Citrus Sinensis ID: 015573


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MQTKKKANGRNASREHASPRVSRTVKKGSENVEVPKKKVTELITSSVRKQKSVSVLSNKNEESVAAINLNTRYGLGNEPSGACLEYDSFKKASMDHKDCDEETAPVLQTIFSPTFHVSKVAGGDIASGDAEGANLSSEVSAIYLAMKNSKLECVDEYGQESMTDVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNIREKIAAAVYPPLNSNRGDPFER
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccEEEEEccccEEEcccccccccccEEEEEEccEEEEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEEEcccccEEEEcccEEEcccccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccc
ccccccccccccccccccccccccccccccccccHHcccHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccHcccccHHHHcccccccccccccccccccccccccccEEEEEEccccEEEccccccccccEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHHEHHHHcHHHHHHHHHHHccccccEEEEEEEEccEEEEcccHHHHHHHHcccHccEEEEEccccEEEEcccccccEEcccccccHHHHHHHHHHHHHHcccHcHHHHHHHHHcHHHHHHHHccccccccccccccc
mqtkkkangrnasrehasprvsrtvkkgsenvevpkKKVTELITSSVRKQKSVSVLSNKNEESVAAINLNtryglgnepsgacleydsfkkasmdhkdcdeetapvlqtifsptfhvskvaggdiasgdaeganlSSEVSAIYLAMKNsklecvdeygqesmtdvcmeddeyeefddfdpylfiknlpelssvvptfrpmllpkqtrscppttlvldldetlvhstlepcddadftfpvnfnlqkhtvyvrcrPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVldpkrklfrhrvfrescvfvdgnylKDLSVLGRDlshviivdnspqafgfqvdngipieswfddrsDQELLLLLPFLeslvgvedvrpliVQKFNIREKIAaavypplnsnrgdpfer
mqtkkkangrnasrehasprvsrtvkkgsenvevpkkkvtelitssvrkqksvsvlsnkneesvAAINLNTRYGLGNEPSGACLEYDSFKKASMDHKDCDEETAPVLQTIFSPTFHVSKVAGGDIASGDAEGANLSSEVSAIYLAMKNSKLECVDEYGQESMTDVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFrescvfvdgnyLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNirekiaaavypplnsnrgdpfer
MQTKKKANGRNASREHASPRVSRTVKKGSENVEVPKKKVTELITSSVRKQKSVSVLSNKNEESVAAINLNTRYGLGNEPSGACLEYDSFKKASMDHKDCDEETAPVLQTIFSPTFHVSKVAGGDIASGDAEGANLSSEVSAIYLAMKNSKLECVDEYGQESMTDVCMeddeyeefddfdPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPttlvldldetlvHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQElllllpfleslVGVEDVRPLIVQKFNIREKIAAAVYPPLNSNRGDPFER
****************************************************************AAINLNTRYGLGNE*SGACLEYDSF*************TAPVLQTIFSPTFHVSKVAGGDIA**********SEVSAIYLAMKNSKLECVDEYGQESMTDVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNIREKIAAAVYP************
******************************************************************************************************************************************************************************FDDFDPYLFIKNL********************SCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNIREKI******************
***************************GSENVEVPKKKVTELITSS************KNEESVAAINLNTRYGLGNEPSGACLEYDSFKKASMDHKDCDEETAPVLQTIFSPTFHVSKVAGGDIASGDAEGANLSSEVSAIYLAMKNSKLECVDEYGQESMTDVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNIREKIAAAVYPPLNSNRGDPFER
**************************************************************************LGNEPSGACLEYDS**************TAPVLQ*IFSPTF**********************************************MTDVCME*DEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNIREKIAAAVYPPLN*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTKKKANGRNASREHASPRVSRTVKKGSENVEVPKKKVTELITSSVRKQKSVSVLSNKNEESVAAINLNTRYGLGNEPSGACLEYDSFKKASMDHKDCDEETAPVLQTIFSPTFHVSKVAGGDIASGDAEGANLSSEVSAIYLAMKNSKLECVDEYGQESMTDVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNIREKIAAAVYPPLNSNRGDPFER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query404 2.2.26 [Sep-21-2011]
A4QNX6460 CTD small phosphatase-lik yes no 0.559 0.491 0.567 2e-68
Q54GB2567 CTD small phosphatase-lik yes no 0.514 0.366 0.575 3e-68
Q08BB5469 CTD small phosphatase-lik no no 0.522 0.449 0.577 2e-67
Q5F3Z7466 CTD small phosphatase-lik yes no 0.688 0.596 0.452 2e-67
Q05D32466 CTD small phosphatase-lik yes no 0.522 0.452 0.577 3e-67
Q5XIK8465 CTD small phosphatase-lik yes no 0.522 0.453 0.577 3e-67
Q8BG15465 CTD small phosphatase-lik yes no 0.522 0.453 0.577 3e-67
Q66KM5466 CTD small phosphatase-lik yes no 0.522 0.452 0.577 4e-67
Q801R4466 CTD small phosphatase-lik N/A no 0.522 0.452 0.572 6e-67
Q3KQB6466 CTD small phosphatase-lik N/A no 0.522 0.452 0.572 1e-66
>sp|A4QNX6|CTL2B_DANRE CTD small phosphatase-like protein 2-B OS=Danio rerio GN=ctdspl2b PE=2 SV=1 Back     alignment and function desciption
 Score =  259 bits (663), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/229 (56%), Positives = 171/229 (74%), Gaps = 3/229 (1%)

Query: 157 YGQESMTDVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVL 216
           Y   S+T V  E    EE++ FDPY FIK++P L+    T +P L P +TRS P  +LVL
Sbjct: 229 YVDASIT-VPAEGSYEEEWEVFDPYFFIKHVPPLTEEQLTRKPAL-PLKTRSTPEFSLVL 286

Query: 217 DLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQ 276
           DLDETLVH +L   DDA  TFPV F    + VYVR RP+ ++FLER+S ++EII+FTAS+
Sbjct: 287 DLDETLVHCSLNELDDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQIYEIILFTASK 346

Query: 277 SIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGF 336
            +YA++LLN+LDP+++L RHR+FRE CV V GNY+KDL++LGRDLS  II+DNSPQAF +
Sbjct: 347 KVYADKLLNILDPRKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAY 406

Query: 337 QVDNGIPIESWFDDRSDQELLLLLPFLESLVGV-EDVRPLIVQKFNIRE 384
           Q+ NGIPIESWF DR+D ELL L+PFLE LV + EDVRP + ++F + +
Sbjct: 407 QLSNGIPIESWFMDRNDSELLKLVPFLEKLVELNEDVRPHVRERFRLHD 455




Probable phosphatase.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: -
>sp|Q54GB2|CTSL2_DICDI CTD small phosphatase-like protein 2 OS=Dictyostelium discoideum GN=ctdspl2 PE=3 SV=1 Back     alignment and function description
>sp|Q08BB5|CTL2A_DANRE CTD small phosphatase-like protein 2-A OS=Danio rerio GN=ctdspl2a PE=2 SV=1 Back     alignment and function description
>sp|Q5F3Z7|CTSL2_CHICK CTD small phosphatase-like protein 2 OS=Gallus gallus GN=CTDSPL2 PE=2 SV=2 Back     alignment and function description
>sp|Q05D32|CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens GN=CTDSPL2 PE=1 SV=2 Back     alignment and function description
>sp|Q5XIK8|CTSL2_RAT CTD small phosphatase-like protein 2 OS=Rattus norvegicus GN=Ctdspl2 PE=2 SV=1 Back     alignment and function description
>sp|Q8BG15|CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus GN=Ctdspl2 PE=1 SV=1 Back     alignment and function description
>sp|Q66KM5|CTSL2_XENTR CTD small phosphatase-like protein 2 OS=Xenopus tropicalis GN=ctdspl2 PE=2 SV=1 Back     alignment and function description
>sp|Q801R4|CTL2A_XENLA CTD small phosphatase-like protein 2-A OS=Xenopus laevis GN=ctdspl2-a PE=2 SV=1 Back     alignment and function description
>sp|Q3KQB6|CTL2B_XENLA CTD small phosphatase-like protein 2-B OS=Xenopus laevis GN=ctdspl2-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
449494439446 PREDICTED: CTD small phosphatase-like pr 0.992 0.899 0.678 1e-154
449450582 1024 PREDICTED: uncharacterized protein LOC10 0.957 0.377 0.680 1e-149
255547724455 conserved hypothetical protein [Ricinus 0.995 0.883 0.663 1e-148
326499061415 predicted protein [Hordeum vulgare subsp 0.950 0.925 0.614 1e-132
242072230447 hypothetical protein SORBIDRAFT_06g00101 0.940 0.850 0.563 1e-128
357463015 885 CTD small phosphatase-like protein [Medi 0.965 0.440 0.597 1e-128
357156635411 PREDICTED: CTD small phosphatase-like pr 0.945 0.929 0.593 1e-128
359473746503 PREDICTED: CTD small phosphatase-like pr 0.829 0.666 0.714 1e-128
218194116444 hypothetical protein OsI_14336 [Oryza sa 0.945 0.860 0.565 1e-127
413917758449 hypothetical protein ZEAMMB73_437679 [Ze 0.950 0.855 0.552 1e-126
>gi|449494439|ref|XP_004159546.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 299/441 (67%), Positives = 341/441 (77%), Gaps = 40/441 (9%)

Query: 1   MQTKKKANGRNASREHASPRVSRTVKKGSENVEVPKKKVTELITSSVRKQKSVSVLSNKN 60
           MQTKKK++GRN  RE  SP+V R+ +K SE ++V +K ++ELITSS RK+      S KN
Sbjct: 1   MQTKKKSHGRNTGRELVSPKVLRSQRKYSETLQVVEKNISELITSSARKRTVGCFPSKKN 60

Query: 61  EESVAAINLNTRYG-LGNEPSGACLEYDSFKKASMDHKDCDEETAPVL-QTIFSPTFHVS 118
           EE V   +LN +Y  L NE SGACL++D+   A++  K  D+       +TIFSP+FHVS
Sbjct: 61  EEDVLT-DLNVKYDFLRNETSGACLDHDATDGATLGFKAYDDGVENCASETIFSPSFHVS 119

Query: 119 KVAGGD-----------------------------IASGDAE------GANLSSEVSAIY 143
              GG+                             I  GD +       A LSSEVSAIY
Sbjct: 120 AHDGGEAHNGVEFIKFFQGEDQVFHSDTKLNNSEYIVHGDQDKNYNLGDAGLSSEVSAIY 179

Query: 144 LAMKNSKLECVDEYGQESMT-DVCMEDDEYEEFDDFDPYLFIKNLPELSSVVPTFRPMLL 202
           LAMKNSKLECVDE+  ++M  +V ++DDEYEE DDFDPY FIKNLP LS+VVPT+RPMLL
Sbjct: 180 LAMKNSKLECVDEHAHDTMAAEVHVQDDEYEEIDDFDPYFFIKNLPALSAVVPTYRPMLL 239

Query: 203 PKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLER 262
           PKQTRSCPPTTLVLDLDETLVHSTLEPC DADFTFPVNFNLQ+HTVYVRCRPYL+DF+E 
Sbjct: 240 PKQTRSCPPTTLVLDLDETLVHSTLEPCVDADFTFPVNFNLQEHTVYVRCRPYLRDFMEA 299

Query: 263 VSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLS 322
           V+  FEIIIFTASQSIYAEQLLNVLDPKRK+FRHRVFRESCVFVDGNYLKDLSVLGRDL+
Sbjct: 300 VARHFEIIIFTASQSIYAEQLLNVLDPKRKIFRHRVFRESCVFVDGNYLKDLSVLGRDLA 359

Query: 323 HVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLIVQKFNI 382
            VIIVDNSPQAFGFQVDNGIPIESWFDDRSD+ELLLLLPFLE+LVGVEDVRPLI +KFN+
Sbjct: 360 RVIIVDNSPQAFGFQVDNGIPIESWFDDRSDKELLLLLPFLETLVGVEDVRPLIAKKFNL 419

Query: 383 REKIAAAVYPPLNSNRGDPFE 403
           R+KIAAAVYP LNSNR DPFE
Sbjct: 420 RQKIAAAVYPSLNSNR-DPFE 439




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449450582|ref|XP_004143041.1| PREDICTED: uncharacterized protein LOC101204959 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255547724|ref|XP_002514919.1| conserved hypothetical protein [Ricinus communis] gi|223545970|gb|EEF47473.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|326499061|dbj|BAK06021.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|242072230|ref|XP_002446051.1| hypothetical protein SORBIDRAFT_06g001010 [Sorghum bicolor] gi|241937234|gb|EES10379.1| hypothetical protein SORBIDRAFT_06g001010 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357463015|ref|XP_003601789.1| CTD small phosphatase-like protein [Medicago truncatula] gi|355490837|gb|AES72040.1| CTD small phosphatase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357156635|ref|XP_003577523.1| PREDICTED: CTD small phosphatase-like protein 2-like isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|359473746|ref|XP_002271611.2| PREDICTED: CTD small phosphatase-like protein 2-like [Vitis vinifera] gi|297738449|emb|CBI27650.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|218194116|gb|EEC76543.1| hypothetical protein OsI_14336 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|413917758|gb|AFW57690.1| hypothetical protein ZEAMMB73_437679 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query404
TAIR|locus:2143019305 SSP5 "SCP1-like small phosphat 0.668 0.885 0.710 1.7e-98
ZFIN|ZDB-GENE-061013-647469 ctdspl2a "CTD (carboxy-termina 0.504 0.434 0.495 1.3e-56
DICTYBASE|DDB_G0290365567 ctdspl2 "CTD small phosphatase 0.509 0.363 0.485 4.8e-54
UNIPROTKB|E2QVP8466 CTDSPL2 "Uncharacterized prote 0.504 0.437 0.5 1.3e-53
ZFIN|ZDB-GENE-030131-1809460 ctdspl2b "CTD (carboxy-termina 0.504 0.443 0.5 2e-53
UNIPROTKB|Q5F3Z7466 CTDSPL2 "CTD small phosphatase 0.504 0.437 0.495 6.9e-53
UNIPROTKB|E1B8W1466 CTDSPL2 "Uncharacterized prote 0.504 0.437 0.495 6.9e-53
UNIPROTKB|F6XTC9466 CTDSPL2 "Uncharacterized prote 0.504 0.437 0.495 6.9e-53
UNIPROTKB|Q05D32466 CTDSPL2 "CTD small phosphatase 0.504 0.437 0.495 6.9e-53
MGI|MGI:1196405465 Ctdspl2 "CTD (carboxy-terminal 0.504 0.438 0.495 8.7e-53
TAIR|locus:2143019 SSP5 "SCP1-like small phosphatase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 978 (349.3 bits), Expect = 1.7e-98, P = 1.7e-98
 Identities = 194/273 (71%), Positives = 215/273 (78%)

Query:   134 NLSSEVSAIYLAMKNSKLECVDEYGQESM-TDVCMXXXXXXXXXXXXPYLFIKNLPELSS 192
             NL S VSAIYLAMK+SKLECVDE GQ+S+ T VCM            PYLFIKNLP LSS
Sbjct:    34 NLDS-VSAIYLAMKSSKLECVDERGQDSLITSVCMEDEEDEELDEFDPYLFIKNLPNLSS 92

Query:   193 VVPTFRPMLLPKQTRSCPPXXXXXXXXXXXXHSTLEPCDDADFTFPVNFNLQKHTVYVRC 252
             VVPTFRP+LLPKQTRSCPP            HSTLEPC + DFTFPVNFN ++H VYVRC
Sbjct:    93 VVPTFRPVLLPKQTRSCPPISLVLDLDETLVHSTLEPCGEVDFTFPVNFNEEEHMVYVRC 152

Query:   253 RPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLK 312
             RP+LK+F+ERVS LFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRV+R+SCVF DGNYLK
Sbjct:   153 RPHLKEFMERVSRLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVYRDSCVFFDGNYLK 212

Query:   313 DLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQEXXXXXXXXXXXVGVEDV 372
             DLSVLGRDLS VIIVDNSPQAFGFQV+NG+PIESWF+D SD+E           +GVEDV
Sbjct:   213 DLSVLGRDLSRVIIVDNSPQAFGFQVENGVPIESWFNDPSDKELLHLLPFLESLIGVEDV 272

Query:   373 RPLIVQKFNIREKIAAAVYPP-LNSNRGDPFER 404
             RP+I +KFN+REKI AAV  P   +  GDPFER
Sbjct:   273 RPMIAKKFNLREKIDAAVAAPEYPAEAGDPFER 305




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0016791 "phosphatase activity" evidence=IEA
GO:0000775 "chromosome, centromeric region" evidence=IDA
GO:0005694 "chromosome" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0006470 "protein dephosphorylation" evidence=IDA
GO:0008420 "CTD phosphatase activity" evidence=IDA
GO:0006914 "autophagy" evidence=RCA
ZFIN|ZDB-GENE-061013-647 ctdspl2a "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290365 ctdspl2 "CTD small phosphatase-like protein 2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2QVP8 CTDSPL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1809 ctdspl2b "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3Z7 CTDSPL2 "CTD small phosphatase-like protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B8W1 CTDSPL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6XTC9 CTDSPL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q05D32 CTDSPL2 "CTD small phosphatase-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1196405 Ctdspl2 "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 3e-75
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 6e-71
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 3e-63
COG5190390 COG5190, FCP1, TFIIF-interacting CTD phosphatases, 4e-42
TIGR02250156 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph 2e-22
COG5190 390 COG5190, FCP1, TFIIF-interacting CTD phosphatases, 0.002
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information
 Score =  230 bits (589), Expect = 3e-75
 Identities = 88/160 (55%), Positives = 116/160 (72%), Gaps = 1/160 (0%)

Query: 213 TLVLDLDETLVHSTLEPCD-DADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIII 271
           TLVLDLDETLVHST +    DADF  PV  + +   VYV  RP++ +FLERVS  +E++I
Sbjct: 3   TLVLDLDETLVHSTFKMPKVDADFKVPVLIDGKIIPVYVFKRPHVDEFLERVSKWYELVI 62

Query: 272 FTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSP 331
           FTAS   YA+ +L++LD   K+   R++RESCVF +G Y+KDLS++G+DLS VII+DNSP
Sbjct: 63  FTASLEEYADPVLDILDRGGKVISRRLYRESCVFTNGKYVKDLSLVGKDLSKVIIIDNSP 122

Query: 332 QAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVED 371
            ++  Q DN IPI+SWF D +D ELL L+PFLE L   +D
Sbjct: 123 YSYSLQPDNAIPIKSWFGDPNDTELLNLIPFLEGLRFEDD 162


This model represents the putative phosphatase domain of a family of eukaryotic proteins including "Dullard" , and the NLI interacting factor (NIF)-like phosphatases. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDNxPxxa) and aparrently lacking the last aspartate. This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the pfam03031. Length = 162

>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 404
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 100.0
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 100.0
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 100.0
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.97
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.95
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.95
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.67
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 98.75
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 98.74
PLN02575381 haloacid dehalogenase-like hydrolase 98.68
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.66
PRK13288214 pyrophosphatase PpaX; Provisional 98.62
COG0637221 Predicted phosphatase/phosphohexomutase [General f 98.6
PRK14988224 GMP/IMP nucleotidase; Provisional 98.59
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.56
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 98.56
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 98.55
PRK11587218 putative phosphatase; Provisional 98.52
PRK13226229 phosphoglycolate phosphatase; Provisional 98.51
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.5
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.47
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.46
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.46
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 98.42
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.39
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 98.37
PRK13225273 phosphoglycolate phosphatase; Provisional 98.35
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 98.34
PRK13222226 phosphoglycolate phosphatase; Provisional 98.32
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 98.31
PRK13223272 phosphoglycolate phosphatase; Provisional 98.31
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 98.3
COG4996164 Predicted phosphatase [General function prediction 98.29
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 98.28
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 98.28
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.26
PLN02940 382 riboflavin kinase 98.23
PHA03398303 viral phosphatase superfamily protein; Provisional 98.22
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 98.21
PRK10563221 6-phosphogluconate phosphatase; Provisional 98.2
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 98.19
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.17
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.17
PHA02597197 30.2 hypothetical protein; Provisional 98.14
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 98.06
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 98.0
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 98.0
PHA02530300 pseT polynucleotide kinase; Provisional 97.99
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.97
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 97.93
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.84
COG0546220 Gph Predicted phosphatases [General function predi 97.83
PRK06769173 hypothetical protein; Validated 97.82
PLN02770248 haloacid dehalogenase-like hydrolase family protei 97.78
PRK13582205 thrH phosphoserine phosphatase; Provisional 97.72
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.67
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 97.67
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.58
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 97.58
PLN02954224 phosphoserine phosphatase 97.55
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 97.5
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 97.48
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 97.45
PRK09449224 dUMP phosphatase; Provisional 97.45
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.42
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.4
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 97.37
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 97.36
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.35
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 97.22
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 97.17
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 97.09
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 97.09
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 97.07
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 97.04
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 97.03
PLN02779286 haloacid dehalogenase-like hydrolase family protei 97.03
PRK11133322 serB phosphoserine phosphatase; Provisional 97.01
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 96.98
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 96.97
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 96.9
PRK08238 479 hypothetical protein; Validated 96.88
PLN02811220 hydrolase 96.84
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.77
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 96.69
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 96.63
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 96.62
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.6
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 96.47
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 96.17
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 96.03
COG0241181 HisB Histidinol phosphatase and related phosphatas 95.94
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 95.92
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.92
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 95.83
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 95.74
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 95.72
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.72
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 95.52
PRK01158230 phosphoglycolate phosphatase; Provisional 95.5
PRK10748238 flavin mononucleotide phosphatase; Provisional 95.48
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 95.47
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 95.36
PRK10513270 sugar phosphate phosphatase; Provisional 95.35
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 95.23
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 95.2
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 95.12
PRK10976266 putative hydrolase; Provisional 95.12
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 95.07
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 95.04
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 95.03
PTZ00445219 p36-lilke protein; Provisional 94.98
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 94.86
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 94.76
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 94.35
PRK10444248 UMP phosphatase; Provisional 94.19
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 94.08
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 94.06
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 93.89
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 93.72
PTZ00174247 phosphomannomutase; Provisional 93.71
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 93.68
PLN02645 311 phosphoglycolate phosphatase 93.41
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 93.26
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 93.11
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 92.93
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 92.65
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 92.65
PLN02887 580 hydrolase family protein 92.62
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 92.24
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 91.95
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 91.84
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 91.83
PLN02423245 phosphomannomutase 91.04
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 90.11
COG0647269 NagD Predicted sugar phosphatases of the HAD super 90.09
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 89.7
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 89.51
TIGR01675229 plant-AP plant acid phosphatase. This model explic 89.27
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 88.77
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 86.43
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 86.42
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 86.23
COG4359220 Uncharacterized conserved protein [Function unknow 84.72
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 84.55
COG2503274 Predicted secreted acid phosphatase [General funct 84.41
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 83.86
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 83.83
PLN03017366 trehalose-phosphatase 83.77
PLN02770248 haloacid dehalogenase-like hydrolase family protei 83.31
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 82.93
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 82.28
PRK11590211 hypothetical protein; Provisional 81.96
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 81.44
PLN02151354 trehalose-phosphatase 81.36
PRK10748238 flavin mononucleotide phosphatase; Provisional 81.06
PLN02779286 haloacid dehalogenase-like hydrolase family protei 80.78
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
Probab=100.00  E-value=4.7e-48  Score=374.22  Aligned_cols=181  Identities=59%  Similarity=1.007  Sum_probs=173.2

Q ss_pred             CCCCCCCCCCCcEEEEeCCccccccc--cCCCCCCCccceeeeccccceEEEEecCcHHHHHHHhhccceEEEEcCCchH
Q 015573          201 LLPKQTRSCPPTTLVLDLDETLVHST--LEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSI  278 (404)
Q Consensus       201 lLP~~~~~~~kktLVLDLDeTLVhS~--~~~~~~~d~~~~v~~~~~~~~~~V~~RPgl~eFL~~Ls~~yEIvIfTAs~k~  278 (404)
                      ++|......+|+|||||||||||||+  .++...+++.+++.+....+.+||.+|||+++||+.++++||++||||+...
T Consensus        79 ~~~~~~~~~~kk~lVLDLDeTLvHss~~~~~~~~~d~~~~v~~~~~~~~~yV~kRP~vdeFL~~~s~~~e~v~FTAs~~~  158 (262)
T KOG1605|consen   79 VLPLRLATVGRKTLVLDLDETLVHSSLNLKPIVNADFTVPVEIDGHIHQVYVRKRPHVDEFLSRVSKWYELVLFTASLEV  158 (262)
T ss_pred             cCCcccccCCCceEEEeCCCcccccccccCCCCCcceeeeeeeCCcceEEEEEcCCCHHHHHHHhHHHHHHHHHHhhhHH
Confidence            45666667889999999999999999  6777789999999999889999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCeeeEEEEecceeeecCceeecccccCCCCCcEEEEECCccccccccccccccccccCCCCcHHHHh
Q 015573          279 YAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLL  358 (404)
Q Consensus       279 YA~~VLd~LDP~~~lF~~rL~Rd~C~~~~g~yvKDLs~Lgrdls~vIIVDDsp~s~~~qp~NgI~I~~f~gd~~D~eLl~  358 (404)
                      ||.+|++.||+.+++|++|+||++|....|+|+|||+.+|+|+++||||||+|.+|.+||+|||||++|++|+.|+||++
T Consensus       159 Ya~~v~D~LD~~~~i~~~RlyR~~C~~~~g~yvKdls~~~~dL~~viIiDNsP~sy~~~p~NgIpI~sw~~d~~D~eLL~  238 (262)
T KOG1605|consen  159 YADPLLDILDPDRKIISHRLYRDSCTLKDGNYVKDLSVLGRDLSKVIIVDNSPQSYRLQPENGIPIKSWFDDPTDTELLK  238 (262)
T ss_pred             HHHHHHHHccCCCCeeeeeecccceEeECCcEEEEcceeccCcccEEEEcCChHHhccCccCCCcccccccCCChHHHHH
Confidence            99999999999888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhccCCCCchHHHHhhhc
Q 015573          359 LLPFLESLVGVEDVRPLIVQKFN  381 (404)
Q Consensus       359 LlpfLe~L~~~~DVR~vL~~~f~  381 (404)
                      |+|||+.|+.++|||++++++|+
T Consensus       239 LlpfLe~L~~~~Dvr~~l~~~~~  261 (262)
T KOG1605|consen  239 LLPFLEALAFVDDVRPILARRFG  261 (262)
T ss_pred             HHHHHHHhcccccHHHHHHHhhc
Confidence            99999999999999999999885



>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
2hhl_A195 Crystal Structure Of The Human Small Ctd Phosphatas 2e-34
1ta0_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 5e-34
3l0y_A184 Crystal Structure Of Scp1 Phosphatase D98a Mutant L 7e-34
2ghq_A181 Ctd-Specific Phosphatase Scp1 In Complex With Pepti 9e-34
3pgl_A180 Crystal Structure Of Human Small C-Terminal Domain 1e-33
2q5e_A187 Crystal Structure Of Human Carboxy-Terminal Domain 2e-33
1t9z_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 3e-33
3l0b_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 5e-33
3l0c_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 6e-33
3qle_A204 Structural Basis For The Function Of Tim50 In The M 2e-18
3ef1_A 442 The Structure Of Fcp1, An Essential Rna Polymerase 3e-07
3ef0_A 372 The Structure Of Fcp1, An Essential Rna Polymerase 5e-07
>pdb|2HHL|A Chain A, Crystal Structure Of The Human Small Ctd Phosphatase 3 Isoform 1 Length = 195 Back     alignment and structure

Iteration: 1

Score = 143 bits (360), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 68/132 (51%), Positives = 96/132 (72%), Gaps = 1/132 (0%) Query: 224 HSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQL 283 HS+ +P +ADF PV + H VYV RP++ +FL+R+ LFE ++FTAS + YA+ + Sbjct: 41 HSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPV 100 Query: 284 LNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIP 343 ++LD + +FR R+FRESCVF GNY+KDLS LGR+LS VIIVDNSP ++ F +N +P Sbjct: 101 ADLLD-RWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVP 159 Query: 344 IESWFDDRSDQE 355 ++SWFDD +D E Sbjct: 160 VQSWFDDMTDTE 171
>pdb|1TA0|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein With Associated Ligand Length = 197 Back     alignment and structure
>pdb|3L0Y|A Chain A, Crystal Structure Of Scp1 Phosphatase D98a Mutant Length = 184 Back     alignment and structure
>pdb|2GHQ|A Chain A, Ctd-Specific Phosphatase Scp1 In Complex With Peptide C- Terminal Domain Of Rna Polymerase Ii Length = 181 Back     alignment and structure
>pdb|3PGL|A Chain A, Crystal Structure Of Human Small C-Terminal Domain Phosphatase 1 (Scp1) Bound To Rabeprazole Length = 180 Back     alignment and structure
>pdb|2Q5E|A Chain A, Crystal Structure Of Human Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 Length = 187 Back     alignment and structure
>pdb|1T9Z|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein Length = 197 Back     alignment and structure
>pdb|3L0B|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant Phosphory Intermediate Length = 184 Back     alignment and structure
>pdb|3L0C|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant With Trap Inorganic Phosphate Length = 184 Back     alignment and structure
>pdb|3QLE|A Chain A, Structural Basis For The Function Of Tim50 In The Mitochondrial Presequence Translocase Length = 204 Back     alignment and structure
>pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 Back     alignment and structure
>pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query404
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 9e-90
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 2e-88
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 3e-78
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 6e-49
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 5e-47
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 2e-44
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
 Score =  268 bits (687), Expect = 9e-90
 Identities = 87/195 (44%), Positives = 125/195 (64%), Gaps = 3/195 (1%)

Query: 182 LFIKNLPELSSVVPTFRPMLLPKQTRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNF 241
           + ++ +  + S  P  + +L            +V+DLDETLVHS+ +P  +ADF  PV  
Sbjct: 1   MSLRQVIPIPS--PPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEI 58

Query: 242 NLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRE 301
           +   H VYV  RP++ +FL+R+  LFE ++FTAS + YA+ + ++LD    +FR R+FRE
Sbjct: 59  DGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRW-GVFRARLFRE 117

Query: 302 SCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLP 361
           SCVF  GNY+KDLS LGR+LS VIIVDNSP ++ F  +N +P++SWFDD +D ELL L+P
Sbjct: 118 SCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIP 177

Query: 362 FLESLVGVEDVRPLI 376
           F E L   +D     
Sbjct: 178 FFEGLSREDDEGHHH 192


>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 100.0
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.98
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.97
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.77
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.74
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.73
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.7
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.64
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.6
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.54
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.52
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.48
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.45
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.45
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.45
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.44
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.41
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 98.41
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 98.4
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.39
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.38
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.38
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.38
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.37
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.36
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.35
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.35
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.34
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.31
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.3
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.29
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.29
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 98.27
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.27
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.26
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.21
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.19
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.17
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.15
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.15
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 98.15
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 98.14
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 98.11
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.08
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.07
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.05
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.05
2o2x_A218 Hypothetical protein; structural genomics, joint c 98.04
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.03
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.0
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.99
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 97.98
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 97.98
3fvv_A232 Uncharacterized protein; unknown function, structu 97.97
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 97.96
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 97.96
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.92
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 97.92
3mmz_A176 Putative HAD family hydrolase; structural genomics 97.9
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 97.88
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 97.88
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.85
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 97.83
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 97.79
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 97.77
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.76
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 97.72
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.7
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 97.68
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.54
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 97.47
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.43
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 97.38
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 97.38
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 97.35
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.29
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 97.28
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 97.26
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 97.24
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 97.22
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 97.2
2zg6_A220 Putative uncharacterized protein ST2620, probable 97.19
2hsz_A243 Novel predicted phosphatase; structural genomics, 97.1
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 97.07
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 96.99
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 96.92
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 96.86
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 96.78
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 96.76
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 96.76
1te2_A226 Putative phosphatase; structural genomics, phospha 96.67
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 96.62
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 96.61
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 96.56
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 96.42
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 96.39
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 96.32
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 96.3
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 96.29
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 96.2
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 96.18
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.17
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.16
1l6r_A227 Hypothetical protein TA0175; structural genomics, 96.06
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 96.01
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 96.0
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 95.92
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 95.91
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 95.83
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 95.8
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 95.75
2p11_A231 Hypothetical protein; putative haloacid dehalogena 95.68
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 95.57
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 95.53
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 95.48
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 95.41
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 95.36
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 95.21
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 95.14
3dao_A283 Putative phosphatse; structural genomics, joint ce 95.12
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 95.11
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 95.08
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 94.98
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 94.83
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 94.82
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 94.77
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 94.6
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 94.45
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 94.45
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 94.28
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 94.26
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 94.18
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 94.13
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 94.11
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 94.08
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 94.07
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 94.03
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 94.01
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 94.0
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 92.81
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 93.61
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 93.48
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 93.46
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 92.72
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 92.47
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 90.99
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 90.63
2p11_A231 Hypothetical protein; putative haloacid dehalogena 87.27
2hsz_A243 Novel predicted phosphatase; structural genomics, 87.12
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 86.57
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 86.19
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 86.17
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 85.82
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 85.65
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 85.54
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 85.18
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 85.05
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 84.82
1te2_A226 Putative phosphatase; structural genomics, phospha 84.57
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 84.45
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 84.39
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 84.35
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 83.61
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 83.41
2zg6_A220 Putative uncharacterized protein ST2620, probable 82.48
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 82.25
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 80.57
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
Probab=100.00  E-value=1.7e-44  Score=337.59  Aligned_cols=158  Identities=39%  Similarity=0.679  Sum_probs=146.9

Q ss_pred             CCCCcEEEEeCCccccccccCCCCCCCccceeeeccccceEEEEecCcHHHHHHHhhccceEEEEcCCchHHHHHHHHHh
Q 015573          208 SCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIYAEQLLNVL  287 (404)
Q Consensus       208 ~~~kktLVLDLDeTLVhS~~~~~~~~d~~~~v~~~~~~~~~~V~~RPgl~eFL~~Ls~~yEIvIfTAs~k~YA~~VLd~L  287 (404)
                      .++++||||||||||||+.+.+               .++++|.+|||+++||++|+++|||+||||+.+.||++|++.|
T Consensus        31 ~~~~~tLVLDLDeTLvh~~~~~---------------~~~~~v~~RPgl~eFL~~l~~~yeivI~Tas~~~ya~~vl~~L   95 (204)
T 3qle_A           31 YQRPLTLVITLEDFLVHSEWSQ---------------KHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKL   95 (204)
T ss_dssp             -CCSEEEEEECBTTTEEEEEET---------------TTEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHT
T ss_pred             cCCCeEEEEeccccEEeeeccc---------------cCceeEEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHh
Confidence            4678999999999999998742               3568999999999999999999999999999999999999999


Q ss_pred             CCCCCeeeEEEEecceeeecCceeecccccCCCCCcEEEEECCccccccccccccccccccCCCCcHHHHhHHHHHhhcc
Q 015573          288 DPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLV  367 (404)
Q Consensus       288 DP~~~lF~~rL~Rd~C~~~~g~yvKDLs~Lgrdls~vIIVDDsp~s~~~qp~NgI~I~~f~gd~~D~eLl~LlpfLe~L~  367 (404)
                      ||.+.+|+++|+|++|....|.|+|||+.||+++++||||||+|.+|.+||+|||+|++|.|++ |+||++|+|||+.|+
T Consensus        96 Dp~~~~f~~rl~R~~c~~~~g~y~KdL~~Lgrdl~~vIiIDDsp~~~~~~p~N~I~I~~~~~~~-D~eL~~L~~~L~~L~  174 (204)
T 3qle_A           96 DPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEA-DDKLVRLIPFLEYLA  174 (204)
T ss_dssp             STTCSSEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEEESCTTTTTTCGGGEEECCCCCSSC-CCHHHHHHHHHHHHH
T ss_pred             CCCCCeEEEEEEecceeEECCeeeecHHHhCCChHHEEEEECCHHHHhhCccCceEeeeECCCC-ChhHHHHHHHHHHHh
Confidence            9998899999999999999999999999999999999999999999999999999999999875 669999999999997


Q ss_pred             --CCCCchHHHHhhhc
Q 015573          368 --GVEDVRPLIVQKFN  381 (404)
Q Consensus       368 --~~~DVR~vL~~~f~  381 (404)
                        .++|||++|++...
T Consensus       175 ~~~~~DVR~~L~~~~~  190 (204)
T 3qle_A          175 TQQTKDVRPILNSFED  190 (204)
T ss_dssp             HTCCSCSHHHHTTSSC
T ss_pred             hcChHHHHHHHHHhcC
Confidence              68999999986443



>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 404
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 5e-62
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  196 bits (498), Expect = 5e-62
 Identities = 88/177 (49%), Positives = 121/177 (68%), Gaps = 2/177 (1%)

Query: 201 LLPKQ-TRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDF 259
           LLP+   +      +V+DLDETLVHS+ +P ++ADF  PV  +   H VYV  RP++ +F
Sbjct: 4   LLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEF 63

Query: 260 LERVSSLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGR 319
           L+R+  LFE ++FTAS + YA+ + ++LD     FR R+FRESCVF  GNY+KDLS LGR
Sbjct: 64  LQRMGELFECVLFTASLAKYADPVADLLDKWGA-FRARLFRESCVFHRGNYVKDLSRLGR 122

Query: 320 DLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLLLPFLESLVGVEDVRPLI 376
           DL  V+I+DNSP ++ F  DN +P+ SWFD+ SD EL  LLPF E L  V+DV  ++
Sbjct: 123 DLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVL 179


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query404
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.01
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.76
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 98.71
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.7
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.61
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.6
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 98.55
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.5
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.4
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.38
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 98.35
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 98.31
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.24
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 98.22
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 98.21
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.18
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 98.12
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 98.03
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 98.0
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 97.99
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 97.97
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.79
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 97.69
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.69
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 97.58
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.41
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 97.04
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 96.8
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 96.72
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 96.45
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 96.32
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 96.17
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 96.16
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 96.02
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 95.93
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 95.85
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 95.78
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 95.72
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 95.68
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 95.41
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 95.41
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 95.25
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 95.2
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 94.61
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 94.58
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 94.51
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 94.06
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 90.93
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 90.51
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 89.57
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 86.39
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.5e-47  Score=343.48  Aligned_cols=177  Identities=50%  Similarity=0.863  Sum_probs=166.0

Q ss_pred             CCCCC-CCCCCCcEEEEeCCccccccccCCCCCCCccceeeeccccceEEEEecCcHHHHHHHhhccceEEEEcCCchHH
Q 015573          201 LLPKQ-TRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLQKHTVYVRCRPYLKDFLERVSSLFEIIIFTASQSIY  279 (404)
Q Consensus       201 lLP~~-~~~~~kktLVLDLDeTLVhS~~~~~~~~d~~~~v~~~~~~~~~~V~~RPgl~eFL~~Ls~~yEIvIfTAs~k~Y  279 (404)
                      ++|++ +...+|+|||||||||||||+..+....++.+.+.+......+||++|||+++||++|+++|||+|||||++.|
T Consensus         4 llp~~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~Y   83 (181)
T d1ta0a_           4 LLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKY   83 (181)
T ss_dssp             SSCCCCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHHH
T ss_pred             cCCCCCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHHH
Confidence            34543 34567999999999999999998888888888888888888999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCeeeEEEEecceeeecCceeecccccCCCCCcEEEEECCccccccccccccccccccCCCCcHHHHhH
Q 015573          280 AEQLLNVLDPKRKLFRHRVFRESCVFVDGNYLKDLSVLGRDLSHVIIVDNSPQAFGFQVDNGIPIESWFDDRSDQELLLL  359 (404)
Q Consensus       280 A~~VLd~LDP~~~lF~~rL~Rd~C~~~~g~yvKDLs~Lgrdls~vIIVDDsp~s~~~qp~NgI~I~~f~gd~~D~eLl~L  359 (404)
                      |++|++.|||++ .|.+++||++|....+.|+|||+.+|+++++||||||++.+|..||+|||+|++|+|+++|+||+.|
T Consensus        84 A~~il~~ldp~~-~~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~~~~~D~eL~~l  162 (181)
T d1ta0a_          84 ADPVADLLDKWG-AFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDL  162 (181)
T ss_dssp             HHHHHHHHCSSC-CEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCSSCTTCCHHHHH
T ss_pred             HHHHHHHhccCC-ceeEEEEeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcCCCCCcHHHHHH
Confidence            999999999987 6779999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhccCCCCchHHHHh
Q 015573          360 LPFLESLVGVEDVRPLIVQ  378 (404)
Q Consensus       360 lpfLe~L~~~~DVR~vL~~  378 (404)
                      ++||+.|+.++|||++|++
T Consensus       163 ~~~L~~l~~~~DVR~~l~~  181 (181)
T d1ta0a_         163 LPFFEQLSRVDDVYSVLRQ  181 (181)
T ss_dssp             HHHHHHHTTCSCHHHHHCC
T ss_pred             HHHHHHHccCCcHHHHhcC
Confidence            9999999999999999974



>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure