0 0112   46789999999


Q ss_pred             cccccccccccCCCCcchhh-----hhhhhcCCCCccEEEEEecceeEEEEEcCCCChhHHHHHHHHHhcCccCCceeee
Q 015475          318 AASRSFTSTAYDPVTTNEFE-----YIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHR  392 (406)
Q Consensus       318 ~~a~SftSt~~~p~t~~~~~-----~~~~~~~~k~~~~v~l~T~~G~i~ieL~~d~aP~t~~NF~~L~~~g~Ydgt~FhR  392 (406)
                      ++|||||||+|+|+|.++++     .+++.|+ +++|||||+|+.|+|+||||||.+|++|+||++||++|||+|++|||
T Consensus       243 ~vaasfTSTam~PvT~neaaiid~d~~ry~rv-Kkkgyvrl~Tn~G~lNlELhcd~~P~aceNFI~lc~~gYYnnt~FHR  321 (518)
T KOG0883|consen  243 AVAASFTSTAMTPVTKNEAAIIDEDDVRYTRV-KKKGYVRLVTNHGPLNLELHCDYAPRACENFITLCKNGYYNNTIFHR  321 (518)
T ss_pred             ceeceeccceeeecccchhhhccchhhhhccc-cccceEEEeccCCceeeEeecCcchHHHHHHHHHHhcccccchHHHH
Confidence            99999999999999999988     3466666 99999999999999999999999999999999999999999999999


Q ss_pred             ecCCeeEeecCCC
Q 015475          393 SIRKRWRIYMGEA  405 (406)
Q Consensus       393 vi~~f~iq~gGDP  405 (406)
                      .|+||||| ||||
T Consensus       322 sIrnFmiQ-GGDP  333 (518)
T KOG0883|consen  322 SIRNFMIQ-GGDP  333 (518)
T ss_pred             HHHHHeee-CCCC
Confidence            99999998 9999

>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF06416 DUF1076: Protein of unknown function (DUF1076); InterPro: IPR010489 This entry is represented by Bacteriophage 2851, Orf74 (EP2851_74) Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
1zkc_A 197 Crystal Structure Of The Cyclophiln_ring Domain Of 3e-17
3bo7_A 201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 2e-11
2oju_A 167 X-Ray Structure Of Complex Of Human Cyclophilin J W 4e-10
1xyh_A 161 Crystal Structure Of Recombinant Human Cyclophilin 4e-10
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 6e-08
3bkp_A 232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 3e-07
2hq6_A 185 Structure Of The Cyclophilin_cecyp16-like Domain Of 6e-07
2poe_A 185 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-06
2k7n_A 203 Solution Structure Of The Ppil1 Bound To A Fragment 3e-06
1xwn_A 174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 3e-06
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 3e-06
3s6m_A 167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 7e-06
2nul_A 164 Peptidylprolyl Isomerase From E. Coli Length = 164 1e-05
1lop_A 164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 1e-05
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 8e-04
3t1u_A 163 Crystal Structure Of The Complex Of Cyclophilin-a E 8e-04
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 34/51 (66%), Positives = 43/51 (84%)
Query: 345 PKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIR 395
           P+  GYV+LHT  GDLN+ELHCD+TP++CENFI LC++ YY+G  FHRSIR
Sbjct: 16  PRGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIR 66
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
2b71_A196 Cyclophilin-like protein; structural genomics, str 1e-27
1zkc_A 197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 5e-27
3bkp_A 232 Cyclophilin; malaria, isomerase, structural GENO s 6e-27
2hq6_A 185 Serologically defined colon cancer antigen 10; pro 2e-26
3bo7_A 201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 2e-26
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 5e-25
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 8e-24
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 3e-23
2ok3_A 161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 4e-23
2k7n_A 203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-22
2poe_A 185 Cyclophilin-like protein, putative; cryptosporidiu 8e-22
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 2e-18
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 8e-18
3s6m_A 167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 2e-13
1v9t_A 166 Cyclophilin B; beta barrel, isomerase-isomerase in 2e-13
1lop_A 164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-13
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 6e-10
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 2e-09
3rfy_A 369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 4e-09
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 3e-08
2f42_A179 STIP1 homology and U-box containing protein 1; cha 2e-07
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 4e-07
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 8e-07
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 9e-06
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 3e-05
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 3e-05
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 3e-05
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 3e-05
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-05
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 4e-05
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 4e-05
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 5e-05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 5e-05
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 6e-05
3ich_A 188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 6e-05
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 7e-05
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 7e-05
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-04
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-04
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 1e-04
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-04
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 2e-04
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-04
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-04
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
 Score =  107 bits (269), Expect = 1e-27
 Identities = 23/67 (34%), Positives = 36/67 (53%)

Query: 330 PVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVA 389
             +  E       K   ++GY+ ++T  GD  +EL+   +P++C NF TLCE G+Y+   
Sbjct: 20  TKSLEEKIAYYKMKGHTERGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGFYDNTI 79

Query: 390 FHRSIRK 396
           FHR I  
Sbjct: 80  FHRVIPN 86
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
1zkc_A 197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 99.75
1v9t_A 166 Cyclophilin B; beta barrel, isomerase-isomerase in 99.74
3s6m_A 167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 99.73
3bo7_A 201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 99.73
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 99.73
1lop_A 164 Cyclophilin A; rotamase, isomerase-isomerase inhib 99.72
2hq6_A 185 Serologically defined colon cancer antigen 10; pro 99.72
3bkp_A 232 Cyclophilin; malaria, isomerase, structural GENO s 99.72
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 99.72
2ok3_A 161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 99.72
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 99.71
2poe_A 185 Cyclophilin-like protein, putative; cryptosporidiu 99.71
2b71_A 196 Cyclophilin-like protein; structural genomics, str 99.7
2k7n_A 203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 99.69
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 99.68
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 99.62
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 99.61
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 99.6
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 99.59
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 99.59
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 99.58
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 99.58
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 99.57
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 99.57
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 99.57
3ich_A 188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 99.57
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 99.56
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 99.56
1z81_A229 Cyclophilin; structural genomics, structural genom 99.56
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 99.55
3k2c_A 193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 99.55
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 99.55
3rfy_A 369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.55
4fru_A 185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 99.55
2ose_A 234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 99.54
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.54
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.47
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.25
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.03
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.03
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.96
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.87
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.62
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.41
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.27
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.13
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 98.06
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.87
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.85
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.83
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.79
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.77
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.73
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.67
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.67
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.66
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.65
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.64
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.6
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.59
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.58
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.58
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.57
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.57
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 97.57
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.56
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.53
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.53
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.52
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.48
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.46
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.45
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.4
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.39
2ect_A78 Ring finger protein 126; metal binding protein, st 97.38
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.37
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.37
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.36
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.35
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.35
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.32
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.31
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.28
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.23
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.23
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.22
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.22
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.21
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.21
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.21
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.21
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.2
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.14
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.12
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.12
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.11
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.1
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.09
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.02
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.99
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.97
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.91
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.91
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.85
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 96.85
2ect_A78 Ring finger protein 126; metal binding protein, st 96.84
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.82
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.81
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.8
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.8
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.75
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.75
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 96.65
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.65
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.64
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.52
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.51
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.48
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.47
2ecm_A55 Ring finger and CHY zinc finger domain- containing 96.46
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.3
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.24
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.2
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.14
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.1
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.07
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 96.0
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 95.97
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 95.94
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.93
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.87
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 95.87
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 95.85
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 95.76
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.71
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 95.68
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 95.66
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 95.52
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.38
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.37
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.35
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 95.35
2ea5_A68 Cell growth regulator with ring finger domain prot 95.19
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 95.1
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 94.95
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 94.87
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 94.18
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.05
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 92.96
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 92.85
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 92.68
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 92.16
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 91.92
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 91.66
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 91.18
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 90.92
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 90.54
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 90.04
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 88.8
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 88.72
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 88.56
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 86.9
2kkx_A102 Uncharacterized protein ECS2156; methods developme 85.45
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 83.88
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 83.06
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 82.54
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 82.36
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 80.89
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 80.73
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
Probab=99.75  E-value=1.3e-18  Score=161.60  Aligned_cols=62  Identities=56%  Similarity=1.092  Sum_probs=59.0

Q ss_pred             cCCCCccEEEEEecceeEEEEEcCCCChhHHHHHHHHHhcCccCCceeeeecCCeeEeecCCC
Q 015475          343 KNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEA  405 (406)
Q Consensus       343 ~~~k~~~~v~l~T~~G~i~ieL~~d~aP~t~~NF~~L~~~g~Ydgt~FhRvi~~f~iq~gGDP  405 (406)
                      +.|+..++|+|+|+.|+|+||||++.||+||+||+.||+.|||+|+.|||||++|||| ||||
T Consensus        14 ~~~~~~~~v~l~T~~G~I~ieL~~~~aP~tv~NF~~L~~~g~Ydg~~FhRVi~~f~iQ-gGd~   75 (197)
T 1zkc_A           14 LVPRGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQ-GGDP   75 (197)
T ss_dssp             CCCCSCEEEEEEETTEEEEEEECTTTSHHHHHHHHHHHHTTTTTTEEEEEEETTTEEE-ECCT
T ss_pred             CCCCCCcEEEEEeCCccEEEEEcCCCCcHHHHHHHHHHhcCCCCCCEEEEEeCCCEEE-cCCC
Confidence            4558899999999999999999999999999999999999999999999999999988 8887
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 406
d1zkca1 178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 9e-15
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 2e-11
d1lopa_ 164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-10
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 6e-10
d1v9ta_ 166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 8e-10
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 2e-08
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-08
d2ok3a1 159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 3e-08
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 9e-08
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-06
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 3e-06
d1h0pa_ 182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 4e-06
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 5e-06
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 3e-05
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 3e-05
d1ihga2 195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 5e-05
d2rmca_ 182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 7e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 2e-04
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-04
d1qnga_ 170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 4e-04
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 4e-04
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 5e-04
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 0.001
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.003
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 0.004
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.8 bits (170), Expect = 9e-15
 Identities = 33/50 (66%), Positives = 41/50 (82%)

Query: 349 GYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRW 398
           GYV+LHT  GDLN+ELHCD+TP++CENFI LC++ YY+G  FHRSIR   
Sbjct: 1   GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFV 50
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
d1v9ta_ 166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.64
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 99.63
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 99.63
d1lopa_ 164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.63
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 99.62
d2ok3a1 159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 99.6
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 99.54
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 99.48
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 99.37
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 99.34
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.34
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 99.34
d1h0pa_ 182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.33
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 99.32
d2rmca_ 182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 99.32
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 99.32
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 99.31
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 99.28
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 99.28
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.28
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 99.27
d1ihga2 195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 99.2
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.87
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.56
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.53
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.37
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.87
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.73
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.68
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.62
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.61
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.57
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.51
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.23
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.09
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.04
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.0
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.95
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.89
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.3
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.8
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 95.75
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 95.73
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 95.72
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.02
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 94.4
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 93.66
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 93.62
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 92.95
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 92.75
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 91.87
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 89.33
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 87.46
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 82.84
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.52
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase A, PpiA
species: Escherichia coli [TaxId: 562]

Probab=99.64  E-value=1.2e-16  Score=141.69  Aligned_cols=59  Identities=32%  Similarity=0.487  Sum_probs=55.0

Q ss_pred             CCccEEEEEecceeEEEEEcCCCChhHHHHHHHHHhcCccCCceeeeecCCeeEeecCCC
Q 015475          346 KKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRKRWRIYMGEA  405 (406)
Q Consensus       346 k~~~~v~l~T~~G~i~ieL~~d~aP~t~~NF~~L~~~g~Ydgt~FhRvi~~f~iq~gGDP  405 (406)
                      +.++.|.|+|+.|+|+||||.+.||+||+||+.||+.|||+|+.|||++++||+| +||+
T Consensus         2 ~g~~~V~l~T~~G~i~ieL~~~~aP~tv~nF~~L~~~~~Y~g~~fhRv~~~~~iq-~G~~   60 (166)
T d1v9ta_           2 KGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQ-GGGF   60 (166)
T ss_dssp             CCSCEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBEEEEETTTEEE-ESSB
T ss_pred             CCCCEEEEEECCeeEEEEEeCCCChHHHHHHHHHhhCCccccceeeEEEEEeecc-cCCc
Confidence            4567899999999999999999999999999999999999999999999999988 5554
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure