Citrus Sinensis ID: 015570


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIPSQRAEPKESIAPEKSDPAASKSMISEESSAPITEEPVQTKAKVTDPLSPYTSYEDLKPPTSPTPTAPSGKKDSTIVDGLPMSGISDAQTSTSGVKTGITETVSAPEELSKARPLSPYFAYEDLKPPSSPSPTPSGPKEVLSSSSTTGEVASQLTGGNDVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLKPPTSPIPSPKKY
ccccHHHHHcccccccccEEEEccccccccHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHHHHHHccccccccEEEEEccccHHHHHHHHccccEEEEEEccccccccccccccHccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHccHHHHccEEEEEcccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHcccccccccEEHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccEEHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccc
mkldgelankgiqpveMLELVECDLEKRvqiepalgnaSVVICCIgasekevfditgpyridfqATKNLVDAATIAKVNHFIMVSslgtnkfgfpAAILNLFWGVLLWKRKAEEALIasglpytivrpggmerptdaykethnitlsqedtlfggqvSNLQVAELLACMAKNRSLSYCKVVEVIAettapltpMEELLAkipsqraepkesiapeksdpaasksmiseessapiteepvqtkakvtdplspytsyedlkpptsptptapsgkkdstivdglpmsgisdaqtstsgvktgitetvsapeelskarplspyfayedlkppsspsptpsgpkevlssssttgevasqltggndvaktpdtslveknpivnsihhhspyhmyedlkpptspipspkky
mkldgelankgiqpveMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIasglpytivrpggMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIpsqraepkesiapeksdpaaskSMISEEssapiteepvqtkakvtdPLSPytsyedlkpptsptptapsgkkdSTIVDGLPMSGIsdaqtstsgvktgitetvsapeelskarpLSPYFAYEDLKPPSSPSPTPSGPKEVLSSSSTTGEvasqltggndvaktpdtSLVEKNPIVNSIHHhspyhmyedlkpptspipspkky
MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIPSQRAEPKESIAPEKSDPAASKSMISEESSAPITEEPVQTKAKVTDPLSPYTSYEDLKpptsptptapsGKKDSTIVDGLPMSGISDAQTSTSGVKTGITETVSAPEELSKARPLSPYFAYEDLKppsspsptpsgpKEVLSSSSTTGEVASQLTGGNDVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLkpptspipspkkY
***********IQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGME***DAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPL*********************************************************************************************************************************************************************************************************************
*K*********IQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAK******************************************************************************************************************************************************************************************MYEDLK************
MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIP*******************************************TDPLSPYTSY*******************STIVDGLPMSGISDAQTSTSGVKTGITETVSAPEELSKARPLSPYFAYEDL******************************TGGNDVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLKPPTSPIPSPKKY
*KLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIP*******************************************TDPLSPYTSYEDLKPPT**************************************************ARPLSPYFAYEDLKPPS*****************************************************SPYHMYEDLKPPT**IP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIPSQRAEPKESIAPEKSDPAASKSMISEESSAPITEEPVQTKAKVTDPLSPYTSYEDLKPPTSPTPTAPSGKKDSTIVDGLPMSGISDAQTSTSGVKTGITETVSAPEELSKARPLSPYFAYEDLKPPSSPSPTPSGPKEVLSSSSTTGEVASQLTGGNDVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLKPPTSPIPSPKKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query404 2.2.26 [Sep-21-2011]
Q8H0U5641 Protein TIC 62, chloropla yes no 0.967 0.609 0.561 1e-114
Q8SKU2534 Protein TIC 62, chloropla N/A no 0.950 0.719 0.600 1e-111
Q8H124280 Uncharacterized protein A no no 0.440 0.635 0.365 5e-17
Q94EG6253 Uncharacterized protein A no no 0.339 0.541 0.310 3e-10
O80934325 Uncharacterized protein A no no 0.242 0.301 0.358 4e-10
>sp|Q8H0U5|TIC62_ARATH Protein TIC 62, chloroplastic OS=Arabidopsis thaliana GN=TIC62 PE=1 SV=1 Back     alignment and function desciption
 Score =  413 bits (1061), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 243/433 (56%), Positives = 291/433 (67%), Gaps = 42/433 (9%)

Query: 1   MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYR 60
           MKL     ++G QPVE LE+VECDLEK+  I+PALGNASV+ICCIGASEKE+ DITGPYR
Sbjct: 128 MKLQN--TDEGTQPVEKLEIVECDLEKKDSIQPALGNASVIICCIGASEKEISDITGPYR 185

Query: 61  IDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASG 120
           ID+ ATKNLVDAAT AKVN+FI+V+SLGTNKFGFPAAILNLFWGVL WKRKAEEALI SG
Sbjct: 186 IDYLATKNLVDAATSAKVNNFILVTSLGTNKFGFPAAILNLFWGVLCWKRKAEEALIESG 245

Query: 121 LPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKV 180
           L Y IVRPGGMERPTDAYKETHN+TL+ +DTLFGGQVSNLQVAELLACMAKN  LS+ K+
Sbjct: 246 LNYAIVRPGGMERPTDAYKETHNLTLALDDTLFGGQVSNLQVAELLACMAKNPQLSFSKI 305

Query: 181 VEVIAETTAPLTPMEELLAKIPSQRAE---PKESIAPEKSDPAASKSMISEESSAPITEE 237
           VEV+AETTAPLTP+E+LL KIPS+R     PK S+A ++  P  +K +  E ++    E 
Sbjct: 306 VEVVAETTAPLTPIEKLLEKIPSKRPYVPPPKASVATKEVKPVPTKPVTQEPTAPKEDEA 365

Query: 238 PVQTKAKVTDPLSPYTSYEDLKPPTSPTPT-------APSGKKDSTIVDGLPM-SGISDA 289
           P + K     PLSPY SYEDLKPPTSP P        A S + D+T V   P+ + +   
Sbjct: 366 PPKEKNVKPRPLSPYASYEDLKPPTSPIPNSTTSVSPAKSKEVDATQV---PVEANVVPV 422

Query: 290 QTSTSGVKTGITETVSAPEELSKARPLSPYFAYEDLKPPS---------------SPSPT 334
             STS V     + V    E  K RPLSPY  YE+LKPPS               SP PT
Sbjct: 423 PDSTSNVPVVEVKQV----EEKKERPLSPYARYENLKPPSSPSPTASSTRKSDSLSPGPT 478

Query: 335 PSGPKEVLSSSSTTGE--VASQLTGGNDVAKTPDTSLVEK-----NPIVNSIHHHSPYHM 387
            S   +  + + T  E  VA+ +T  +     P+T++         P  + +   SPY +
Sbjct: 479 DSDTDKSSTVAKTVTETAVATSVTETSVATSVPETAVATSVTETAAPATSKMRPLSPYAI 538

Query: 388 YEDLKPPTSPIPS 400
           Y DLKPPTSP P+
Sbjct: 539 YADLKPPTSPTPA 551




Involved in protein precursor import into chloroplasts. Part of the redox regulon consisting of TIC32, TIC 55 and TIC62. Acts as a membrane anchor of LFNR1 and LFNR2. Has a NADPH-dependent dehydrogenase activity, but only after preincubation with lipids.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8SKU2|TIC62_PEA Protein TIC 62, chloroplastic OS=Pisum sativum GN=TIC62 PE=1 SV=2 Back     alignment and function description
>sp|Q8H124|Y2446_ARATH Uncharacterized protein At2g34460, chloroplastic OS=Arabidopsis thaliana GN=At2g34460 PE=1 SV=1 Back     alignment and function description
>sp|Q94EG6|Y5224_ARATH Uncharacterized protein At5g02240 OS=Arabidopsis thaliana GN=At5g02240 PE=1 SV=1 Back     alignment and function description
>sp|O80934|Y2766_ARATH Uncharacterized protein At2g37660, chloroplastic OS=Arabidopsis thaliana GN=At2g37660 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
255556137 584 NAD dependent epimerase/dehydratase, put 0.975 0.674 0.664 1e-134
224103467 564 predicted protein [Populus trichocarpa] 0.972 0.696 0.591 1e-131
224080277 517 predicted protein [Populus trichocarpa] 0.935 0.731 0.628 1e-126
225428568 529 PREDICTED: protein TIC 62, chloroplastic 0.957 0.731 0.632 1e-118
157849706 624 catalytic/coenzyme binding protein [Bras 0.960 0.621 0.572 1e-118
356545313 528 PREDICTED: uncharacterized protein LOC10 0.965 0.738 0.613 1e-116
356541105 529 PREDICTED: uncharacterized protein LOC10 0.962 0.735 0.595 1e-114
297830550 668 catalytic/ coenzyme binding protein [Ara 0.985 0.595 0.541 1e-114
359475261448 PREDICTED: protein TIC 62, chloroplastic 0.923 0.832 0.62 1e-113
30685117 641 Rossmann-fold NAD(P)-binding domain-cont 0.967 0.609 0.561 1e-112
>gi|255556137|ref|XP_002519103.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis] gi|223541766|gb|EEF43314.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 267/402 (66%), Positives = 309/402 (76%), Gaps = 8/402 (1%)

Query: 1   MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYR 60
           MKLDGE    G QP+E  E++ECDL+K  +I  ALGNAS+VICCIGA EKEVFD TGPYR
Sbjct: 127 MKLDGE----GAQPIEKFEIIECDLDKPNEIGAALGNASIVICCIGAGEKEVFDFTGPYR 182

Query: 61  IDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASG 120
           ID+QAT+NL+DAAT+AKV HFIMVSSLGTNK GFPAAILNLFWGVL WKRKAEEALIASG
Sbjct: 183 IDYQATRNLIDAATVAKVKHFIMVSSLGTNKVGFPAAILNLFWGVLFWKRKAEEALIASG 242

Query: 121 LPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKV 180
           +PYTIVRPGGMERPTDAYKETHNITLS+EDTLFGGQVSNLQVAEL+A MAKN  LSYCKV
Sbjct: 243 IPYTIVRPGGMERPTDAYKETHNITLSEEDTLFGGQVSNLQVAELMAVMAKNLDLSYCKV 302

Query: 181 VEVIAETTAPLTPMEELLAKIPSQRAEPKESIAPEKSDPAASKSMISE--ESSAPITEEP 238
           VEVIAETTAPLT M++LL +IPSQR +PKE  A E  +PA S  ++ E  E ++ I +EP
Sbjct: 303 VEVIAETTAPLTTMDKLLTRIPSQRIKPKEPAAAEGPEPAPSTKVVPEASEPTSAIEKEP 362

Query: 239 VQTKAKVTDPLSPYTSYEDLKPPTSPTPTAPS-GKKDSTIVDGLPMSGISDAQTSTSGVK 297
            Q KA V+ PLSPYT+Y+DLKPPTSP P  PS G + S+ VD +      DAQTS+SG+ 
Sbjct: 363 EQPKATVSRPLSPYTAYDDLKPPTSPIPIRPSGGNQSSSPVDAVAKPDTIDAQTSSSGLA 422

Query: 298 TGITETVSAPEELSKARPLSPYFAYEDLKPPSSPSPTPSGPKEVLSSSSTTGEVASQLTG 357
           + I E+  A  E   A PLSPY AY DLKPP+SPSP PSG KE+ S +S+T +V S  TG
Sbjct: 423 SAIPESKPATVEAKIAGPLSPYAAYPDLKPPTSPSPKPSGSKEIPSGASSTEKVESSATG 482

Query: 358 GNDVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLKPPTSPIP 399
            NDVA     +  E NP       HSP+ +Y+DLKPPTSP P
Sbjct: 483 DNDVATITANNDAE-NPPPEFSSGHSPFLVYDDLKPPTSPSP 523




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224103467|ref|XP_002313068.1| predicted protein [Populus trichocarpa] gi|222849476|gb|EEE87023.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224080277|ref|XP_002306080.1| predicted protein [Populus trichocarpa] gi|222849044|gb|EEE86591.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428568|ref|XP_002284662.1| PREDICTED: protein TIC 62, chloroplastic isoform 1 [Vitis vinifera] gi|297741413|emb|CBI32544.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|157849706|gb|ABV89636.1| catalytic/coenzyme binding protein [Brassica rapa] Back     alignment and taxonomy information
>gi|356545313|ref|XP_003541088.1| PREDICTED: uncharacterized protein LOC100779056 [Glycine max] Back     alignment and taxonomy information
>gi|356541105|ref|XP_003539023.1| PREDICTED: uncharacterized protein LOC100802919 [Glycine max] Back     alignment and taxonomy information
>gi|297830550|ref|XP_002883157.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. lyrata] gi|297328997|gb|EFH59416.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359475261|ref|XP_003631626.1| PREDICTED: protein TIC 62, chloroplastic isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|30685117|ref|NP_188519.2| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] gi|75151827|sp|Q8H0U5.1|TIC62_ARATH RecName: Full=Protein TIC 62, chloroplastic; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 62; Short=AtTIC62; Flags: Precursor gi|25083201|gb|AAN72050.1| Unknown protein [Arabidopsis thaliana] gi|30725480|gb|AAP37762.1| At3g18890 [Arabidopsis thaliana] gi|332642643|gb|AEE76164.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
TAIR|locus:2087901 641 Tic62 "translocon at the inner 0.915 0.577 0.567 1.8e-101
TAIR|locus:2040854280 AT2G34460 [Arabidopsis thalian 0.480 0.692 0.354 4.7e-20
TAIR|locus:2185228253 AT5G02240 [Arabidopsis thalian 0.353 0.565 0.315 7.4e-10
TAIR|locus:2040716325 AT2G37660 [Arabidopsis thalian 0.339 0.421 0.289 2.4e-09
TAIR|locus:2102842510 PTAC16 "plastid transcriptiona 0.725 0.574 0.240 1.4e-07
TAIR|locus:2087901 Tic62 "translocon at the inner envelope membrane of chloroplasts 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 982 (350.7 bits), Expect = 1.8e-101, Sum P(2) = 1.8e-101
 Identities = 220/388 (56%), Positives = 263/388 (67%)

Query:     1 MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYR 60
             MKL     ++G QPVE LE+VECDLEK+  I+PALGNASV+ICCIGASEKE+ DITGPYR
Sbjct:   128 MKLQN--TDEGTQPVEKLEIVECDLEKKDSIQPALGNASVIICCIGASEKEISDITGPYR 185

Query:    61 IDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASG 120
             ID+ ATKNLVDAAT AKVN+FI+V+SLGTNKFGFPAAILNLFWGVL WKRKAEEALI SG
Sbjct:   186 IDYLATKNLVDAATSAKVNNFILVTSLGTNKFGFPAAILNLFWGVLCWKRKAEEALIESG 245

Query:   121 LPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKV 180
             L Y IVRPGGMERPTDAYKETHN+TL+ +DTLFGGQVSNLQVAELLACMAKN  LS+ K+
Sbjct:   246 LNYAIVRPGGMERPTDAYKETHNLTLALDDTLFGGQVSNLQVAELLACMAKNPQLSFSKI 305

Query:   181 VEVIAETTAPLTPMEELLAKIPSQRA---EPKESIAPEKSDPAASKSMISEESSAPITEE 237
             VEV+AETTAPLTP+E+LL KIPS+R     PK S+A ++  P  +K  +++E +AP  +E
Sbjct:   306 VEVVAETTAPLTPIEKLLEKIPSKRPYVPPPKASVATKEVKPVPTKP-VTQEPTAPKEDE 364

Query:   238 -PVQTKAKVTDPLSPYTSYEDLK--XXXXXXXXXXXGKKDSTIVDG--LPM-SGISDAQT 291
              P + K     PLSPY SYEDLK                 S  VD   +P+ + +     
Sbjct:   365 APPKEKNVKPRPLSPYASYEDLKPPTSPIPNSTTSVSPAKSKEVDATQVPVEANVVPVPD 424

Query:   292 STSGVKTGITETVSAPEELSKARPLSPYFAYEDLKXXXXXXXXXXXXKEVLSSSSTTGEV 351
             STS V   + E V   EE  K RPLSPY  YE+LK            ++  S S + G  
Sbjct:   425 STSNVP--VVE-VKQVEE-KKERPLSPYARYENLKPPSSPSPTASSTRK--SDSLSPGPT 478

Query:   352 ASQLTGGNDVAKTPDTSLVEKNPIVNSI 379
              S     + VAKT   + V  +    S+
Sbjct:   479 DSDTDKSSTVAKTVTETAVATSVTETSV 506


GO:0000166 "nucleotide binding" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
TAIR|locus:2040854 AT2G34460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185228 AT5G02240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040716 AT2G37660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102842 PTAC16 "plastid transcriptionally active 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H0U5TIC62_ARATHNo assigned EC number0.56120.96780.6099yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 0.0
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 3e-46
PLN00141251 PLN00141, PLN00141, Tic62-NAD(P)-related group II 8e-25
pfam13460182 pfam13460, NAD_binding_10, NADH(P)-binding 3e-16
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 1e-12
CHL00194317 CHL00194, ycf39, Ycf39; Provisional 4e-09
cd05251242 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional 2e-08
cd05250214 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical 3e-08
cd05269272 cd05269, TMR_SDR_a, triphenylmethane reductase (TM 3e-08
cd05244207 cd05244, BVR-B_like_SDR_a, biliverdin IX beta redu 4e-08
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 8e-08
pfam05368232 pfam05368, NmrA, NmrA-like family 6e-07
PLN02657390 PLN02657, PLN02657, 3,8-divinyl protochlorophyllid 1e-06
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 2e-05
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 3e-05
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 5e-05
cd05259282 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe 3e-04
cd05267203 cd05267, SDR_a6, atypical (a) SDRs, subgroup 6 7e-04
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 0.004
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
 Score =  514 bits (1326), Expect = 0.0
 Identities = 266/401 (66%), Positives = 291/401 (72%), Gaps = 13/401 (3%)

Query: 1   MKLDGELANKGIQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYR 60
           MKLD E    G QPVE LE+VECDLEK  QI PALGNASVVICCIGASEKEVFD+TGPYR
Sbjct: 127 MKLDVE----GTQPVEKLEIVECDLEKPDQIGPALGNASVVICCIGASEKEVFDVTGPYR 182

Query: 61  IDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASG 120
           ID+ ATKNLVDAAT+AKVNHFI+V+SLGTNK GFPAAILNLFWGVL WKRKAEEALIASG
Sbjct: 183 IDYLATKNLVDAATVAKVNHFILVTSLGTNKVGFPAAILNLFWGVLCWKRKAEEALIASG 242

Query: 121 LPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKV 180
           LPYTIVRPGGMERPTDAYKETHN+TLS+EDTLFGGQVSNLQVAEL+ACMAKNR LSYCKV
Sbjct: 243 LPYTIVRPGGMERPTDAYKETHNLTLSEEDTLFGGQVSNLQVAELMACMAKNRRLSYCKV 302

Query: 181 VEVIAETTAPLTPMEELLAKIPSQRAEPKESIAPEKSDPAASKSMISEESSAPITEEPVQ 240
           VEVIAETTAPLTPMEELLAKIPSQR  PKES A +   P  +K +  E  S PI EEP Q
Sbjct: 303 VEVIAETTAPLTPMEELLAKIPSQRVPPKESDAADGPKPVPTKPVTPEAPSPPIEEEPPQ 362

Query: 241 TKAKVTDPLSPYTSYEDLKPPTSPTPTAPSGKKD-STIVDGLPMSGISDAQTSTSGVKTG 299
            KA V  PLSPYT+YEDLKPPTSP PT PS     S  VD +      D   S  G  + 
Sbjct: 363 PKAVVPRPLSPYTAYEDLKPPTSPIPTPPSSSPASSKSVDAVAKPAEPDVVPS-PGSASN 421

Query: 300 ITETVSAPEELSKARPLSPYFAYEDLKPPSSPSPTPSGPKEVLSSSSTTGEVASQLTGGN 359
           + E   A  E  K RPLSPY  YEDLKPP+SPSPT           S +    S +    
Sbjct: 422 VPEVEPAQVEAKKTRPLSPYARYEDLKPPTSPSPTAPTG------VSPSVSSTSSVPAVP 475

Query: 360 DVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLKPPTSPIPS 400
           D A     +     P   ++   SPY +Y+DLKPPTSP P+
Sbjct: 476 DTA-PATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSPA 515


Length = 576

>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|215072 PLN00141, PLN00141, Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|177093 CHL00194, ycf39, Ycf39; Provisional Back     alignment and domain information
>gnl|CDD|187561 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187560 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187555 cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187577 cd05267, SDR_a6, atypical (a) SDRs, subgroup 6 Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 404
PLN03209576 translocon at the inner envelope of chloroplast su 100.0
PLN03209576 translocon at the inner envelope of chloroplast su 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.86
CHL00194317 ycf39 Ycf39; Provisional 99.85
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.84
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.83
PLN02427386 UDP-apiose/xylose synthase 99.81
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.81
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.79
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.79
PLN02214342 cinnamoyl-CoA reductase 99.79
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.78
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.78
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.77
PLN02260 668 probable rhamnose biosynthetic enzyme 99.77
PLN02572442 UDP-sulfoquinovose synthase 99.77
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.76
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.76
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.76
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.76
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.75
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.75
PLN02650351 dihydroflavonol-4-reductase 99.75
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.74
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.74
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.74
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.73
PLN02166436 dTDP-glucose 4,6-dehydratase 99.73
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.73
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.73
PLN00198338 anthocyanidin reductase; Provisional 99.73
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.73
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.73
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.73
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.72
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.72
PLN00016378 RNA-binding protein; Provisional 99.72
PLN02240352 UDP-glucose 4-epimerase 99.72
PLN02206442 UDP-glucuronate decarboxylase 99.72
PRK07201 657 short chain dehydrogenase; Provisional 99.71
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.71
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.7
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.7
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.7
PLN02583297 cinnamoyl-CoA reductase 99.7
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.7
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.7
PLN02686367 cinnamoyl-CoA reductase 99.69
PLN02653340 GDP-mannose 4,6-dehydratase 99.69
PLN02996491 fatty acyl-CoA reductase 99.69
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.69
PLN02896353 cinnamyl-alcohol dehydrogenase 99.68
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.67
PRK05865 854 hypothetical protein; Provisional 99.65
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.63
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.62
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.61
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 99.6
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.56
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.54
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.5
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.49
PLN02778298 3,5-epimerase/4-reductase 99.49
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.44
PRK12320 699 hypothetical protein; Provisional 99.43
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.43
PLN02503605 fatty acyl-CoA reductase 2 99.4
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.39
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.37
PLN02260668 probable rhamnose biosynthetic enzyme 99.36
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.36
PRK06482276 short chain dehydrogenase; Provisional 99.31
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.24
PRK05875276 short chain dehydrogenase; Provisional 99.23
PRK07806248 short chain dehydrogenase; Provisional 99.22
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.21
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.21
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 99.21
COG3320382 Putative dehydrogenase domain of multifunctional n 99.18
COG2910211 Putative NADH-flavin reductase [General function p 99.17
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.15
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.15
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.15
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.14
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.14
PRK07074257 short chain dehydrogenase; Provisional 99.14
PRK09135249 pteridine reductase; Provisional 99.14
PRK08263275 short chain dehydrogenase; Provisional 99.13
PRK12746254 short chain dehydrogenase; Provisional 99.12
PRK12827249 short chain dehydrogenase; Provisional 99.09
PRK12828239 short chain dehydrogenase; Provisional 99.09
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.08
PRK06182273 short chain dehydrogenase; Validated 99.07
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.07
PRK12829264 short chain dehydrogenase; Provisional 99.06
PRK08219227 short chain dehydrogenase; Provisional 99.06
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.05
PRK12939250 short chain dehydrogenase; Provisional 99.04
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.04
PRK07775274 short chain dehydrogenase; Provisional 99.03
PRK06180277 short chain dehydrogenase; Provisional 99.03
PRK06914280 short chain dehydrogenase; Provisional 99.03
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.03
PRK06138252 short chain dehydrogenase; Provisional 99.02
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.02
PRK07060245 short chain dehydrogenase; Provisional 99.02
PRK06128300 oxidoreductase; Provisional 99.01
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.01
PRK06179270 short chain dehydrogenase; Provisional 99.0
KOG4288283 consensus Predicted oxidoreductase [General functi 98.99
PRK10538248 malonic semialdehyde reductase; Provisional 98.99
PRK07067257 sorbitol dehydrogenase; Provisional 98.99
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.98
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.98
PRK07774250 short chain dehydrogenase; Provisional 98.98
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.98
PRK09186256 flagellin modification protein A; Provisional 98.96
PRK07326237 short chain dehydrogenase; Provisional 98.96
PRK07523255 gluconate 5-dehydrogenase; Provisional 98.95
PRK12938246 acetyacetyl-CoA reductase; Provisional 98.94
PRK06123248 short chain dehydrogenase; Provisional 98.93
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.93
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.92
PRK06181263 short chain dehydrogenase; Provisional 98.92
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.91
PRK07454241 short chain dehydrogenase; Provisional 98.9
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.9
PRK12743256 oxidoreductase; Provisional 98.89
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.88
PRK12937245 short chain dehydrogenase; Provisional 98.87
PRK07577234 short chain dehydrogenase; Provisional 98.87
PRK09134258 short chain dehydrogenase; Provisional 98.87
PRK07825273 short chain dehydrogenase; Provisional 98.86
PRK07041230 short chain dehydrogenase; Provisional 98.86
PRK05876275 short chain dehydrogenase; Provisional 98.86
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.85
PRK07890258 short chain dehydrogenase; Provisional 98.85
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.85
PRK08628258 short chain dehydrogenase; Provisional 98.84
PRK05993277 short chain dehydrogenase; Provisional 98.84
PRK05717255 oxidoreductase; Validated 98.84
PLN02253280 xanthoxin dehydrogenase 98.83
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.83
PRK09291257 short chain dehydrogenase; Provisional 98.83
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.82
PRK06523260 short chain dehydrogenase; Provisional 98.82
PRK08324681 short chain dehydrogenase; Validated 98.82
PRK06701290 short chain dehydrogenase; Provisional 98.82
PRK07985294 oxidoreductase; Provisional 98.81
PRK05650270 short chain dehydrogenase; Provisional 98.81
PRK06841255 short chain dehydrogenase; Provisional 98.81
PRK07904253 short chain dehydrogenase; Provisional 98.81
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.8
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.8
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.79
PRK07024257 short chain dehydrogenase; Provisional 98.78
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 98.78
PRK06124256 gluconate 5-dehydrogenase; Provisional 98.78
PRK07814263 short chain dehydrogenase; Provisional 98.77
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.77
PRK08277278 D-mannonate oxidoreductase; Provisional 98.76
PRK07856252 short chain dehydrogenase; Provisional 98.75
PRK06194287 hypothetical protein; Provisional 98.75
PRK06947248 glucose-1-dehydrogenase; Provisional 98.75
PRK08264238 short chain dehydrogenase; Validated 98.75
PRK06114254 short chain dehydrogenase; Provisional 98.75
PRK12744257 short chain dehydrogenase; Provisional 98.74
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.74
PRK08251248 short chain dehydrogenase; Provisional 98.74
PRK07069251 short chain dehydrogenase; Validated 98.74
PRK08017256 oxidoreductase; Provisional 98.74
PRK12742237 oxidoreductase; Provisional 98.74
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.74
PRK12747252 short chain dehydrogenase; Provisional 98.73
PRK08265261 short chain dehydrogenase; Provisional 98.73
PRK07109334 short chain dehydrogenase; Provisional 98.72
PRK06172253 short chain dehydrogenase; Provisional 98.72
PRK08643256 acetoin reductase; Validated 98.72
PRK06500249 short chain dehydrogenase; Provisional 98.72
PRK06196315 oxidoreductase; Provisional 98.71
PRK05866293 short chain dehydrogenase; Provisional 98.71
PRK06398258 aldose dehydrogenase; Validated 98.71
PRK08267260 short chain dehydrogenase; Provisional 98.71
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.7
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.68
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 98.68
PRK07478254 short chain dehydrogenase; Provisional 98.67
TIGR02415254 23BDH acetoin reductases. One member of this famil 98.67
PRK06949258 short chain dehydrogenase; Provisional 98.66
PRK09242257 tropinone reductase; Provisional 98.66
PRK07063260 short chain dehydrogenase; Provisional 98.66
PRK06198260 short chain dehydrogenase; Provisional 98.65
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.64
PRK05867253 short chain dehydrogenase; Provisional 98.64
PRK07035252 short chain dehydrogenase; Provisional 98.63
PRK07102243 short chain dehydrogenase; Provisional 98.63
PRK05693274 short chain dehydrogenase; Provisional 98.62
PRK08339263 short chain dehydrogenase; Provisional 98.61
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.61
PRK06101240 short chain dehydrogenase; Provisional 98.59
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.59
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.58
PRK07832272 short chain dehydrogenase; Provisional 98.58
PRK06139330 short chain dehydrogenase; Provisional 98.58
PRK07831262 short chain dehydrogenase; Provisional 98.57
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 98.56
PRK07677252 short chain dehydrogenase; Provisional 98.56
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 98.55
PRK08226263 short chain dehydrogenase; Provisional 98.55
PRK08589272 short chain dehydrogenase; Validated 98.55
PRK08936261 glucose-1-dehydrogenase; Provisional 98.55
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.53
PRK07578199 short chain dehydrogenase; Provisional 98.53
PRK07023243 short chain dehydrogenase; Provisional 98.51
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.51
PRK06057255 short chain dehydrogenase; Provisional 98.5
PRK07576264 short chain dehydrogenase; Provisional 98.5
PRK06940275 short chain dehydrogenase; Provisional 98.5
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.49
PRK06483236 dihydromonapterin reductase; Provisional 98.48
PRK05872296 short chain dehydrogenase; Provisional 98.48
PRK06924251 short chain dehydrogenase; Provisional 98.47
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 98.47
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 98.47
PRK07201657 short chain dehydrogenase; Provisional 98.47
PRK08278273 short chain dehydrogenase; Provisional 98.46
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.46
PRK06125259 short chain dehydrogenase; Provisional 98.46
PRK06484520 short chain dehydrogenase; Validated 98.46
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 98.44
PRK07062265 short chain dehydrogenase; Provisional 98.43
PRK09072263 short chain dehydrogenase; Provisional 98.43
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.43
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 98.42
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 98.42
PRK05855582 short chain dehydrogenase; Validated 98.41
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 98.41
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 98.4
PRK08340259 glucose-1-dehydrogenase; Provisional 98.39
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 98.39
PRK06197306 short chain dehydrogenase; Provisional 98.39
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 98.39
COG0300265 DltE Short-chain dehydrogenases of various substra 98.38
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.38
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.36
PRK07453322 protochlorophyllide oxidoreductase; Validated 98.35
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 98.34
PRK08703239 short chain dehydrogenase; Provisional 98.34
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 98.33
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 98.32
PRK09009235 C factor cell-cell signaling protein; Provisional 98.31
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.31
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 98.31
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 98.29
PRK06953222 short chain dehydrogenase; Provisional 98.27
PRK05884223 short chain dehydrogenase; Provisional 98.27
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.26
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 98.21
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.21
KOG2774366 consensus NAD dependent epimerase [General functio 98.2
PRK06484520 short chain dehydrogenase; Validated 98.2
PRK07791286 short chain dehydrogenase; Provisional 98.2
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.19
PRK05599246 hypothetical protein; Provisional 98.17
PRK12367245 short chain dehydrogenase; Provisional 98.14
PLN00015308 protochlorophyllide reductase 98.08
PRK08177225 short chain dehydrogenase; Provisional 97.99
PLN02780320 ketoreductase/ oxidoreductase 97.99
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 97.93
PRK07424406 bifunctional sterol desaturase/short chain dehydro 97.9
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 97.89
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 97.84
PRK08303305 short chain dehydrogenase; Provisional 97.79
PRK05854313 short chain dehydrogenase; Provisional 97.77
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 97.73
PLN02730303 enoyl-[acyl-carrier-protein] reductase 97.66
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.53
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 97.53
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 97.48
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 97.43
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 97.4
KOG1611249 consensus Predicted short chain-type dehydrogenase 97.39
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 97.38
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 97.34
KOG0725270 consensus Reductases with broad range of substrate 97.3
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.22
PF08732410 HIM1: HIM1; InterPro: IPR014843 HIM1 (high inducti 97.2
PRK08862227 short chain dehydrogenase; Provisional 97.19
PTZ00325321 malate dehydrogenase; Provisional 97.03
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 96.87
COG1028251 FabG Dehydrogenases with different specificities ( 96.77
KOG1208314 consensus Dehydrogenases with different specificit 96.39
PLN00106323 malate dehydrogenase 96.03
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 95.51
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 95.3
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 94.18
COG0623259 FabI Enoyl-[acyl-carrier-protein] 93.28
PRK05086312 malate dehydrogenase; Provisional 93.17
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 92.67
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 92.41
PRK08309177 short chain dehydrogenase; Provisional 91.16
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 90.1
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 90.0
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 89.88
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 88.89
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 88.84
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 88.23
PRK06732229 phosphopantothenate--cysteine ligase; Validated 87.53
KOG2733423 consensus Uncharacterized membrane protein [Functi 87.01
PRK06720169 hypothetical protein; Provisional 86.63
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 81.85
PF1008797 DUF2325: Uncharacterized protein conserved in bact 81.12
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.7e-67  Score=544.52  Aligned_cols=379  Identities=67%  Similarity=1.010  Sum_probs=320.3

Q ss_pred             CCeEEEEcCCCCHhhHHHHhCCCCEEEEcCcCCCCCCCCCCcchhhHHHHHHHHHHHHHhCCCCEEEEeccCcccCCCCc
Q 015570           16 EMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFP   95 (404)
Q Consensus        16 ~gveiV~gDl~d~~~l~~aL~gvDvVI~~ag~~~~~~~d~~~~~~vnv~~~~~Ll~Aa~~agVkrfI~vSS~gv~~~~~~   95 (404)
                      .+++++.+|+.|.+++..+|.++|+||||+|.......++...+++|+.++.+|+++|++.|++|||++||++++.....
T Consensus       138 ~~v~iV~gDLtD~esI~~aLggiDiVVn~AG~~~~~v~d~~~~~~VN~~Gt~nLl~Aa~~agVgRIV~VSSiga~~~g~p  217 (576)
T PLN03209        138 EKLEIVECDLEKPDQIGPALGNASVVICCIGASEKEVFDVTGPYRIDYLATKNLVDAATVAKVNHFILVTSLGTNKVGFP  217 (576)
T ss_pred             CceEEEEecCCCHHHHHHHhcCCCEEEEccccccccccchhhHHHHHHHHHHHHHHHHHHhCCCEEEEEccchhcccCcc
Confidence            56899999999999999999999999999997644334566778899999999999999999999999999987533222


Q ss_pred             hhhcccchHHHHHHHHHHHHHHHCCCCEEEEEcCccCCCCCCccCcccEEEccCCccccCcccHHHHHHHHHHHHhCCCC
Q 015570           96 AAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSL  175 (404)
Q Consensus        96 ~~~~~~~~~y~~sK~~~E~~l~~~gl~~tIlRpg~~~G~~~~~~~~~~i~~~~~~~~~~~~Is~~DVA~ai~~~l~~~~~  175 (404)
                      ....+.+++|..+|+.+|++|+..||+|++||||+++++.+.+...+.+.+...+...++.++++|||++|++++.++..
T Consensus       218 ~~~~~sk~~~~~~KraaE~~L~~sGIrvTIVRPG~L~tp~d~~~~t~~v~~~~~d~~~gr~isreDVA~vVvfLasd~~a  297 (576)
T PLN03209        218 AAILNLFWGVLCWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNLTLSEEDTLFGGQVSNLQVAELMACMAKNRRL  297 (576)
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHcCCCEEEEECCeecCCccccccccceeeccccccCCCccCHHHHHHHHHHHHcCchh
Confidence            22234567899999999999999999999999999988755433334455444444556689999999999999998876


Q ss_pred             CCCcEEEEEcCCCCCCccHHHHHHHcccccCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCcccccccCCCCCCCCccC
Q 015570          176 SYCKVVEVIAETTAPLTPMEELLAKIPSQRAEPKESIAPEKSDPAASKSMISEESSAPITEEPVQTKAKVTDPLSPYTSY  255 (404)
Q Consensus       176 ~~~~i~nI~~~~~~~~~si~ell~~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~  255 (404)
                      ..+++|+|+++......+|.++|..|......++++.++++..+.|+++|.++++..+.++++.|++++..||||||++|
T Consensus       298 s~~kvvevi~~~~~p~~~~~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  377 (576)
T PLN03209        298 SYCKVVEVIAETTAPLTPMEELLAKIPSQRVPPKESDAADGPKPVPTKPVTPEAPSPPIEEEPPQPKAVVPRPLSPYTAY  377 (576)
T ss_pred             ccceEEEEEeCCCCCCCCHHHHHHhcccccCCCCcccccccCCCCCCcccCCCCCCCcccccCCCCcCCCCCCCCCcccc
Confidence            78999999999988899999999999999988999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCC
Q 015570          256 EDLKPPTSPTPTAPSGKKD-STIVDGLPMSGISDAQTSTSGVKTGITETVSAPEELSKARPLSPYFAYEDLKPPSSPSPT  334 (404)
Q Consensus       256 ~dlkpp~sp~P~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rplspy~~y~dlkpp~sp~p~  334 (404)
                      +||||||||+|++++++.. ..++|++.++.++++..+. ...+.+.+......+.++.||||||++|+||||||||+|+
T Consensus       378 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  456 (576)
T PLN03209        378 EDLKPPTSPIPTPPSSSPASSKSVDAVAKPAEPDVVPSP-GSASNVPEVEPAQVEAKKTRPLSPYARYEDLKPPTSPSPT  456 (576)
T ss_pred             ccCCCCCCCCCCCCCCCCCCCCcccccccCccCCCCCCC-CccccCccccccccccCCCCCCCcccccccCCCCCCCCCC
Confidence            9999999999999998777 7788999999999988764 4455666655666677899999999999999999999999


Q ss_pred             CCCCCcccCCCCCCCccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCC
Q 015570          335 PSGPKEVLSSSSTTGEVASQLTGGNDVAKTPDTSLVEKNPIVNSIHHHSPYHMYEDLKPPTSPIPSPK  402 (404)
Q Consensus       335 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sp~~~y~d~kpp~sp~p~~~  402 (404)
                      ++....    .+.....+...+++++.+.++.+++++.+++   +||||||+||+||||||||||+.+
T Consensus       457 ~~~~~~----~~~~~~~~~~~~~~~~~~~a~~d~~~~~~~~---~~plspy~~y~d~kpp~sp~p~~~  517 (576)
T PLN03209        457 APTGVS----PSVSSTSSVPAVPDTAPATAATDAAAPPPAN---MRPLSPYAVYDDLKPPTSPSPAAP  517 (576)
T ss_pred             CCCCcc----cccccccccCCCCCCCCcccccccccCCCCC---CCCCCcchhhcccCCCCCCCcccc
Confidence            975532    1222333335567777776777889999998   999999999999999999999653



>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF08732 HIM1: HIM1; InterPro: IPR014843 HIM1 (high induction of mutagenesis protein 1) plays a role in the control of spontaneous and induced mutagenesis [] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
1xq6_A253 X-ray Structure Of Gene Product From Arabidopsis Th 2e-11
>pdb|1XQ6|A Chain A, X-ray Structure Of Gene Product From Arabidopsis Thaliana At5g02240 Length = 253 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 48/152 (31%), Positives = 75/152 (49%), Gaps = 9/152 (5%) Query: 58 PYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALI 117 P ++D+ KN +DAA +A V H ++V S+G P L +L+WKRKAE+ L Sbjct: 105 PEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLG-NGNILVWKRKAEQYLA 163 Query: 118 ASGLPYTIVRPGGMERPTDAYKE---THNITLSQED--TLFGGQVSNLQVAELLACMAKN 172 SG PYTI+R GG+ +E + L Q D T+ V+ + + LL AKN Sbjct: 164 DSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKN 223 Query: 173 RSLSYCKVVEVIAETTAPLTPMEELLAKIPSQ 204 ++ E T+ P + L +++ S+ Sbjct: 224 KAFDLGSKPE---GTSTPTKDFKALFSQVTSR 252

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 2e-41
1xq6_A253 Unknown protein; structural genomics, protein stru 4e-40
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 9e-35
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 3e-34
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 7e-26
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 4e-20
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 1e-13
2wm3_A299 NMRA-like family domain containing protein 1; unkn 4e-13
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 6e-12
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 5e-11
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 5e-11
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 6e-11
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 7e-09
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 2e-08
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 2e-08
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 3e-08
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 8e-08
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 8e-08
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 2e-07
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 5e-07
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 1e-06
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 3e-05
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 4e-04
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
 Score =  145 bits (368), Expect = 2e-41
 Identities = 44/192 (22%), Positives = 81/192 (42%), Gaps = 16/192 (8%)

Query: 12  IQPVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVD 71
           ++     ++V  +LE+      A  +   V+   G+             ID       + 
Sbjct: 61  LRERGASDIVVANLEE--DFSHAFASIDAVVFAAGSGPH--TGADKTILIDLWGAIKTIQ 116

Query: 72  AATIAKVNHFIMVSSLGTNKFGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGM 131
            A    +  FIMVSS+GT     P          L+ KR A++ L  S L YTIVRPG +
Sbjct: 117 EAEKRGIKRFIMVSSVGTVD---PDQGPMNMRHYLVAKRLADDELKRSSLDYTIVRPGPL 173

Query: 132 ERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPL 191
              ++  + T  +T+S   +     ++   VA+++A +   +  +  K  EV+       
Sbjct: 174 ---SNE-ESTGKVTVSPHFSEITRSITRHDVAKVIAELVDQQH-TIGKTFEVLNGD---- 224

Query: 192 TPMEELLAKIPS 203
           TP+ +++ ++ S
Sbjct: 225 TPIAKVVEQLGS 236


>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Length = 287 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Length = 352 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Length = 286 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Length = 289 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.87
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.87
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.87
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.86
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.85
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.85
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.84
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.84
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.84
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.84
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.83
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.83
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.83
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.82
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.82
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.82
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.82
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.82
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.82
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.82
1xq6_A253 Unknown protein; structural genomics, protein stru 99.81
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.81
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.81
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.81
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.8
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.8
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.8
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.8
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.8
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.8
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.8
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.8
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.8
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.79
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.79
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.79
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.79
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.79
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.78
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.78
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.78
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.78
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.78
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.78
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.77
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.77
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.77
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.77
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.76
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.76
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.76
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.76
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.76
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.76
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.76
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.75
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.75
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.75
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.75
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.75
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.75
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.75
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.74
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.74
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.73
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.73
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.73
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.72
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.72
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.71
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.71
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.71
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.71
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.71
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.7
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.7
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.7
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.7
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.7
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.69
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.69
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.69
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.69
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.69
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.69
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.67
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.65
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.64
3mhp_C26 TIC62_peptide, ferredoxin--NADP reductase, LEAF is 99.59
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.58
3mhp_C26 TIC62_peptide, ferredoxin--NADP reductase, LEAF is 99.52
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.47
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.47
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.4
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.4
1spx_A278 Short-chain reductase family member (5L265); paral 99.39
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.38
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.37
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.37
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.36
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.35
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.34
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.34
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.34
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.33
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.33
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.33
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.32
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.32
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.31
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.31
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.31
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.3
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.3
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.3
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.3
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.3
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.29
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.28
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.28
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.28
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.28
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.27
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.27
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.26
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.26
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.25
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.25
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.25
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.25
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.24
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.24
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.24
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.24
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.23
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.23
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.23
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.23
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.23
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.23
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.22
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.22
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.22
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.22
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.22
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.21
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.21
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.21
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.21
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.21
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.2
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.2
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.2
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.2
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.19
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.19
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.19
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.19
3rih_A293 Short chain dehydrogenase or reductase; structural 99.19
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.18
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.18
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.18
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.18
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.18
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.18
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.18
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.17
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.17
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.17
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.17
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.16
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.16
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.16
3cxt_A291 Dehydrogenase with different specificities; rossma 99.16
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.16
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.16
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.16
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.16
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.16
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.15
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.15
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.15
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.15
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.15
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.15
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.15
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.14
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.14
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.14
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.14
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.14
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.13
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.13
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.13
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.13
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.13
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.12
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.12
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.12
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.12
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.12
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.12
4e4y_A244 Short chain dehydrogenase family protein; structur 99.12
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.11
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.11
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.11
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.11
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.11
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.11
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.1
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.1
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.1
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.1
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.1
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.1
1xkq_A280 Short-chain reductase family member (5D234); parra 99.1
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.09
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.09
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.09
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.08
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.08
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.07
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.07
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.07
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.07
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.06
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.06
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.05
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.05
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.05
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.05
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.05
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.05
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.05
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.04
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.04
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.04
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.04
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.04
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.03
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.03
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.03
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.02
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.02
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.02
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.02
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.01
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.01
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.01
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.01
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.0
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 98.99
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.99
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.98
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.98
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.97
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.96
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.96
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.96
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.95
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 98.95
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.95
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 98.94
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.94
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.92
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.92
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 98.92
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.92
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.91
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.9
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.89
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 98.89
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.89
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 98.88
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.88
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.85
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.82
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.81
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.81
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.79
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.76
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.76
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.74
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.74
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.7
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 98.67
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 98.66
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.64
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.63
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 98.59
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.58
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 98.58
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.58
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.51
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 98.5
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 98.41
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.4
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.39
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 98.39
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.38
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.38
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.32
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 98.24
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 98.12
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.08
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 97.88
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 97.79
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 97.7
3slk_A795 Polyketide synthase extender module 2; rossmann fo 97.45
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.41
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.39
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.29
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.14
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 96.61
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.38
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.19
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.03
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 95.86
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.76
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 94.95
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 93.97
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 92.79
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 92.53
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.71
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 89.71
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.85
1lss_A140 TRK system potassium uptake protein TRKA homolog; 88.4
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 87.14
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 87.12
1id1_A153 Putative potassium channel protein; RCK domain, E. 84.54
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 82.64
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 80.46
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 80.02
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
Probab=99.87  E-value=3.3e-21  Score=186.39  Aligned_cols=184  Identities=11%  Similarity=0.013  Sum_probs=153.2

Q ss_pred             CeEEEEcCCCCHhhHHHHhCCCCEEEEcCcCCCCCCCCCCcchhhHHHHHHHHHHHHHhCCCCEEEEeccCcccCCC---
Q 015570           17 MLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFG---   93 (404)
Q Consensus        17 gveiV~gDl~d~~~l~~aL~gvDvVI~~ag~~~~~~~d~~~~~~vnv~~~~~Ll~Aa~~agVkrfI~vSS~gv~~~~---   93 (404)
                      +++++.+|+. .+.+.++++++|+||||++.....  ++...+++|+.++.+|+++|++.+++||||+||.++++..   
T Consensus        43 ~~~~~~~Dl~-~~~~~~~~~~~d~Vih~a~~~~~~--~~~~~~~~n~~~~~~ll~a~~~~~~~r~v~~SS~~vyg~~~~~  119 (311)
T 3m2p_A           43 DYEYRVSDYT-LEDLINQLNDVDAVVHLAATRGSQ--GKISEFHDNEILTQNLYDACYENNISNIVYASTISAYSDETSL  119 (311)
T ss_dssp             CCEEEECCCC-HHHHHHHTTTCSEEEECCCCCCSS--SCGGGTHHHHHHHHHHHHHHHHTTCCEEEEEEEGGGCCCGGGC
T ss_pred             ceEEEEcccc-HHHHHHhhcCCCEEEEccccCCCC--ChHHHHHHHHHHHHHHHHHHHHcCCCEEEEEccHHHhCCCCCC
Confidence            8999999999 999999999999999999987544  6677889999999999999999999999999998886532   


Q ss_pred             --CchhhcccchHHHHHHHHHHHHHHH----CCCCEEEEEcCccCCCCCCcc-----------CcccEEEccCCccccCc
Q 015570           94 --FPAAILNLFWGVLLWKRKAEEALIA----SGLPYTIVRPGGMERPTDAYK-----------ETHNITLSQEDTLFGGQ  156 (404)
Q Consensus        94 --~~~~~~~~~~~y~~sK~~~E~~l~~----~gl~~tIlRpg~~~G~~~~~~-----------~~~~i~~~~~~~~~~~~  156 (404)
                        .+.....+...|+.+|..+|++++.    .|+++++||++++||+.....           ....+.+.+.+...+.+
T Consensus       120 ~~~E~~~~~p~~~Y~~sK~~~E~~~~~~~~~~g~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~  199 (311)
T 3m2p_A          120 PWNEKELPLPDLMYGVSKLACEHIGNIYSRKKGLCIKNLRFAHLYGFNEKNNYMINRFFRQAFHGEQLTLHANSVAKREF  199 (311)
T ss_dssp             SBCTTSCCCCSSHHHHHHHHHHHHHHHHHHHSCCEEEEEEECEEECSCC--CCHHHHHHHHHHTCCCEEESSBCCCCEEE
T ss_pred             CCCCCCCCCCCchhHHHHHHHHHHHHHHHHHcCCCEEEEeeCceeCcCCCCCCHHHHHHHHHHcCCCeEEecCCCeEEce
Confidence              1222345567899999999999986    799999999999999866421           12234454555566789


Q ss_pred             ccHHHHHHHHHHHHhCCCCCCCcEEEEEcCCCCCCccHHHHHHHcccccCCC
Q 015570          157 VSNLQVAELLACMAKNRSLSYCKVVEVIAETTAPLTPMEELLAKIPSQRAEP  208 (404)
Q Consensus       157 Is~~DVA~ai~~~l~~~~~~~~~i~nI~~~~~~~~~si~ell~~i~~~~g~~  208 (404)
                      |+++|+|++++.+++++.  .+++|||++++.   +++.|+++.+.+..|..
T Consensus       200 v~v~Dva~a~~~~~~~~~--~~~~~~i~~~~~---~s~~e~~~~i~~~~g~~  246 (311)
T 3m2p_A          200 LYAKDAAKSVIYALKQEK--VSGTFNIGSGDA---LTNYEVANTINNAFGNK  246 (311)
T ss_dssp             EEHHHHHHHHHHHTTCTT--CCEEEEECCSCE---ECHHHHHHHHHHHTTCT
T ss_pred             EEHHHHHHHHHHHHhcCC--CCCeEEeCCCCc---ccHHHHHHHHHHHhCCC
Confidence            999999999999998875  489999999875   99999999999998854



>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3mhp_C TIC62_peptide, ferredoxin--NADP reductase, LEAF isozyme, chlorop; FNR, oxidoreductase, thylakoid membrane, proton-FLUX, poly P helix; HET: FAD; 1.70A {Pisum sativum} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3mhp_C TIC62_peptide, ferredoxin--NADP reductase, LEAF isozyme, chlorop; FNR, oxidoreductase, thylakoid membrane, proton-FLUX, poly P helix; HET: FAD; 1.70A {Pisum sativum} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 404
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 7e-07
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Biliverdin IX beta reductase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 47.3 bits (111), Expect = 7e-07
 Identities = 22/137 (16%), Positives = 43/137 (31%), Gaps = 13/137 (9%)

Query: 32  EPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNK 91
           +  +     VI  +G           P  +  +  +N+V A     V+  +  +S     
Sbjct: 62  DKTVAGQDAVIVLLGTRNDL-----SPTTVMSEGARNIVAAMKAHGVDKVVACTS--AFL 114

Query: 92  FGFPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGG-MERPTDAYKETHNITLSQED 150
              P  +      V     +  + L  SGL Y  V P    ++P      T   T++ + 
Sbjct: 115 LWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPL-----TGAYTVTLDG 169

Query: 151 TLFGGQVSNLQVAELLA 167
                 +S   +   + 
Sbjct: 170 RGPSRVISKHDLGHFML 186


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.83
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.82
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.81
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.77
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.76
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.76
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.75
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.73
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.72
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.7
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.69
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.68
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.68
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.65
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.64
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.63
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.63
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.62
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.6
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.6
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.59
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.58
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.55
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.55
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.49
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.43
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.42
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.32
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.27
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.24
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 98.88
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.84
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 98.82
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.79
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.78
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.77
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 98.76
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.75
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.73
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.71
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.7
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 98.7
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 98.69
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.66
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.65
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.64
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 98.64
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.64
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.64
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.62
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 98.61
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.61
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.59
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.59
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 98.59
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.5
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.49
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 98.48
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.48
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 98.46
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.46
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.46
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.44
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 98.44
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.43
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 98.43
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.42
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.42
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.4
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.39
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.39
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.37
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.34
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.32
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.3
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.27
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.24
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.19
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.16
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.1
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.06
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.04
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 97.89
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 97.77
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 97.77
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 97.74
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.7
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.5
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 97.47
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.42
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.24
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 97.18
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.11
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.91
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.9
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 96.18
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.4
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 84.08
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.99
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 81.93
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Biliverdin IX beta reductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=6.6e-20  Score=165.51  Aligned_cols=161  Identities=14%  Similarity=0.089  Sum_probs=131.3

Q ss_pred             CCCCeEEEEcCCCCHhhHHHHhCCCCEEEEcCcCCCCCCCCCCcchhhHHHHHHHHHHHHHhCCCCEEEEeccCcccCCC
Q 015570           14 PVEMLELVECDLEKRVQIEPALGNASVVICCIGASEKEVFDITGPYRIDFQATKNLVDAATIAKVNHFIMVSSLGTNKFG   93 (404)
Q Consensus        14 ~~~gveiV~gDl~d~~~l~~aL~gvDvVI~~ag~~~~~~~d~~~~~~vnv~~~~~Ll~Aa~~agVkrfI~vSS~gv~~~~   93 (404)
                      ...+++++.||+.|.+++.++|+++|+||||+|....     ....+++.+++++++++++++|++|||++|+.+++...
T Consensus        44 ~~~~~~~~~gD~~d~~~l~~al~~~d~vi~~~g~~~~-----~~~~~~~~~~~~~l~~aa~~~~v~r~i~~ss~~~~~~~  118 (205)
T d1hdoa_          44 GPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLGTRND-----LSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDP  118 (205)
T ss_dssp             SCCCSEEEESCTTSHHHHHHHHTTCSEEEECCCCTTC-----CSCCCHHHHHHHHHHHHHHHHTCCEEEEECCGGGTSCT
T ss_pred             cccccccccccccchhhHHHHhcCCCEEEEEeccCCc-----hhhhhhhHHHHHHHHHHHHhcCCCeEEEEeeeeccCCC
Confidence            3478999999999999999999999999999987532     23346788999999999999999999999998875432


Q ss_pred             CchhhcccchHHHHHHHHHHHHHHHCCCCEEEEEcCccCCCCCCccCcccEEEccCCccccCcccHHHHHHHHHHHHhCC
Q 015570           94 FPAAILNLFWGVLLWKRKAEEALIASGLPYTIVRPGGMERPTDAYKETHNITLSQEDTLFGGQVSNLQVAELLACMAKNR  173 (404)
Q Consensus        94 ~~~~~~~~~~~y~~sK~~~E~~l~~~gl~~tIlRpg~~~G~~~~~~~~~~i~~~~~~~~~~~~Is~~DVA~ai~~~l~~~  173 (404)
                      .  .....+..|...|..+|+++++.|++||||||++|++..    ..+.+.+..++.....+|+++|||++++.+++++
T Consensus       119 ~--~~~~~~~~~~~~~~~~e~~l~~~~~~~tiirp~~~~~~~----~~~~~~~~~~~~~~~~~i~~~DvA~~~~~~l~~~  192 (205)
T d1hdoa_         119 T--KVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQP----LTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD  192 (205)
T ss_dssp             T--CSCGGGHHHHHHHHHHHHHHHHTCSEEEEECCSEEECCC----CCSCCEEESSSCSSCSEEEHHHHHHHHHHTTSCS
T ss_pred             c--cccccccccchHHHHHHHHHHhcCCceEEEecceecCCC----CcccEEEeeCCCCCCCcCCHHHHHHHHHHHhCCC
Confidence            2  223445678999999999999999999999999998642    2345555555666667899999999999999988


Q ss_pred             CCCCCcEEEEEcC
Q 015570          174 SLSYCKVVEVIAE  186 (404)
Q Consensus       174 ~~~~~~i~nI~~~  186 (404)
                      + +.++.+.+..+
T Consensus       193 ~-~~g~~~~~s~~  204 (205)
T d1hdoa_         193 E-YDGHSTYPSHQ  204 (205)
T ss_dssp             T-TTTCEEEEECC
T ss_pred             C-CCCEEEecCCc
Confidence            7 56788877653



>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure