Citrus Sinensis ID: 015668


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400---
MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEQIMFCL
ccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEcccccEEEEccccccccEEccEEEcccccccEEEEEEEEEEcccccccccccccccEEEEEEEcccccccccccccccEEEcccccEEEcccccccccccccccEEEEEEEcccccccEEEEEEcccccccEEcccccccccccccccHHccccccccEEEEEEccEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccEEEEccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHcccccccEEEEEEEEccHHHHHHHHHHHHHHcccccccccc
cccHccccccccccccccHHHHccccccccccccccccccccEEEEcccccccEEEEccccccccccccccHHHHHHcccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEcccccccccccccccccccccccEcccccccccccccccccEEEEEEEcccccEEEEEEEEccccccEEEEEccccccccccccccHHHHcccccccEEEEEcEEEEEEcccccccccccccEEEEccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEccHHHHHHHccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHcccccccEEEEEEEccHHHHHHHHHHHHHHcccccEEEEc
matakrelelpdgdkpesvvkkakvddpvsdssasgprsqkqrvvlnpadcdldfdiednglkssglhqegfaycwsgaranvginggkycfgckivstqpvdmedtppdqqhvcrvgtsrgddpvgklgeteqsfgfggtgkfshggnflnfgekfgvgDTIICAIdleskplatigfakngkwlgtakqfdagsnglgvvdsavkerqcesavfphiLLKNVVVVMQFSVeqglipvegYKSWVSAlddgnsvlgptfcnmkdCEVMMMvglpasgkttwAEKWvkdhpekrYILLGTNLILEQmkvpgllrkhnYSERFQCLMGRANAIFDVLLSrasrtprnfiidqTNVFKSARKRKLRLFVNFRKIAVvvfpkpedlkIRSVKRFKEMGKEQIMFCL
matakrelelpdgdkpesvvkkakvddpvsdssasgprsqkqrvVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRAsrtprnfiidqtnvfksarKRKLRLFVnfrkiavvvfpkpedlkirsvKRFKEMGKEQIMFCL
MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSfgfggtgkfshggnfLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEQIMFCL
********************************************VLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVST************************************FGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKR*************
****************************************KQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWV************************MVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKV**********ERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPE***************EQIMFCL
*****************************************QRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEQIMFCL
***************************************QKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEQIMFCL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKEQIMFCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query403 2.2.26 [Sep-21-2011]
Q8VDM6 859 Heterogeneous nuclear rib yes no 0.836 0.392 0.395 3e-63
Q9BUJ2 856 Heterogeneous nuclear rib no no 0.836 0.393 0.392 5e-63
Q00839 825 Heterogeneous nuclear rib no no 0.838 0.409 0.356 6e-49
Q8VEK3 800 Heterogeneous nuclear rib no no 0.838 0.422 0.353 1e-48
Q00PI9 745 Heterogeneous nuclear rib no no 0.779 0.421 0.351 1e-46
Q1KMD3 747 Heterogeneous nuclear rib no no 0.779 0.420 0.348 9e-46
Q55CP6 765 Probable ATP-dependent RN yes no 0.394 0.207 0.260 2e-09
Q5XH91 740 ATP-dependent RNA helicas no no 0.429 0.233 0.320 4e-07
A2VD92 740 ATP-dependent RNA helicas N/A no 0.429 0.233 0.316 4e-06
Q90WU3 740 ATP-dependent RNA helicas no no 0.496 0.270 0.308 2e-05
>sp|Q8VDM6|HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus GN=Hnrnpul1 PE=1 SV=1 Back     alignment and function desciption
 Score =  243 bits (619), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/359 (39%), Positives = 201/359 (55%), Gaps = 22/359 (6%)

Query: 44  VVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPV- 102
           V ++  +CDL F +  +      L  EGFAY WSGARA+ G+  G+ CF  KI     V 
Sbjct: 212 VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVK 271

Query: 103 DMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDT 162
            +  T PD  HV R+G S  D    +LGE   S+G+GGTGK S    F N+G+KF   D 
Sbjct: 272 HLPSTEPDP-HVVRIGWSL-DSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDV 329

Query: 163 IICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLK 222
           I C  D E      + F KNGKW+G A  F      LG             A++PH+L+K
Sbjct: 330 IGCFADFECGNDVELSFTKNGKWMGIA--FRIQKEALGG-----------QALYPHVLVK 376

Query: 223 NVVVVMQFSVEQ----GLIPVEGYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASG 278
           N  V   F         ++P   +   +   +     +GP   +  +CE++MMVGLPA+G
Sbjct: 377 NCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTIGPK--SKAECEILMMVGLPAAG 434

Query: 279 KTTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLS 338
           KTTWA K    +P K+Y +LGTN I+++M+V GL R+ NY+ R+  L+ +A    + L+ 
Sbjct: 435 KTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQ 494

Query: 339 RASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKE 397
            A+R  RN+I+DQTNV+ SA++RK+R F  F++ A+V+ P  EDLK R+VKR  E GK+
Sbjct: 495 IAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKD 553




Acts as a basic transcriptional regulator. Represses basic transcription driven by several virus and cellular promoters. When associated with BRD7, activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Plays also a role in mRNA processing and transport. Binds avidly to poly(G) and poly(C) RNA homopolymers in vitro.
Mus musculus (taxid: 10090)
>sp|Q9BUJ2|HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens GN=HNRNPUL1 PE=1 SV=2 Back     alignment and function description
>sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 Back     alignment and function description
>sp|Q8VEK3|HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus GN=Hnrnpu PE=1 SV=1 Back     alignment and function description
>sp|Q00PI9|HNRL2_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Mus musculus GN=Hnrnpul2 PE=1 SV=2 Back     alignment and function description
>sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1 Back     alignment and function description
>sp|Q55CP6|DDX1_DICDI Probable ATP-dependent RNA helicase ddx1 OS=Dictyostelium discoideum GN=ddx1 PE=3 SV=1 Back     alignment and function description
>sp|Q5XH91|DDX1_XENTR ATP-dependent RNA helicase DDX1 OS=Xenopus tropicalis GN=ddx1 PE=2 SV=1 Back     alignment and function description
>sp|A2VD92|DDX1_XENLA ATP-dependent RNA helicase DDX1 OS=Xenopus laevis GN=ddx1 PE=2 SV=1 Back     alignment and function description
>sp|Q90WU3|DDX1_CHICK ATP-dependent RNA helicase DDX1 OS=Gallus gallus GN=DDX1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
302144182 703 unnamed protein product [Vitis vinifera] 0.962 0.551 0.707 1e-168
359495485 590 PREDICTED: heterogeneous nuclear ribonuc 0.962 0.657 0.707 1e-167
147827160 1021 hypothetical protein VITISV_016567 [Viti 0.962 0.380 0.707 1e-167
359495491 514 PREDICTED: heterogeneous nuclear ribonuc 0.962 0.754 0.707 1e-167
302144178 1459 unnamed protein product [Vitis vinifera] 0.923 0.254 0.685 1e-158
449457692 595 PREDICTED: heterogeneous nuclear ribonuc 0.888 0.601 0.715 1e-157
449488411 595 PREDICTED: heterogeneous nuclear ribonuc 0.962 0.652 0.662 1e-156
90265186 717 H0410G08.12 [Oryza sativa Indica Group] 0.895 0.503 0.685 1e-150
356557660 517 PREDICTED: heterogeneous nuclear ribonuc 0.875 0.682 0.708 1e-150
414585252 882 TPA: putative SPRY-domain family protein 0.945 0.431 0.640 1e-148
>gi|302144182|emb|CBI23309.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 281/397 (70%), Positives = 329/397 (82%), Gaps = 9/397 (2%)

Query: 1   MATAKRELELPDGDKPESVVKKAKVDDPVSDSSASGPRSQKQRVVLNPADCDLDFDIEDN 60
           MA+ KR+L  P+  +PES   KA + D       S     KQRVVLNPADCDLDF+I  +
Sbjct: 1   MASIKRQLSEPE--EPESKKPKAVLSD-------SPEHKTKQRVVLNPADCDLDFNIVGD 51

Query: 61  GLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTS 120
           GL+ S LH  GFAYCWSGAR NVGI GGKYCFGCKI+STQPVDMEDTPPDQQHVCR+G S
Sbjct: 52  GLQGSALHDHGFAYCWSGARGNVGITGGKYCFGCKIISTQPVDMEDTPPDQQHVCRLGIS 111

Query: 121 RGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFA 180
           RGDD VG LGETE SFGFGGTGKFS  G F N+GEKFGVGDTI+CA++LE+KPLA+I F+
Sbjct: 112 RGDDAVGNLGETEHSFGFGGTGKFSVAGKFSNYGEKFGVGDTIVCAVNLETKPLASISFS 171

Query: 181 KNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKNVVVVMQFSVEQGLIPVE 240
           KNGKWLG AK+FDAG  GLGVVDS +++   ESA+FPH+LLKNV+V +QFS E+GL+P E
Sbjct: 172 KNGKWLGVAKEFDAGVKGLGVVDSPMRQLHWESALFPHVLLKNVMVQVQFSTEEGLVPEE 231

Query: 241 GYKSWVSALDDGNSVLGPTFCNMKDCEVMMMVGLPASGKTTWAEKWVKDHPEKRYILLGT 300
           GYK W SAL DGN+++GP+F + +DCEVMMMVGLPASGK+TWAEKWVK+H EKRY+LLGT
Sbjct: 232 GYKPWASALYDGNAIMGPSFSSPRDCEVMMMVGLPASGKSTWAEKWVKEHAEKRYVLLGT 291

Query: 301 NLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSRASRTPRNFIIDQTNVFKSARK 360
           NL L+QMKVPGLLRK NY ERF+ LM RA  IF+ LLSRAS+TP N+IIDQTNV+K+ARK
Sbjct: 292 NLALDQMKVPGLLRKQNYGERFERLMDRATGIFNTLLSRASKTPHNYIIDQTNVYKNARK 351

Query: 361 RKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKE 397
           RKL+ F NF+KIAVV+FPKPE+LK R+ KRFKEMGKE
Sbjct: 352 RKLKPFANFQKIAVVLFPKPEELKFRAEKRFKEMGKE 388




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359495485|ref|XP_002271342.2| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147827160|emb|CAN66470.1| hypothetical protein VITISV_016567 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495491|ref|XP_003635003.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302144178|emb|CBI23305.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457692|ref|XP_004146582.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449488411|ref|XP_004158025.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|90265186|emb|CAH67657.1| H0410G08.12 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|356557660|ref|XP_003547133.1| PREDICTED: heterogeneous nuclear ribonucleoprotein U-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|414585252|tpg|DAA35823.1| TPA: putative SPRY-domain family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query403
ZFIN|ZDB-GENE-040426-2432 784 hnrnpul1 "heterogeneous nuclea 0.836 0.429 0.399 1.2e-56
UNIPROTKB|J9JHA9 756 HNRNPUL1 "Uncharacterized prot 0.833 0.444 0.383 1.6e-54
UNIPROTKB|B7Z4B8 767 HNRNPUL1 "cDNA FLJ56481, highl 0.833 0.438 0.383 1.6e-54
UNIPROTKB|E2RNY1 856 HNRNPUL1 "Uncharacterized prot 0.833 0.392 0.383 4.5e-54
UNIPROTKB|Q9BUJ2 856 HNRNPUL1 "Heterogeneous nuclea 0.833 0.392 0.383 4.5e-54
UNIPROTKB|A4FUC2 858 HNRNPUL1 "Uncharacterized prot 0.833 0.391 0.383 4.6e-54
MGI|MGI:2443517 859 Hnrnpul1 "heterogeneous nuclea 0.833 0.391 0.386 4.6e-54
RGD|1307456 859 Hnrnpul1 "heterogeneous nuclea 0.833 0.391 0.383 7.7e-54
ZFIN|ZDB-GENE-030131-6422 796 hnrnpub "heterogeneous nuclear 0.836 0.423 0.341 1.2e-47
UNIPROTKB|F1Q3W0 783 HNRNPU "Uncharacterized protei 0.836 0.430 0.355 3.4e-47
ZFIN|ZDB-GENE-040426-2432 hnrnpul1 "heterogeneous nuclear ribonucleoprotein U-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 583 (210.3 bits), Expect = 1.2e-56, P = 1.2e-56
 Identities = 143/358 (39%), Positives = 199/358 (55%)

Query:    44 VVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVD 103
             V ++  + DL F +  +      L  EGFAY WSGARA  G+N G+ C+  K+     V 
Sbjct:   201 VAIDTYNSDLHFKVSPDHCSGYPLTIEGFAYLWSGARATYGVNKGRVCYELKVKEYISVK 260

Query:   104 -MEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSXXXXXXXXXXXXXXXLNFGEKFGVGDT 162
              +  + PD  HV RVG S  D    +LGE   S                ++GEKFG GD 
Sbjct:   261 HLPSSEPDP-HVVRVGWSL-DSCSTQLGEEAFSYGYGGTGKKSTNYKFGDYGEKFGEGDI 318

Query:   163 IICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLK 222
             I C ID +S     + F+KNGKWL  A +               KE     A+FPH+L+K
Sbjct:   319 IGCYIDFDSHEQVEMAFSKNGKWLDVAFRVS-------------KEELAGQALFPHVLVK 365

Query:   223 NVVVVMQFSV-EQGLIPV-EGYKSWVSALDDGNSVLGPTFCNMK-DCEVMMMVGLPASGK 279
             N  V   F   E+   P+ +GY S++  +   N V G    + K DC+V+MMVGLPA GK
Sbjct:   366 NCAVEFNFGQREEPYFPLPDGY-SFIGDVSLENRVRGTVGPSSKSDCQVLMMVGLPACGK 424

Query:   280 TTWAEKWVKDHPEKRYILLGTNLILEQMKVPGLLRKHNYSERFQCLMGRANAIFDVLLSR 339
             TTWA K  + +P+KR+ +LGTN I+E+MKV GL R+ NY+ R+  L+ +A    + LL  
Sbjct:   425 TTWAAKHAEMNPDKRFNILGTNAIMEKMKVMGLRRQRNYAGRWDILIQQATQCLNRLLQI 484

Query:   340 ASRTPRNFIIDQTNVFKSARKRKLRLFVNFRKIAVVVFPKPEDLKIRSVKRFKEMGKE 397
             AS   RN+I+DQTNV+ SA++RK+R F  F + AVV+ P+ EDLK R  K+ ++ GK+
Sbjct:   485 ASHKKRNYILDQTNVYGSAQRRKMRPFEGFHRKAVVICPRDEDLKERRCKQAED-GKD 541




GO:0006396 "RNA processing" evidence=IEA
GO:0009615 "response to virus" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0030529 "ribonucleoprotein complex" evidence=IEA
UNIPROTKB|J9JHA9 HNRNPUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z4B8 HNRNPUL1 "cDNA FLJ56481, highly similar to Heterogeneous nuclear ribonucleoprotein U-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNY1 HNRNPUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BUJ2 HNRNPUL1 "Heterogeneous nuclear ribonucleoprotein U-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUC2 HNRNPUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2443517 Hnrnpul1 "heterogeneous nuclear ribonucleoprotein U-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307456 Hnrnpul1 "heterogeneous nuclear ribonucleoprotein U-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6422 hnrnpub "heterogeneous nuclear ribonucleoprotein Ub" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3W0 HNRNPU "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00009742001
SubName- Full=Chromosome undetermined scaffold_247, whole genome shotgun sequence; (489 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
cd12884176 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous 1e-67
cd12873155 cd12873, SPRY_DDX1, SPRY domain associated with DE 5e-33
pfam13671143 pfam13671, AAA_33, AAA domain 2e-22
cd11709118 cd11709, SPRY, SPRY domain 4e-11
cd12872149 cd12872, SPRY_Ash2, SPRY domain in Ash2 1e-10
pfam00622125 pfam00622, SPRY, SPRY domain 2e-10
cd12885132 cd12885, SPRY_RanBP_like, SPRY domain in Ran bindi 3e-08
smart00449122 smart00449, SPRY, Domain in SPla and the RYanodine 3e-08
cd12876187 cd12876, SPRY_SOCS3, SPRY domain in the suppressor 9e-08
cd12875171 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and 3e-06
COG4639168 COG4639, COG4639, Predicted kinase [General functi 3e-05
cd12886128 cd12886, SPRY_like, SPRY domain-like in bacteria 5e-05
cd12907175 cd12907, SPRY_Fbox, SPRY domain in the F-box famil 1e-04
cd12909153 cd12909, SPRY_RanBP9_10, SPRY domain in Ran bindin 3e-04
cd12906174 cd12906, SPRY_SOCS1-2-4, SPRY domain in the suppre 7e-04
TIGR03574 249 TIGR03574, selen_PSTK, L-seryl-tRNA(Sec) kinase, a 0.001
cd12882128 cd12882, SPRY_RNF123, SPRY domain at N-terminus of 0.001
cd12878133 cd12878, SPRY2_RyR, SPRY domain 2 (SPRY2) of ryano 0.004
>gnl|CDD|240464 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 Back     alignment and domain information
 Score =  211 bits (540), Expect = 1e-67
 Identities = 80/188 (42%), Positives = 100/188 (53%), Gaps = 16/188 (8%)

Query: 44  VVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVD 103
           VVL+  + DL   I  +GL +  L  EGFAY W+GARA  G+  GK CF  K++   PV 
Sbjct: 1   VVLDWYNSDLHLKISKDGLSAEPLTDEGFAYLWAGARATYGVRKGKVCFEVKVLENLPVK 60

Query: 104 MEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTI 163
              T     HV RVG S     + +LGE + S+G+G TGK S  G F ++GE FG GD I
Sbjct: 61  HLPTEETDPHVVRVGWSVDSSSL-QLGEEKLSYGYGSTGKKSTNGKFEDYGEPFGEGDVI 119

Query: 164 ICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLKN 223
            C +DLES+P   I F KNGK LG A + D    G               A+FPHIL KN
Sbjct: 120 GCYLDLESEP-VEISFTKNGKDLGVAFRIDKELEG--------------KALFPHILTKN 164

Query: 224 VVVVMQFS 231
             V + F 
Sbjct: 165 CAVEVNFG 172


This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 (also known as HNRPUL1 ) which is a major constituent of nuclear matrix or scaffold and binds directly to DNA sequences through the N-terminal acidic region named serum amyloid P (SAP). Its function is specifically modulated by E1B-55kDa in adenovirus-infected cells. HNRPUL1 also participates in ATR protein kinase signaling pathways during adenovirus infection. Two transcript variants encoding different isoforms have been found for this gene. When associated with bromodomain-containing protein 7 (BRD7), it activates transcription of glucocorticoid-responsive promoter in the absence of ligand-stimulation. Length = 176

>gnl|CDD|240453 cd12873, SPRY_DDX1, SPRY domain associated with DEAD box gene DDX1 Back     alignment and domain information
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information
>gnl|CDD|240451 cd11709, SPRY, SPRY domain Back     alignment and domain information
>gnl|CDD|240452 cd12872, SPRY_Ash2, SPRY domain in Ash2 Back     alignment and domain information
>gnl|CDD|216029 pfam00622, SPRY, SPRY domain Back     alignment and domain information
>gnl|CDD|240465 cd12885, SPRY_RanBP_like, SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3 Back     alignment and domain information
>gnl|CDD|214669 smart00449, SPRY, Domain in SPla and the RYanodine Receptor Back     alignment and domain information
>gnl|CDD|240456 cd12876, SPRY_SOCS3, SPRY domain in the suppressor of cytokine signaling 3 (SOCS3) family Back     alignment and domain information
>gnl|CDD|240455 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and suppressors of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|226986 COG4639, COG4639, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240466 cd12886, SPRY_like, SPRY domain-like in bacteria Back     alignment and domain information
>gnl|CDD|240487 cd12907, SPRY_Fbox, SPRY domain in the F-box family Fbxo45 Back     alignment and domain information
>gnl|CDD|240489 cd12909, SPRY_RanBP9_10, SPRY domain in Ran binding proteins 9 and 10 Back     alignment and domain information
>gnl|CDD|240486 cd12906, SPRY_SOCS1-2-4, SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4) Back     alignment and domain information
>gnl|CDD|132613 TIGR03574, selen_PSTK, L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>gnl|CDD|240462 cd12882, SPRY_RNF123, SPRY domain at N-terminus of ring finger protein 123 Back     alignment and domain information
>gnl|CDD|240458 cd12878, SPRY2_RyR, SPRY domain 2 (SPRY2) of ryanodine receptor (RyR) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 403
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 100.0
KOG2626544 consensus Histone H3 (Lys4) methyltransferase comp 99.97
PF00622124 SPRY: SPRY domain; InterPro: IPR003877 The SPRY do 99.88
smart00449122 SPRY Domain in SPla and the RYanodine Receptor. Do 99.87
KOG2242 558 consensus Scaffold/matrix specific factor hnRNP-U/ 99.83
COG4639168 Predicted kinase [General function prediction only 99.78
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.76
KOG4030197 consensus Uncharacterized conserved protein, conta 99.74
KOG3953242 consensus SOCS box protein SSB-1, contains SPRY do 99.69
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 99.69
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.62
PHA02530 300 pseT polynucleotide kinase; Provisional 99.61
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.57
COG0645170 Predicted kinase [General function prediction only 99.56
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 99.55
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 99.54
PRK06762166 hypothetical protein; Provisional 99.52
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 99.5
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 99.42
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.42
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.39
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.34
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 99.34
PRK12339197 2-phosphoglycerate kinase; Provisional 99.32
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 99.31
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 99.27
KOG4367699 consensus Predicted Zn-finger protein [Function un 99.25
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 99.24
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.23
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.23
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.19
COG4185187 Uncharacterized protein conserved in bacteria [Fun 99.13
PRK00889175 adenylylsulfate kinase; Provisional 99.13
PRK14527191 adenylate kinase; Provisional 99.07
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 99.06
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 99.06
PRK14532188 adenylate kinase; Provisional 99.05
PRK05541176 adenylylsulfate kinase; Provisional 99.03
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.0
PRK14531183 adenylate kinase; Provisional 98.99
KOG3062 281 consensus RNA polymerase II elongator associated p 98.97
PRK12337475 2-phosphoglycerate kinase; Provisional 98.93
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.92
PLN02200234 adenylate kinase family protein 98.91
PRK03846198 adenylylsulfate kinase; Provisional 98.91
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.88
PRK01184184 hypothetical protein; Provisional 98.81
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.8
PRK11545163 gntK gluconate kinase 1; Provisional 98.79
PRK12338 319 hypothetical protein; Provisional 98.79
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 98.78
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.77
PRK00279215 adk adenylate kinase; Reviewed 98.76
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.72
KOG1477469 consensus SPRY domain-containing proteins [General 98.72
PRK09825176 idnK D-gluconate kinase; Provisional 98.72
PRK14530215 adenylate kinase; Provisional 98.69
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.65
PRK00625173 shikimate kinase; Provisional 98.63
PRK04220301 2-phosphoglycerate kinase; Provisional 98.61
PRK00131175 aroK shikimate kinase; Reviewed 98.6
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 98.6
PRK13946184 shikimate kinase; Provisional 98.58
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 98.55
PRK07261171 topology modulation protein; Provisional 98.55
PLN02674244 adenylate kinase 98.54
PRK02496184 adk adenylate kinase; Provisional 98.52
PRK06217183 hypothetical protein; Validated 98.51
PRK13948182 shikimate kinase; Provisional 98.5
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.49
PRK03839180 putative kinase; Provisional 98.49
PRK13947171 shikimate kinase; Provisional 98.48
PRK14529223 adenylate kinase; Provisional 98.46
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.46
PTZ00088229 adenylate kinase 1; Provisional 98.45
PRK14528186 adenylate kinase; Provisional 98.43
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.43
PRK08118167 topology modulation protein; Reviewed 98.42
PRK06547172 hypothetical protein; Provisional 98.42
PRK13949169 shikimate kinase; Provisional 98.42
PRK04040188 adenylate kinase; Provisional 98.42
PRK13808 333 adenylate kinase; Provisional 98.39
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 98.39
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 98.37
PRK04182180 cytidylate kinase; Provisional 98.36
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.36
PRK05057172 aroK shikimate kinase I; Reviewed 98.35
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 98.34
KOG4622 291 consensus Predicted nucleotide kinase [General fun 98.34
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.34
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.33
PLN02459261 probable adenylate kinase 98.31
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.31
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.28
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.28
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.26
PRK14526211 adenylate kinase; Provisional 98.26
PRK14737186 gmk guanylate kinase; Provisional 98.25
PRK00698205 tmk thymidylate kinase; Validated 98.25
PRK03731171 aroL shikimate kinase II; Reviewed 98.22
PRK08233182 hypothetical protein; Provisional 98.21
PRK13973213 thymidylate kinase; Provisional 98.21
KOG0234 438 consensus Fructose-6-phosphate 2-kinase/fructose-2 98.19
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 98.19
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.16
PRK06696223 uridine kinase; Validated 98.15
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 98.13
PRK14730195 coaE dephospho-CoA kinase; Provisional 98.11
PRK08356195 hypothetical protein; Provisional 98.1
TIGR00152188 dephospho-CoA kinase. This model produces scores i 98.08
PRK13975196 thymidylate kinase; Provisional 98.07
PRK00300205 gmk guanylate kinase; Provisional 98.07
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.06
PRK00081194 coaE dephospho-CoA kinase; Reviewed 98.01
PRK06761 282 hypothetical protein; Provisional 97.99
COG3896205 Chloramphenicol 3-O-phosphotransferase [Defense me 97.99
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 97.98
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.98
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.96
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 97.95
PRK05480209 uridine/cytidine kinase; Provisional 97.93
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.93
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 97.92
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 97.89
PLN02199303 shikimate kinase 97.87
PRK14738206 gmk guanylate kinase; Provisional 97.86
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 97.86
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 97.85
PLN02924220 thymidylate kinase 97.84
PLN02422232 dephospho-CoA kinase 97.8
PRK14734200 coaE dephospho-CoA kinase; Provisional 97.78
PRK07667193 uridine kinase; Provisional 97.74
PRK13974212 thymidylate kinase; Provisional 97.74
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.74
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.73
PLN02842 505 nucleotide kinase 97.71
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.7
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.69
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 97.67
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.67
PLN02772 398 guanylate kinase 97.54
PRK07933213 thymidylate kinase; Validated 97.54
PLN02165 334 adenylate isopentenyltransferase 97.52
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.51
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.48
PRK14733204 coaE dephospho-CoA kinase; Provisional 97.47
PRK14732196 coaE dephospho-CoA kinase; Provisional 97.46
PRK14731208 coaE dephospho-CoA kinase; Provisional 97.45
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 97.44
PTZ00451 244 dephospho-CoA kinase; Provisional 97.43
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.4
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 97.34
PF00004132 AAA: ATPase family associated with various cellula 97.33
PLN02348 395 phosphoribulokinase 97.28
PRK05439311 pantothenate kinase; Provisional 97.25
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.23
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.17
cd03115173 SRP The signal recognition particle (SRP) mediates 97.13
PRK13976209 thymidylate kinase; Provisional 97.1
COG3709192 Uncharacterized component of phosphonate metabolis 97.1
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 97.1
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.09
PLN02318 656 phosphoribulokinase/uridine kinase 97.09
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.08
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 97.08
KOG3078235 consensus Adenylate kinase [Nucleotide transport a 97.06
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.06
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 97.05
TIGR00959 428 ffh signal recognition particle protein. This mode 97.05
KOG1477 469 consensus SPRY domain-containing proteins [General 97.04
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.04
PRK10867 433 signal recognition particle protein; Provisional 97.04
PTZ00301210 uridine kinase; Provisional 97.03
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.02
PRK14974336 cell division protein FtsY; Provisional 96.96
PRK07429 327 phosphoribulokinase; Provisional 96.96
PRK09087226 hypothetical protein; Validated 96.94
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.93
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.92
KOG4238 627 consensus Bifunctional ATP sulfurylase/adenosine 5 96.91
smart00382148 AAA ATPases associated with a variety of cellular 96.91
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.9
PHA00729226 NTP-binding motif containing protein 96.9
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 96.88
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.86
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.84
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.84
PF13173128 AAA_14: AAA domain 96.81
PF03668 284 ATP_bind_2: P-loop ATPase protein family; InterPro 96.8
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 96.74
CHL00181287 cbbX CbbX; Provisional 96.73
PRK08099399 bifunctional DNA-binding transcriptional repressor 96.72
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.72
KOG3877 393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 96.72
KOG3308225 consensus Uncharacterized protein of the uridine k 96.69
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 96.66
PRK10416318 signal recognition particle-docking protein FtsY; 96.64
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.58
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.56
PRK14086 617 dnaA chromosomal replication initiation protein; P 96.53
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 96.52
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.5
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.49
TIGR00064272 ftsY signal recognition particle-docking protein F 96.48
PRK08084235 DNA replication initiation factor; Provisional 96.46
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.46
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 96.46
PHA03132 580 thymidine kinase; Provisional 96.44
PRK00149 450 dnaA chromosomal replication initiation protein; R 96.42
PF1324576 AAA_19: Part of AAA domain 96.38
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 96.36
PRK06620214 hypothetical protein; Validated 96.35
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.33
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.29
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.28
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.28
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.26
PRK14088 440 dnaA chromosomal replication initiation protein; P 96.25
cd03246173 ABCC_Protease_Secretion This family represents the 96.25
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 96.23
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.23
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.22
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.21
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.17
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.13
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.12
PRK05642234 DNA replication initiation factor; Validated 96.12
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.08
PRK06893229 DNA replication initiation factor; Validated 96.07
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.05
KOG0780 483 consensus Signal recognition particle, subunit Srp 96.02
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.02
PRK08727233 hypothetical protein; Validated 95.99
PHA02544 316 44 clamp loader, small subunit; Provisional 95.98
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.98
PRK08116268 hypothetical protein; Validated 95.96
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.93
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.92
PRK15453 290 phosphoribulokinase; Provisional 95.92
PRK12402 337 replication factor C small subunit 2; Reviewed 95.92
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.92
KOG1384 348 consensus tRNA delta(2)-isopentenylpyrophosphate t 95.9
KOG1533 290 consensus Predicted GTPase [General function predi 95.9
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.89
PRK12377248 putative replication protein; Provisional 95.89
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.88
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.87
PF05729166 NACHT: NACHT domain 95.86
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 95.85
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 95.84
PTZ00202 550 tuzin; Provisional 95.83
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 95.83
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.83
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 95.83
PLN02840 421 tRNA dimethylallyltransferase 95.83
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.83
PLN02748 468 tRNA dimethylallyltransferase 95.82
COG3911183 Predicted ATPase [General function prediction only 95.81
PRK13695174 putative NTPase; Provisional 95.8
COG2884223 FtsE Predicted ATPase involved in cell division [C 95.8
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.8
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 95.8
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.76
PRK00023225 cmk cytidylate kinase; Provisional 95.74
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.71
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.71
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.68
PLN03025 319 replication factor C subunit; Provisional 95.67
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.66
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.65
cd02029 277 PRK_like Phosphoribulokinase-like (PRK-like) is a 95.63
PRK12422 445 chromosomal replication initiation protein; Provis 95.62
PRK03992389 proteasome-activating nucleotidase; Provisional 95.62
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.6
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 95.55
COG2256 436 MGS1 ATPase related to the helicase subunit of the 95.52
PLN02796 347 D-glycerate 3-kinase 95.51
PRK09183259 transposase/IS protein; Provisional 95.51
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.5
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.46
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.45
cd03215182 ABC_Carb_Monos_II This family represents domain II 95.44
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 95.44
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.43
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.39
COG1341 398 Predicted GTPase or GTP-binding protein [General f 95.38
COG1855 604 ATPase (PilT family) [General function prediction 95.36
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.34
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 95.33
PRK13342 413 recombination factor protein RarA; Reviewed 95.32
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.31
PRK06921266 hypothetical protein; Provisional 95.28
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 95.28
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 95.27
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.26
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 95.25
PLN03046 460 D-glycerate 3-kinase; Provisional 95.23
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 95.22
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.22
PRK07952244 DNA replication protein DnaC; Validated 95.22
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.21
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.2
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 95.18
PRK08760 476 replicative DNA helicase; Provisional 95.17
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.16
PRK09435 332 membrane ATPase/protein kinase; Provisional 95.16
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 95.15
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.14
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 95.14
PHA02244 383 ATPase-like protein 95.12
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.11
PRK04328249 hypothetical protein; Provisional 95.11
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 95.1
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 95.1
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 95.08
cd03116159 MobB Molybdenum is an essential trace element in t 95.08
PRK13341 725 recombination factor protein RarA/unknown domain f 95.07
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 95.06
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.05
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.03
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.02
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.02
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 95.01
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 95.01
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 95.0
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 94.99
CHL00195489 ycf46 Ycf46; Provisional 94.98
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.98
PRK08181269 transposase; Validated 94.91
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.89
PF13479213 AAA_24: AAA domain 94.88
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 94.88
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.88
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 94.88
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 94.87
TIGR00101199 ureG urease accessory protein UreG. This model rep 94.87
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 94.85
CHL00176 638 ftsH cell division protein; Validated 94.83
cd03112158 CobW_like The function of this protein family is u 94.81
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.8
PRK05636505 replicative DNA helicase; Provisional 94.78
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 94.76
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 94.75
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.74
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 94.73
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 94.72
COG0324 308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 94.72
PRK06835329 DNA replication protein DnaC; Validated 94.72
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.71
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.68
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.68
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 94.68
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 94.65
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.65
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.64
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.64
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 94.63
PRK13764 602 ATPase; Provisional 94.63
TIGR00665434 DnaB replicative DNA helicase. This model describe 94.62
PRK00411 394 cdc6 cell division control protein 6; Reviewed 94.61
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.58
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 94.56
COG1660 286 Predicted P-loop-containing kinase [General functi 94.56
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.56
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 94.53
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 94.52
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 94.52
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 94.51
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 94.5
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 94.5
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.48
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.47
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 94.45
PRK09165 497 replicative DNA helicase; Provisional 94.43
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.43
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 94.42
PF00005137 ABC_tran: ABC transporter This structure is on hol 94.41
KOG1969 877 consensus DNA replication checkpoint protein CHL12 94.41
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 94.4
PRK06321 472 replicative DNA helicase; Provisional 94.39
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 94.38
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 94.38
cd02034116 CooC The accessory protein CooC, which contains a 94.37
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.33
cd03114148 ArgK-like The function of this protein family is u 94.32
cd00154159 Rab Rab family. Rab GTPases form the largest famil 94.27
PRK13768 253 GTPase; Provisional 94.22
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 94.22
PRK08506 472 replicative DNA helicase; Provisional 94.18
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 94.18
PRK13833323 conjugal transfer protein TrbB; Provisional 94.18
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 94.17
PRK08006 471 replicative DNA helicase; Provisional 94.15
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 94.15
PRK15455 644 PrkA family serine protein kinase; Provisional 94.14
PRK00440 319 rfc replication factor C small subunit; Reviewed 94.13
PRK07004 460 replicative DNA helicase; Provisional 94.11
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 94.11
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 94.1
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 94.1
TIGR00231161 small_GTP small GTP-binding protein domain. This m 94.09
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 94.09
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 94.06
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.0
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.99
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 93.97
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 93.97
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 93.95
cd01394218 radB RadB. The archaeal protein radB shares simila 93.94
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.93
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 93.93
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 93.89
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.89
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 93.89
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.87
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.87
PRK05973237 replicative DNA helicase; Provisional 93.85
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 93.85
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.84
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.8
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.8
PF1355562 AAA_29: P-loop containing region of AAA domain 93.78
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 93.77
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 93.76
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 93.75
cd00876160 Ras Ras family. The Ras family of the Ras superfam 93.75
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 93.74
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 93.73
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 93.71
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 93.69
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 93.68
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 93.68
PRK04296190 thymidine kinase; Provisional 93.65
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 93.63
COG4618580 ArpD ABC-type protease/lipase transport system, AT 93.62
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 93.59
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 93.59
PRK14087 450 dnaA chromosomal replication initiation protein; P 93.58
PRK13851344 type IV secretion system protein VirB11; Provision 93.55
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 93.52
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 93.51
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 93.51
COG4619223 ABC-type uncharacterized transport system, ATPase 93.51
cd03234226 ABCG_White The White subfamily represents ABC tran 93.5
COG1084346 Predicted GTPase [General function prediction only 93.5
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 93.49
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 93.49
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 93.48
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 93.47
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.46
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.43
COG4988559 CydD ABC-type transport system involved in cytochr 93.42
PRK05748 448 replicative DNA helicase; Provisional 93.41
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 93.4
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 93.4
cd03269210 ABC_putative_ATPase This subfamily is involved in 93.38
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 93.38
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 93.38
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.38
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 93.36
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 93.36
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 93.34
PRK14493 274 putative bifunctional molybdopterin-guanine dinucl 93.33
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 93.31
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.3
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 93.3
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 93.28
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 93.28
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 93.27
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 93.24
PRK05595 444 replicative DNA helicase; Provisional 93.24
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 93.23
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 93.23
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 93.23
PF07726131 AAA_3: ATPase family associated with various cellu 93.23
cd01128249 rho_factor Transcription termination factor rho is 93.21
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 93.2
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 93.19
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 93.18
PF00025175 Arf: ADP-ribosylation factor family The prints ent 93.17
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 93.17
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 93.17
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 93.17
PRK08939306 primosomal protein DnaI; Reviewed 93.16
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 93.16
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 93.15
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 93.12
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 93.12
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 93.12
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 93.11
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 93.09
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 93.09
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 93.06
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 93.04
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.03
PF12775 272 AAA_7: P-loop containing dynein motor region D3; P 93.02
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.01
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 93.0
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 93.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 93.0
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=8.7e-38  Score=303.91  Aligned_cols=173  Identities=34%  Similarity=0.576  Sum_probs=158.2

Q ss_pred             cEEeCcCCCCCCeEEcCCCceEEecCCCCcccceeeEEecceec-CCEEEEEEEEEeecCCCCCCCCCCCCCcEEEEEec
Q 015668           43 RVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGIN-GGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSR  121 (403)
Q Consensus        43 ~v~l~~~d~~~~l~is~d~l~~~~~~~~~~~~~~~~~Ra~~gv~-~G~~YfEv~i~~~~~~~~~~~~~~~~~~~rVG~s~  121 (403)
                      .|+||++|+++.|.|++|||.|++..    .+.|.++|||.|+. .|||||||+|.+             .|.|||||||
T Consensus        88 ~w~mn~~Drg~alaI~~dGL~CqSre----~KeWhGcRaT~Gl~gkGK~YyEvtitd-------------~GLCRVGWsT  150 (725)
T KOG0349|consen   88 EWKMNKQDRGLALAIDEDGLACQSRE----KKEWHGCRATAGLYGKGKYYYEVTITD-------------KGLCRVGWST  150 (725)
T ss_pred             ccccCccccCceeeEcCCccccchhH----HhhhhccccccccccCceEEEEEEecc-------------Cceeeechhh
Confidence            49999999999999999999998753    47899999999999 899999999985             5999999999


Q ss_pred             CCCCCCCCCCCCcceeEecCCceeeCCCcccCCCCCCCCCEEEEEEecCCCCCceEEEEeCcccccccccccCCCCCCcc
Q 015668          122 GDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFGVGDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGV  201 (403)
Q Consensus       122 ~~~~~~~lG~d~~Sygy~~~G~~~~~~~~~~yG~~f~~gDVIGc~ldl~~~p~~~i~ftkNG~~lg~af~~~~~~~~l~~  201 (403)
                      .+. +.-+|.+..+|||+++|++++|.++.+||++|+..|||||+||+++   .+|.|+|||+.+|.||++++..     
T Consensus       151 ~qa-sLdlGt~~~gFGfGGTGkKS~nkqFDdYGe~Ft~~DvIGCyLDld~---~~v~fsKNG~~lg~AF~ip~~~-----  221 (725)
T KOG0349|consen  151 LQA-SLDLGTGLDGFGFGGTGKKSTNKQFDDYGEPFTLNDVIGCYLDLDS---RTVWFSKNGEQLGAAFSIPVKY-----  221 (725)
T ss_pred             ccc-ccccCccccccccCccCccccccccccccCcccccceeeEEEeccC---ceEEEecCccccceeEEcChhh-----
Confidence            774 5679999999999999999999999999999999999999999999   8999999999999999987643     


Q ss_pred             ccchhhcccCCCceEeEEEEeCeEEEEEccCCC-CCCCcccceecccccc
Q 015668          202 VDSAVKERQCESAVFPHILLKNVVVVMQFSVEQ-GLIPVEGYKSWVSALD  250 (403)
Q Consensus       202 ~~~~~~g~~~~~~~fP~v~l~~~~v~~nFG~~~-~~~p~~g~~p~~~~~~  250 (403)
                               ....|||||.++|+++.+|||.++ +|+|-+||....+|.+
T Consensus       222 ---------kn~~lfPAvvlkNael~fNFG~~~FKfpPgngFva~s~Ap~  262 (725)
T KOG0349|consen  222 ---------KNSNLFPAVVLKNAELSFNFGSQPFKFPPGNGFVAVSDAPN  262 (725)
T ss_pred             ---------cccccchheeeccceEEEecCCCccccCCCCceEEeecCCc
Confidence                     267899999999999999999875 7777899999987765



>KOG2626 consensus Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF00622 SPRY: SPRY domain; InterPro: IPR003877 The SPRY domain is of unknown function Back     alignment and domain information
>smart00449 SPRY Domain in SPla and the RYanodine Receptor Back     alignment and domain information
>KOG2242 consensus Scaffold/matrix specific factor hnRNP-U/SAF-A, contains SPRY domain [RNA processing and modification] Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG4030 consensus Uncharacterized conserved protein, contains SPRY domain [Function unknown] Back     alignment and domain information
>KOG3953 consensus SOCS box protein SSB-1, contains SPRY domain [General function prediction only] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>KOG1477 consensus SPRY domain-containing proteins [General function prediction only] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>KOG4622 consensus Predicted nucleotide kinase [General function prediction only] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG1477 consensus SPRY domain-containing proteins [General function prediction only] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query403
3toj_A213 SET1/ASH2 histone methyltransferase complex subun; 2e-26
3emw_A217 SPRY domain-containing SOCS box protein 2; apoptos 2e-24
2jk9_A212 SPRY domain-containing SOCS box protein 1; transcr 7e-23
2afj_A226 Gene rich cluster, C9 gene; beta sandwich, gene re 4e-22
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 3e-20
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 4e-20
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 3e-17
2yyo_A171 SPRY domain-containing protein 3; NPPSFA, national 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 4e-06
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 2e-05
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 2e-05
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 2e-05
>3toj_A SET1/ASH2 histone methyltransferase complex subun; transcription, SPRY domain, prote binding, histone methylation, RBBP5, DPY-30, nuclear; 2.07A {Homo sapiens} Length = 213 Back     alignment and structure
 Score =  104 bits (261), Expect = 2e-26
 Identities = 40/192 (20%), Positives = 66/192 (34%), Gaps = 31/192 (16%)

Query: 42  QRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQP 101
           +RV+L   D      I D+ L   G         +S  RA+ G+  G + F   +    P
Sbjct: 11  ERVLLALHDRAPQLKISDDRLTVVGEKG------YSMVRASHGVRKGAWYFEITVDEMPP 64

Query: 102 VDMEDTPPDQQHVCRVGTSRGDDPVGK-LGETEQSFGF-GGTGKFSHGGNFLNFGEKFGV 159
                         R+G S+    +   LG  + S+ +    G   H     ++   +G 
Sbjct: 65  ----------DTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQ 114

Query: 160 GDTIICAIDLESKPLATIGFAKNGKWLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHI 219
           GD +   I+L    ++  G ++          F       GV    +     E   FP I
Sbjct: 115 GDVLGFYINLPEDTISGRGSSE--------IIFYKNGVNQGVAYKDIF----EGVYFPAI 162

Query: 220 -LLKNVVVVMQF 230
            L K+  V + F
Sbjct: 163 SLYKSCTVSINF 174


>3emw_A SPRY domain-containing SOCS box protein 2; apoptosis nucleus, apoptosis, UBL conjugation pathwayc, CL transcription regulation, transcription, phosphoprotein; 1.80A {Homo sapiens} PDB: 3ek9_A Length = 217 Back     alignment and structure
>2jk9_A SPRY domain-containing SOCS box protein 1; transcription regulation, transcription; 1.79A {Homo sapiens} PDB: 3f2o_A 2fnj_A 2v24_A 2ihs_A Length = 212 Back     alignment and structure
>2afj_A Gene rich cluster, C9 gene; beta sandwich, gene regulation; NMR {Mus musculus} SCOP: b.29.1.22 Length = 226 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>2yyo_A SPRY domain-containing protein 3; NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Length = 287 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Length = 416 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
3toj_A213 SET1/ASH2 histone methyltransferase complex subun; 100.0
2yyo_A171 SPRY domain-containing protein 3; NPPSFA, national 100.0
3emw_A217 SPRY domain-containing SOCS box protein 2; apoptos 99.91
2jk9_A212 SPRY domain-containing SOCS box protein 1; transcr 99.91
2afj_A226 Gene rich cluster, C9 gene; beta sandwich, gene re 99.87
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.56
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.44
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.43
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.36
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.35
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 99.34
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 99.3
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.29
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.28
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.14
2wl1_A191 Pyrin, marenostrin; amyloidosis, polymorphism, cyt 99.1
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.08
2vli_A183 Antibiotic resistance protein; transferase, tunica 99.08
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.07
2vok_A188 52 kDa RO protein; polymorphism, immune system, me 99.07
2fbe_A201 Predicted: similar to RET finger protein-like 1; d 99.06
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 99.05
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 99.05
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.03
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.0
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 98.99
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.99
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.97
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.97
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.97
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.96
3uv9_A186 TRIM5alpha, tripartite motif-containing protein 5; 98.95
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.95
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.93
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.92
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.91
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.9
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.9
3kb5_A193 Tripartite motif-containing protein 72; B30.2, gus 98.89
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.86
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.86
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.85
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 98.85
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.84
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 98.82
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.76
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.75
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.72
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.7
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.69
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.69
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.65
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.63
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.63
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.62
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.62
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.6
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.59
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.52
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.51
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.5
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.49
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.48
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.47
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.47
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.43
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.42
4b3n_A602 Maltose-binding periplasmic protein, tripartite mo 98.4
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.39
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.37
1via_A175 Shikimate kinase; structural genomics, transferase 98.37
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.36
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 98.32
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.32
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.3
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.29
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.26
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.2
2e63_A170 KIAA1787 protein; structure genomics, neuralized d 98.2
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.19
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 98.15
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 98.1
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.1
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 98.05
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 98.05
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 98.04
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.02
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 98.02
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.99
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.99
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.99
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.96
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.94
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 97.91
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.91
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.9
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.87
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 97.8
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.8
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.79
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.79
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.78
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 97.67
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 97.64
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.63
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.58
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 97.58
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.56
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.55
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.51
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.38
2yue_A168 Protein neuralized; structure genomics, NEUZ(NHR) 97.18
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.14
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 97.11
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 97.1
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.07
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.05
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.03
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.02
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.94
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.92
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.8
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.8
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.8
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.79
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.78
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.76
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.7
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.7
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.64
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.56
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.53
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.51
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.46
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.41
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.37
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.25
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.19
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.13
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.12
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 96.1
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 96.08
1p6x_A 334 Thymidine kinase; P-loop, LID, transferase; HET: T 96.02
3co5_A143 Putative two-component system transcriptional RES 96.0
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.93
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 95.9
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.89
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.88
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.88
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.87
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.8
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.79
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 95.76
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.76
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.73
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.72
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.69
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 95.66
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.62
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.62
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 95.54
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.47
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.45
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.42
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.42
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.41
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.4
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 95.36
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.34
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.34
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.31
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.29
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.28
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.27
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.24
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 95.23
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.21
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.19
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 95.18
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.15
3pvs_A 447 Replication-associated recombination protein A; ma 95.15
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.14
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.13
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 95.1
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 95.06
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.06
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 95.05
3bos_A242 Putative DNA replication factor; P-loop containing 95.04
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.03
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.02
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 95.01
3czq_A304 Putative polyphosphate kinase 2; structural genomi 94.97
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.96
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.93
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.92
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 94.92
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.89
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.88
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.87
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 94.86
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.82
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.8
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.74
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 94.73
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.64
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.63
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.61
2og2_A359 Putative signal recognition particle receptor; nuc 94.61
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.57
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.56
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.55
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 94.52
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 94.42
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 94.4
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.37
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.37
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 94.34
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.32
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.32
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 94.31
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.23
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 94.23
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 94.22
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 94.2
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.12
1dek_A 241 Deoxynucleoside monophosphate kinase; transferase, 94.1
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.06
2xxa_A 433 Signal recognition particle protein; protein trans 94.02
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 94.01
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.01
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.0
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 93.97
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.96
1tue_A212 Replication protein E1; helicase, replication, E1E 93.95
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 93.94
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 93.9
2qgz_A308 Helicase loader, putative primosome component; str 93.86
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.82
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.8
2ghi_A260 Transport protein; multidrug resistance protein, M 93.69
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 93.68
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.66
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 93.66
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 93.65
2r62_A268 Cell division protease FTSH homolog; ATPase domain 93.65
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.61
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.61
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.6
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.6
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.58
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.56
3czp_A 500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 93.55
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 93.55
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.53
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.51
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.5
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.46
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.46
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.41
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 93.38
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 93.33
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.33
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.27
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.25
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.25
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 93.24
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.18
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 93.15
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 93.14
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.1
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 93.1
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.1
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.04
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 93.02
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 93.02
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.99
1g6h_A257 High-affinity branched-chain amino acid transport 92.98
2z43_A324 DNA repair and recombination protein RADA; archaea 92.97
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.97
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 92.96
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 92.95
2r44_A 331 Uncharacterized protein; putative ATPase, structur 92.95
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 92.94
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.94
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.93
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.92
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.9
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 92.89
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 92.89
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 92.88
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.87
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.87
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 92.84
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.84
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.83
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.83
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 92.83
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.82
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 92.82
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.81
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 92.79
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 92.79
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.79
2ged_A193 SR-beta, signal recognition particle receptor beta 92.75
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 92.73
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.73
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.72
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.72
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 92.71
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 92.71
2ewv_A372 Twitching motility protein PILT; pilus retraction 92.69
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.68
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 92.61
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 92.6
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 92.6
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 92.58
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.56
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.54
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.54
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.53
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 92.53
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 92.52
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.49
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 92.48
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.47
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 92.44
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.43
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 92.4
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 92.39
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 92.39
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 92.37
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 92.37
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.36
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 92.36
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.36
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 92.33
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.32
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.31
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 92.3
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 92.3
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 92.3
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.29
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 92.26
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.24
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 92.18
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 92.16
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 92.12
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 92.12
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 92.1
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.07
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 92.05
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 92.04
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 92.02
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 92.02
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 92.02
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 92.01
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.97
3kta_A182 Chromosome segregation protein SMC; structural mai 91.95
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 91.93
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 91.92
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.91
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.91
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.89
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 91.83
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 91.82
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.8
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 91.75
1p9r_A 418 General secretion pathway protein E; bacterial typ 91.71
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 91.69
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 91.66
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.62
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 91.61
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 91.6
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 91.6
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 91.6
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 91.58
3t1o_A198 Gliding protein MGLA; G domain containing protein, 91.57
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 91.55
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 91.54
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 91.54
2chq_A 319 Replication factor C small subunit; DNA-binding pr 91.51
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.48
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 91.46
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 91.46
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 91.44
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 91.41
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 91.41
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 91.41
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 91.39
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 91.38
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 91.36
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 91.31
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 91.3
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 91.26
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 91.24
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.24
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 91.21
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 91.2
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 91.2
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 91.18
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 91.17
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 91.15
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 91.13
1u94_A 356 RECA protein, recombinase A; homologous recombinat 91.09
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.07
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 91.06
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 91.02
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 91.01
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 91.01
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 91.01
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 90.96
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 90.95
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 90.91
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.89
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 90.87
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 90.87
1xp8_A 366 RECA protein, recombinase A; recombination, radior 90.84
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 90.84
3lxx_A239 GTPase IMAP family member 4; structural genomics c 90.8
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 90.8
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 90.76
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 90.74
2fh5_B214 SR-beta, signal recognition particle receptor beta 90.72
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 90.71
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 90.7
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 90.69
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 90.65
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 90.64
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 90.58
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 90.54
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 90.53
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 90.53
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 90.52
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 90.51
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 90.51
3lxw_A247 GTPase IMAP family member 1; immunity, structural 90.48
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 90.44
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 90.43
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 90.4
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 90.37
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 90.36
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 90.34
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 90.33
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 90.26
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 90.23
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 90.21
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 90.21
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 90.19
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 90.18
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 90.16
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 90.15
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 89.99
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 89.89
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 89.85
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 89.82
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 89.77
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 89.73
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 89.63
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 89.61
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 89.58
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 89.56
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 89.56
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 89.55
2fna_A 357 Conserved hypothetical protein; structural genomic 89.46
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 89.34
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 89.33
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 89.21
3llu_A196 RAS-related GTP-binding protein C; structural geno 89.15
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 89.14
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 89.14
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 89.08
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 89.03
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 89.02
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 88.9
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 88.79
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 88.77
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 88.74
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 88.55
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 88.53
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 88.51
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 88.48
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 88.45
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 88.44
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 88.26
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 88.24
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 88.05
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 88.03
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 88.01
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 87.82
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 87.82
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 87.82
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 87.74
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 87.69
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 87.66
3io5_A 333 Recombination and repair protein; storage dimer, i 87.54
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 87.44
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 87.44
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 87.36
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 87.21
>3toj_A SET1/ASH2 histone methyltransferase complex subun; transcription, SPRY domain, prote binding, histone methylation, RBBP5, DPY-30, nuclear; 2.07A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=6e-38  Score=290.42  Aligned_cols=175  Identities=25%  Similarity=0.298  Sum_probs=152.7

Q ss_pred             CcEEeCcCCCCCCeEEcCCCceEEecCCCCcccceeeEEecceecCCEEEEEEEEEeecCCCCCCCCCCCCCcEEEEEec
Q 015668           42 QRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTSR  121 (403)
Q Consensus        42 ~~v~l~~~d~~~~l~is~d~l~~~~~~~~~~~~~~~~~Ra~~gv~~G~~YfEv~i~~~~~~~~~~~~~~~~~~~rVG~s~  121 (403)
                      ..|+||+.|++++|.||+|+++++..      ++|++|||++++.+|+|||||+|.+..          ..++++|||++
T Consensus        11 ~~v~ld~~d~~~~l~ls~d~l~v~~~------~~~~~vra~~~v~~G~~YfEV~v~~~~----------~~~~~~iG~a~   74 (213)
T 3toj_A           11 ERVLLALHDRAPQLKISDDRLTVVGE------KGYSMVRASHGVRKGAWYFEITVDEMP----------PDTAARLGWSQ   74 (213)
T ss_dssp             CCCCEEEEEECTTSEECTTSSEEECC------SSCEEEEESCCBSSEEEEEEEEEEECC----------TTCEEEEEEEC
T ss_pred             CeEEechhhCCCCEEEcCCCcEEEeC------CceeEEEeCCCccCCeEEEEEEEeecC----------CCceEEEEecc
Confidence            46999999999999999999999863      689999999999999999999999741          35899999999


Q ss_pred             CCCC-CCCCCCCCcceeEe-cCCceeeCCCcccCCCCCCCCCEEEEEEecCCC-----CCceEEEEeCcccccccccccC
Q 015668          122 GDDP-VGKLGETEQSFGFG-GTGKFSHGGNFLNFGEKFGVGDTIICAIDLESK-----PLATIGFAKNGKWLGTAKQFDA  194 (403)
Q Consensus       122 ~~~~-~~~lG~d~~Sygy~-~~G~~~~~~~~~~yG~~f~~gDVIGc~ldl~~~-----p~~~i~ftkNG~~lg~af~~~~  194 (403)
                      ...+ ..++|+|.+||||+ .+|+++|++....||++|++||||||+||++..     +.++|+||+||+.||+||+.  
T Consensus        75 ~~~~~~~~~G~d~~S~gy~~~~G~~~h~~~~~~yg~~~~~GDvIGc~ld~~~~~~~~~~~g~i~Ft~NG~~lg~aF~~--  152 (213)
T 3toj_A           75 PLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTISGRGSSEIIFYKNGVNQGVAYKD--  152 (213)
T ss_dssp             TTSCTTSCTTSSTTEEEEETTTTCEEETTEEECCSCCCCTTCEEEEEEEECCC-----CCCEEEEEETTEEEEEEEES--
T ss_pred             CCcccccCCCCCCCcEEEECCCCeEEeCCcCcccCCCCCCCCEEEEEEEcCCCccccCCccEEEEEeCCeeeeeeEEc--
Confidence            8764 56899999999997 689999998888999999999999999999862     22599999999999999972  


Q ss_pred             CCCCCccccchhhcccCCCceEeEEEEe-CeEEEEEccCCCCCCCcc-cceeccccc
Q 015668          195 GSNGLGVVDSAVKERQCESAVFPHILLK-NVVVVMQFSVEQGLIPVE-GYKSWVSAL  249 (403)
Q Consensus       195 ~~~~l~~~~~~~~g~~~~~~~fP~v~l~-~~~v~~nFG~~~~~~p~~-g~~p~~~~~  249 (403)
                       +              ....|||+|++. +++|++|||+.+.|+|++ +|+|+.+.+
T Consensus       153 -~--------------~~~~lyPavsl~~~~~v~~NFG~~F~~~p~~~~~~~~~~~~  194 (213)
T 3toj_A          153 -I--------------FEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMG  194 (213)
T ss_dssp             -C--------------CSSCBEEEEEEESSCEEEEECSSSCSSCCSSCCCEEGGGGG
T ss_pred             -C--------------CCCcEEEEEEcCCCCEEEEECCCCCccCCCCCceEcHHHhc
Confidence             1              146899999996 999999999977787776 799997754



>2yyo_A SPRY domain-containing protein 3; NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} Back     alignment and structure
>3emw_A SPRY domain-containing SOCS box protein 2; apoptosis nucleus, apoptosis, UBL conjugation pathwayc, CL transcription regulation, transcription, phosphoprotein; 1.80A {Homo sapiens} PDB: 3ek9_A Back     alignment and structure
>2jk9_A SPRY domain-containing SOCS box protein 1; transcription regulation, transcription; 1.79A {Homo sapiens} PDB: 3f2o_A 2fnj_A 2v24_A 2ihs_A Back     alignment and structure
>2afj_A Gene rich cluster, C9 gene; beta sandwich, gene regulation; NMR {Mus musculus} SCOP: b.29.1.22 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2wl1_A Pyrin, marenostrin; amyloidosis, polymorphism, cytoskeleton, actin-binding inflammatory response, metal-binding, signaling protein; 1.35A {Homo sapiens} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2vok_A 52 kDa RO protein; polymorphism, immune system, metal-binding, tripartite motif (TRIM) protein, SPRY systemic lupus erythematosus, zinc, B30.2; 1.30A {Mus musculus} PDB: 2vol_B* 2iwg_B* Back     alignment and structure
>2fbe_A Predicted: similar to RET finger protein-like 1; dimer, jellyroll beta-sandwich fold, unknown function; 2.52A {Homo sapiens} SCOP: b.29.1.22 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3uv9_A TRIM5alpha, tripartite motif-containing protein 5; domain SWAP, antiretroviral, HIV capsid, ligase; 1.55A {Macaca mulatta} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3kb5_A Tripartite motif-containing protein 72; B30.2, gustavus, SPRY, TRIM21, TRIM72, PRY, high resolution, Mg53; 1.50A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4b3n_A Maltose-binding periplasmic protein, tripartite motif-containing protein 5; sugar binding protein-ligase complex; HET: MAL MES; 3.30A {Escherichia coli} PDB: 2lm3_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2e63_A KIAA1787 protein; structure genomics, neuralized domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2yue_A Protein neuralized; structure genomics, NEUZ(NHR) domain, structural genomics, NPPSFA; NMR {Drosophila melanogaster} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 403
d2fnja1217 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophi 2e-18
d2afja1213 b.29.1.22 (A:12-224) SPRY domain-containing SOCS b 1e-15
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 3e-06
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 2e-05
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.002
>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: SPRY domain
domain: LD34464p
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score = 81.0 bits (199), Expect = 2e-18
 Identities = 27/151 (17%), Positives = 50/151 (33%), Gaps = 13/151 (8%)

Query: 46  LNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQP---- 101
            N  D  L+  ++++   +   H+   A      R  VG+  G + +     + Q     
Sbjct: 26  WNSEDRSLNIFVKEDDKLT--FHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHA 83

Query: 102 ---VDMEDTPPDQQHVCRVGTSRGDDPVGKLGETEQSFGFGGTGKFSHGGNFLNFGEKFG 158
              V   D P        +  S  +   G      + +              L   E F 
Sbjct: 84  VVGVCTADAPLHSVGYQSLVGST-EQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFL 142

Query: 159 VGDTIICAIDLESKPLATIGFAKNGKWLGTA 189
           V D  + A+D++     T+ F  + ++LG A
Sbjct: 143 VPDKFLVALDMDEG---TLSFIVDQQYLGIA 170


>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 213 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query403
d2fnja1217 LD34464p {Fruit fly (Drosophila melanogaster) [Tax 99.95
d2afja1213 SPRY domain-containing SOCS box protein 2 {Mouse ( 99.94
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.78
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.7
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.45
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.36
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 99.25
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.24
d2fbea1188 Similar to Ret finger protein-like 1 {Human (Homo 99.2
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.18
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.18
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.12
d2iwgb1179 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 96 99.06
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 99.04
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.81
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.78
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.75
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.73
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.72
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.7
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.67
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.63
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.6
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.59
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.53
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.52
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.45
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.43
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.42
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.34
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.32
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.26
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.24
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.18
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.08
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.07
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.98
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.92
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.9
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.89
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.77
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.75
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.59
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.46
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.45
d2qy9a2211 GTPase domain of the signal recognition particle r 97.41
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.34
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.31
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.28
d1vmaa2213 GTPase domain of the signal recognition particle r 97.26
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.18
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.12
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.08
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 96.99
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.98
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 96.94
d1okkd2207 GTPase domain of the signal recognition particle r 96.92
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.91
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.89
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.84
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.82
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.8
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.7
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.6
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.52
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.51
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.49
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.46
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.32
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.31
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.31
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.26
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.25
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.25
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.18
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.07
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 95.97
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.93
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.92
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 95.84
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.81
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.81
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.78
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 95.73
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 95.71
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.56
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.5
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.27
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.23
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.21
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.16
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.09
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.06
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.02
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.96
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 94.65
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.63
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.55
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.54
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.51
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 94.46
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.34
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.21
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.19
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.13
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.11
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.09
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.08
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.04
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.02
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.94
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 93.91
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.89
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.83
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.79
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.75
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.75
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.72
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.5
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.48
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.46
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.39
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.37
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.33
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.32
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.31
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.3
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.25
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 93.2
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.09
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.08
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.08
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.06
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.03
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 93.03
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.01
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.99
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.99
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.99
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.98
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.97
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.95
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.95
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.95
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.9
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.83
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.82
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.77
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.77
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.76
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.68
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.66
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.65
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.61
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 92.61
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.57
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.51
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.5
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.5
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.45
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.42
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.32
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.29
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.25
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.14
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.11
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.0
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.89
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.88
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 91.85
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.79
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.73
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.65
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.63
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.6
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.58
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.44
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.41
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.4
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.34
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.33
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.25
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 91.12
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.11
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.06
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.04
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.01
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.99
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.92
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.85
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.82
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 90.75
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 90.72
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 90.7
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.62
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.52
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.49
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 90.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.2
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 90.19
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.15
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 90.13
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.01
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.85
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.78
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.61
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.26
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 88.62
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 88.59
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 88.2
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 88.04
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.03
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.56
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.1
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.05
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 86.9
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 86.53
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 86.35
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 86.03
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 85.21
d1tuea_205 Replication protein E1 helicase domain {Human papi 84.48
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 84.47
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 84.41
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.88
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 83.66
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 83.63
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 82.81
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 82.79
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 82.79
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 82.39
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 81.97
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.76
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 80.68
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 80.63
>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: SPRY domain
domain: LD34464p
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.95  E-value=2.2e-28  Score=224.70  Aligned_cols=162  Identities=22%  Similarity=0.294  Sum_probs=133.0

Q ss_pred             CCcEEeCcCCCCCCeEEcCCCceEEecCCCCcccceeeEEecceecCCEEEEEEEEEeecCCCCCCCCCCCCCcEEEEEe
Q 015668           41 KQRVVLNPADCDLDFDIEDNGLKSSGLHQEGFAYCWSGARANVGINGGKYCFGCKIVSTQPVDMEDTPPDQQHVCRVGTS  120 (403)
Q Consensus        41 ~~~v~l~~~d~~~~l~is~d~l~~~~~~~~~~~~~~~~~Ra~~gv~~G~~YfEv~i~~~~~~~~~~~~~~~~~~~rVG~s  120 (403)
                      +..++||+.|++.++.|++|++.+...  +....+|++||++.|+.+|+|||||+|....          ....+.|||+
T Consensus        21 ~~~~~wn~~~~~~~~~ls~~~~~~~~~--~~~~~~~~~vrgt~g~ssGk~YWEV~v~~~~----------~~~~~~IGV~   88 (217)
T d2fnja1          21 QLKHSWNSEDRSLNIFVKEDDKLTFHR--HPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQ----------RGTHAVVGVC   88 (217)
T ss_dssp             HHHTSEEEEEECTTEEEETTEEEEEEE--CCCTTEEEEEEESCCBCSSEEEEEEECCGGG----------CTTCCEEEEE
T ss_pred             cccccCChhcCCCCEEEeCCCceEEEe--CCccccCCeEEEcccccCCcEEEEEEEecCC----------CCCeeEEEEE
Confidence            345689999999999999999776432  2345789999999999999999999998642          2356889999


Q ss_pred             cCCCC------CCCCCCCCcceeEec-CCceeeCCCc---------ccCCCCCCCCCEEEEEEecCCCCCceEEEEeCcc
Q 015668          121 RGDDP------VGKLGETEQSFGFGG-TGKFSHGGNF---------LNFGEKFGVGDTIICAIDLESKPLATIGFAKNGK  184 (403)
Q Consensus       121 ~~~~~------~~~lG~d~~Sygy~~-~G~~~~~~~~---------~~yG~~f~~gDVIGc~ldl~~~p~~~i~ftkNG~  184 (403)
                      +...+      ...+|.+.+||+|.. +|.++|++..         ..||++|..||||||+||++.   ++|+|+|||+
T Consensus        89 ~~~~~~~~~~~~~~~G~~~~s~~~~~~~g~~~~~~~~~~~~~~~~~~~~g~~~~~gDvIGV~LD~d~---gtLsF~kNG~  165 (217)
T d2fnja1          89 TADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMDE---GTLSFIVDQQ  165 (217)
T ss_dssp             CTTSCSEEESSCCCTTSSTTEEEEETTTTEEEESTTTSCCEESSTTCCTTCCCCCCSEEEEEEETTT---TEEEEEETTE
T ss_pred             ecccCcccCCccccccCCCCcceEecCCCEEEecCCCccccccCcccccCCccCCCCEEEEEEeCCC---CEEEEEECCE
Confidence            97653      346899999999974 6788887643         358899999999999999999   8999999999


Q ss_pred             cccccccccCCCCCCccccchhhcccCCCceEeEEEEe--CeEEEEEccCCC
Q 015668          185 WLGTAKQFDAGSNGLGVVDSAVKERQCESAVFPHILLK--NVVVVMQFSVEQ  234 (403)
Q Consensus       185 ~lg~af~~~~~~~~l~~~~~~~~g~~~~~~~fP~v~l~--~~~v~~nFG~~~  234 (403)
                      +||+||+.   +              ....|||+|+..  +++|+++|....
T Consensus       166 ~lGvAf~~---l--------------~~~~lyP~vs~~~~~~~v~~~~~~~~  200 (217)
T d2fnja1         166 YLGIAFRG---L--------------RGKKLYPIVSAVWGHCEITMRYIGGL  200 (217)
T ss_dssp             EEEEEECC---C--------------TTCCBEEEEEECCTTCEEEEEEEEEE
T ss_pred             EeeEEEeC---C--------------CCCeEEEEEEeccCCcEEEEEEcCCc
Confidence            99999972   1              145899999975  789999986553



>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fbea1 b.29.1.22 (A:1-188) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iwgb1 b.29.1.22 (B:4-182) 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure