Citrus Sinensis ID: 015680
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 403 | ||||||
| 224065090 | 841 | predicted protein [Populus trichocarpa] | 0.885 | 0.424 | 0.852 | 0.0 | |
| 224079588 | 821 | predicted protein [Populus trichocarpa] | 0.885 | 0.434 | 0.841 | 1e-177 | |
| 356552003 | 850 | PREDICTED: potassium channel SKOR-like [ | 0.875 | 0.415 | 0.844 | 1e-176 | |
| 356499077 | 849 | PREDICTED: potassium channel SKOR-like [ | 0.875 | 0.415 | 0.838 | 1e-176 | |
| 255585584 | 445 | Potassium channel SKOR, putative [Ricinu | 0.878 | 0.795 | 0.833 | 1e-174 | |
| 147777957 | 559 | hypothetical protein VITISV_022830 [Viti | 0.890 | 0.642 | 0.807 | 1e-173 | |
| 225451365 | 794 | PREDICTED: potassium channel SKOR [Vitis | 0.885 | 0.449 | 0.805 | 1e-172 | |
| 449479935 | 828 | PREDICTED: potassium channel SKOR-like [ | 0.890 | 0.433 | 0.796 | 1e-172 | |
| 449445216 | 828 | PREDICTED: potassium channel SKOR-like [ | 0.890 | 0.433 | 0.796 | 1e-172 | |
| 15232991 | 828 | Potassium channel SKOR [Arabidopsis thal | 0.878 | 0.427 | 0.768 | 1e-163 |
| >gi|224065090|ref|XP_002301665.1| predicted protein [Populus trichocarpa] gi|222843391|gb|EEE80938.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 639 bits (1648), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 306/359 (85%), Positives = 329/359 (91%)
Query: 30 KISQTLYMPYIEKVSLFKGCSSEFINQIVIRLHEEFFLPGEVIMEQGNVIDQLYFVCHGV 89
K+SQTLY YIEKV L KGCS+EFINQIVIRLHEEFFLPGEVIMEQGNV+DQLYFVCHGV
Sbjct: 397 KVSQTLYTEYIEKVPLLKGCSAEFINQIVIRLHEEFFLPGEVIMEQGNVVDQLYFVCHGV 456
Query: 90 LEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVRICELSRLLRIDKQSFTSILE 149
LEEVG+G+DGSEETV L PNSSFGE+SILCNIPQPYTVR+CEL RLLRIDKQSF++ILE
Sbjct: 457 LEEVGIGQDGSEETVKLLPPNSSFGEISILCNIPQPYTVRVCELCRLLRIDKQSFSNILE 516
Query: 150 IYFCDGRKVLTNLLEGKESNLRLKQVESDITFHIGKHEAELALRFNSAAYHGDLYQLKGL 209
IYF DGRK+L NLLEGKESNLR KQ+ESDITFHIGK EAELALR NSAAYHGDLYQLKG
Sbjct: 517 IYFYDGRKILDNLLEGKESNLRDKQLESDITFHIGKQEAELALRVNSAAYHGDLYQLKGF 576
Query: 210 IRAGADLNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHD 269
IRAGAD N+TDYDGRSPLHLA SRGYEDITLFLIQ+GVDINIKDKFGNTPLLEAIK GHD
Sbjct: 577 IRAGADPNRTDYDGRSPLHLAASRGYEDITLFLIQEGVDINIKDKFGNTPLLEAIKNGHD 636
Query: 270 GVTSLLVKEGASLNVDDAGSFLCIAVARGDSDLLKRVLSNGVDPNSRDYDHRTPLHVAAS 329
V SLL K+GA LN+DDAGS LC AVARGDSD LKR+LSNG+DPNS+DYDHRTPLHVAAS
Sbjct: 637 RVESLLFKQGAILNIDDAGSVLCRAVARGDSDFLKRILSNGIDPNSKDYDHRTPLHVAAS 696
Query: 330 EGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAKCTQLSEFHYCSQ 388
EGLYLMAKLL+EAGASVF+KDRWGNTPLDEGRMCGNK LIKLLE+AK +Q EFHY +
Sbjct: 697 EGLYLMAKLLIEAGASVFSKDRWGNTPLDEGRMCGNKKLIKLLEEAKSSQKLEFHYSTH 755
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224079588|ref|XP_002305894.1| predicted protein [Populus trichocarpa] gi|222848858|gb|EEE86405.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356552003|ref|XP_003544361.1| PREDICTED: potassium channel SKOR-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356499077|ref|XP_003518370.1| PREDICTED: potassium channel SKOR-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255585584|ref|XP_002533481.1| Potassium channel SKOR, putative [Ricinus communis] gi|223526674|gb|EEF28913.1| Potassium channel SKOR, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147777957|emb|CAN64951.1| hypothetical protein VITISV_022830 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225451365|ref|XP_002262949.1| PREDICTED: potassium channel SKOR [Vitis vinifera] gi|296087079|emb|CBI33453.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449479935|ref|XP_004155751.1| PREDICTED: potassium channel SKOR-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449445216|ref|XP_004140369.1| PREDICTED: potassium channel SKOR-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15232991|ref|NP_186934.1| Potassium channel SKOR [Arabidopsis thaliana] gi|44888539|sp|Q9M8S6.1|SKOR_ARATH RecName: Full=Potassium channel SKOR; AltName: Full=Stelar K(+) outward rectifying channel gi|6728977|gb|AAF26975.1|AC018363_20 stelar K+ outward rectifying channel (SKOR) [Arabidopsis thaliana] gi|332640345|gb|AEE73866.1| Potassium channel SKOR [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 403 | ||||||
| TAIR|locus:2075442 | 828 | SKOR "STELAR K+ outward rectif | 0.878 | 0.427 | 0.725 | 2.3e-144 | |
| TAIR|locus:2169866 | 820 | GORK "gated outwardly-rectifyi | 0.873 | 0.429 | 0.693 | 1e-139 | |
| TAIR|locus:2043839 | 857 | KT1 "AT2G26650" [Arabidopsis t | 0.851 | 0.400 | 0.306 | 1.2e-38 | |
| TAIR|locus:2127866 | 880 | KT5 "K+ transporter 5" [Arabid | 0.799 | 0.365 | 0.328 | 1.3e-38 | |
| TAIR|locus:2132065 | 802 | KT2/3 "potassium transport 2/3 | 0.826 | 0.415 | 0.301 | 3.6e-31 | |
| ZFIN|ZDB-GENE-050112-1 | 226 | psmd10 "proteasome (prosome, m | 0.429 | 0.765 | 0.372 | 2.3e-21 | |
| UNIPROTKB|O75832 | 226 | PSMD10 "26S proteasome non-ATP | 0.426 | 0.761 | 0.368 | 1e-19 | |
| WB|WBGene00007756 | 715 | C27A7.5 [Caenorhabditis elegan | 0.473 | 0.267 | 0.348 | 1.6e-19 | |
| MGI|MGI:1858898 | 231 | Psmd10 "proteasome (prosome, m | 0.426 | 0.744 | 0.368 | 2.3e-19 | |
| ZFIN|ZDB-GENE-050522-247 | 1071 | ankrd52a "ankyrin repeat domai | 0.436 | 0.164 | 0.329 | 2.4e-19 |
| TAIR|locus:2075442 SKOR "STELAR K+ outward rectifier" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1349 (479.9 bits), Expect = 2.3e-144, Sum P(2) = 2.3e-144
Identities = 257/354 (72%), Positives = 299/354 (84%)
Query: 30 KISQTLYMPYIEKVSLFKGCSSEFINQIVIRLHEEFFLPGEVIMEQGNVIDQLYFXXXXX 89
KI+QTLY+PYIEKV LF+GCSSEFINQIVIRLHEEFFLPGEVIMEQG+V+DQLYF
Sbjct: 388 KIAQTLYLPYIEKVPLFRGCSSEFINQIVIRLHEEFFLPGEVIMEQGSVVDQLYFVCHGV 447
Query: 90 XXXXXXXXXXXXXXXSQLQPNSSFGEVSILCNIPQPYTVRICELSRLLRIDKQSFTSILE 149
+ LQP+ SFGE+SILCNIPQPYTVR+ EL R+LR+DKQSF +ILE
Sbjct: 448 LEEIGITKDGSEEIVAVLQPDHSFGEISILCNIPQPYTVRVAELCRILRLDKQSFMNILE 507
Query: 150 IYFCDGRKVLTNLLEGKESNLRLKQVESDITFHIGKHEAELALRFNSAAYHGDLYQLKGL 209
I+F DGR++L NLLEGKESN+R+KQ+ESDITFHI K EAELAL+ NSAA++GDLYQLK L
Sbjct: 508 IFFHDGRRILNNLLEGKESNVRIKQLESDITFHISKQEAELALKLNSAAFYGDLYQLKSL 567
Query: 210 IRAGADLNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHD 269
IRAG D NKTDYDGRSPLHLA SRGYEDITL+LIQ+ VD+NIKDK G+TPLLEAIK G+D
Sbjct: 568 IRAGGDPNKTDYDGRSPLHLAASRGYEDITLYLIQESVDVNIKDKLGSTPLLEAIKNGND 627
Query: 270 GVTSLLVKEGASLNVDDAGSFLCIAVARGDSDLLKRVLSNGVDPNSRDYDHRTPLHVAAS 329
V +LLVKEGA+LN+++AG+FLC VA+GDSD LKR+LSNG+DPNS+DYDHRTPLHVAAS
Sbjct: 628 RVAALLVKEGATLNIENAGTFLCTVVAKGDSDFLKRLLSNGIDPNSKDYDHRTPLHVAAS 687
Query: 330 EGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAKCTQLSEF 383
EG Y++A L+EA A+V KDRWGNTPLDE CGNK LIKLLEDAK +Q+S F
Sbjct: 688 EGFYVLAIQLVEASANVLAKDRWGNTPLDEALGCGNKMLIKLLEDAKNSQISSF 741
|
|
| TAIR|locus:2169866 GORK "gated outwardly-rectifying K+ channel" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043839 KT1 "AT2G26650" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127866 KT5 "K+ transporter 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132065 KT2/3 "potassium transport 2/3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050112-1 psmd10 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75832 PSMD10 "26S proteasome non-ATPase regulatory subunit 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007756 C27A7.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858898 Psmd10 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-247 ankrd52a "ankyrin repeat domain 52a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_II001048 | hypothetical protein (841 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 403 | |||
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 3e-50 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-35 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-28 | |
| cd00038 | 115 | cd00038, CAP_ED, effector domain of the CAP family | 5e-26 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-21 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-19 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-18 | |
| smart00100 | 120 | smart00100, cNMP, Cyclic nucleotide-monophosphate | 1e-17 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 4e-17 | |
| pfam00027 | 91 | pfam00027, cNMP_binding, Cyclic nucleotide-binding | 8e-17 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 9e-17 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-16 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 7e-16 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 1e-15 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 1e-14 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 1e-14 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 1e-14 | |
| COG0664 | 214 | COG0664, Crp, cAMP-binding proteins - catabolite g | 5e-14 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 4e-13 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 8e-13 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 5e-10 | |
| PHA02798 | 489 | PHA02798, PHA02798, ankyrin-like protein; Provisio | 6e-10 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 1e-09 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-09 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 1e-09 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 3e-09 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 3e-09 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 3e-09 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 4e-09 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 6e-09 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 8e-09 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 9e-09 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-08 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-08 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-08 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 2e-08 | |
| PHA02946 | 446 | PHA02946, PHA02946, ankyin-like protein; Provision | 2e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 4e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 9e-08 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 1e-07 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 1e-07 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 2e-07 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-07 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-07 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 6e-07 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 9e-07 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-06 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 2e-06 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 4e-06 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 4e-06 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-06 | |
| PHA02798 | 489 | PHA02798, PHA02798, ankyrin-like protein; Provisio | 1e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 5e-05 | |
| PHA02917 | 661 | PHA02917, PHA02917, ankyrin-like protein; Provisio | 9e-05 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 1e-04 | |
| PHA02946 | 446 | PHA02946, PHA02946, ankyin-like protein; Provision | 2e-04 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 2e-04 | |
| PHA02736 | 154 | PHA02736, PHA02736, Viral ankyrin protein; Provisi | 4e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-04 | |
| TIGR03896 | 317 | TIGR03896, cyc_nuc_ocin, bacteriocin-type transpor | 7e-04 | |
| TIGR00870 | 743 | TIGR00870, trp, transient-receptor-potential calci | 8e-04 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 0.001 | |
| PHA02716 | 764 | PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi | 0.002 | |
| PRK09392 | 236 | PRK09392, ftrB, transcriptional activator FtrB; Pr | 0.002 | |
| PHA02798 | 489 | PHA02798, PHA02798, ankyrin-like protein; Provisio | 0.003 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 0.003 | |
| PHA02989 | 494 | PHA02989, PHA02989, ankyrin repeat protein; Provis | 0.003 |
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
Score = 180 bits (459), Expect = 3e-50
Identities = 104/322 (32%), Positives = 159/322 (49%), Gaps = 9/322 (2%)
Query: 29 RKISQTLYMPYIEKVSLFKGCSSEFINQIVIRLHEEFFLPGEVIMEQGNVIDQLYFVCHG 88
+ I Q L++P +EKV LFKG S E + +V ++ E+ P E ++ Q D +Y V G
Sbjct: 365 KSICQHLFLPVVEKVYLFKGVSREILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVVSG 424
Query: 89 VLEEVGV-GEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVRICELSRLLRIDKQSFTSI 147
+E + GE E V L FGEV LC PQ +T R LS+LLR+ +
Sbjct: 425 EVEIIDSEGEK--ERVVGTLGCGDIFGEVGALCCRPQSFTFRTKTLSQLLRLKTSTLIEA 482
Query: 148 LEIYFCDGRKVLTNLLEGKESNLRLKQVE-SDITFHIGKHEAELALRFN--SAAYHGDLY 204
++ D +L N L+ + L + D+ G + + N + A G+
Sbjct: 483 MQTRQEDNVVILKNFLQ---HHKELHDLNVGDLLGDNGGEHDDPNMASNLLTVASTGNAA 539
Query: 205 QLKGLIRAGADLNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAI 264
L+ L++A D + D GR+PLH+A S+GYED L L++ +++I+D GNT L AI
Sbjct: 540 LLEELLKAKLDPDIGDSKGRTPLHIAASKGYEDCVLVLLKHACNVHIRDANGNTALWNAI 599
Query: 265 KCGHDGVTSLLVKEGASLNVDDAGSFLCIAVARGDSDLLKRVLSNGVDPNSRDYDHRTPL 324
H + +L + + AG LC A R D +K +L G++ +S D+ T L
Sbjct: 600 SAKHHKIFRILYHFASISDPHAAGDLLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATAL 659
Query: 325 HVAASEGLYLMAKLLLEAGASV 346
VA +E M +LL+ GA V
Sbjct: 660 QVAMAEDHVDMVRLLIMNGADV 681
|
Length = 823 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234384 TIGR03896, cyc_nuc_ocin, bacteriocin-type transport-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181817 PRK09392, ftrB, transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.98 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.98 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.98 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.98 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.97 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.97 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.97 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.97 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.96 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.96 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.96 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.96 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.95 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.94 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.94 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.94 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.94 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.94 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.93 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.93 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.92 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.92 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.92 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.91 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.91 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.91 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.9 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.9 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.89 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.89 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.88 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.87 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.87 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.86 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.86 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.85 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.85 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.84 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 99.83 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.83 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.82 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.81 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.79 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.78 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.77 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.77 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.76 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.75 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.75 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.74 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 99.7 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.68 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.63 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.62 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 99.62 | |
| cd00038 | 115 | CAP_ED effector domain of the CAP family of transc | 99.61 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 99.58 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 99.55 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.55 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 99.55 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 99.55 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 99.55 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.53 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.53 | |
| COG0664 | 214 | Crp cAMP-binding proteins - catabolite gene activa | 99.52 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.52 | |
| KOG1113 | 368 | consensus cAMP-dependent protein kinase types I an | 99.5 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.45 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.45 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.44 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.43 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.43 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 99.42 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.42 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.39 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.39 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 99.38 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 99.38 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.36 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.35 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 99.33 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.28 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 99.23 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 99.0 | |
| KOG1113 | 368 | consensus cAMP-dependent protein kinase types I an | 99.0 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.9 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.89 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.88 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.88 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 98.82 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.81 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.75 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.75 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.73 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.72 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.71 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.7 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.66 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.65 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.64 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 98.62 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.54 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.53 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.5 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.48 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.44 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.16 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 98.13 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.11 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.05 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 98.02 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 98.01 | |
| PF04831 | 153 | Popeye: Popeye protein conserved region; InterPro: | 97.87 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 97.55 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 97.5 | |
| PRK11832 | 207 | putative DNA-binding transcriptional regulator; Pr | 97.35 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 97.01 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.77 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.65 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 96.02 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 95.93 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 95.87 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 95.03 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 94.92 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 94.75 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 91.06 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 87.28 |
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-50 Score=414.04 Aligned_cols=349 Identities=29% Similarity=0.450 Sum_probs=317.2
Q ss_pred ccceeeeeeeecChhhHHHHHHhHHhhhccCCCCCCCHHHHHHHHHHhheeeeCCCCeEEecCCccCeEEEEeeeEEEEE
Q 015680 14 KEEVRYLLWIRLYPVRKISQTLYMPYIEKVSLFKGCSSEFINQIVIRLHEEFFLPGEVIMEQGNVIDQLYFVCHGVLEEV 93 (403)
Q Consensus 14 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~ge~i~~~g~~~~~~~~v~~G~v~~~ 93 (403)
.++.++++.||..++.+++++++.+.++++++|++++++++.++...++.+.|+|||.|+.+||.++.+|||++|.|+++
T Consensus 350 ~~~~~~l~~Lp~~Lr~~i~~~l~~~~l~~~~lF~~~s~~~l~~L~~~~~~~~~~pge~I~~qge~~~~lY~I~~G~V~i~ 429 (823)
T PLN03192 350 LNQQQLIDQLPKSICKSICQHLFLPVVEKVYLFKGVSREILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVVSGEVEII 429 (823)
T ss_pred ccHHHHHHHcCHHHHHHHHHHHHHHHHhhCcchhcCCHHHHHHHHHhhheeeeCCCCEEEECCCCCceEEEEEecEEEEE
Confidence 45678999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred eecCCCCeeEeeeecCCCcccccccccCCCcceeEEEeccceeeeechHhHHHHHHHHhhcchHHHHHhhhcccc----c
Q 015680 94 GVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVRICELSRLLRIDKQSFTSILEIYFCDGRKVLTNLLEGKES----N 169 (403)
Q Consensus 94 ~~~~~g~~~~~~~~~~G~~~g~~~ll~~~~~~~~~~a~~~~~~~~i~~~~~~~l~~~~~~~~~~ll~~ll~~~~~----~ 169 (403)
. ..+|++.++..+.+|++||+.+++.+.+++++++|.++|++++++++.|.++++.+++....++..+++.... .
T Consensus 430 ~-~~~~~e~~l~~l~~Gd~FGE~~~l~~~p~~~t~ra~~~s~ll~l~~~~f~~ll~~~p~d~~~i~~~~l~~~~~l~~l~ 508 (823)
T PLN03192 430 D-SEGEKERVVGTLGCGDIFGEVGALCCRPQSFTFRTKTLSQLLRLKTSTLIEAMQTRQEDNVVILKNFLQHHKELHDLN 508 (823)
T ss_pred E-ecCCcceeeEEccCCCEecchHHhcCCCCCCeEEEcccEEEEEEEHHHHHHHHHHhhHHHHHHHHHHHHHhhhhcccc
Confidence 5 5567888999999999999999999999999999999999999999999999999999999999988875321 1
Q ss_pred hhhhhcccceeeecCcchhhHhhhHHHhhccCCHHHHHHHHHcCCCccccCCCCCcHHHHHHHcCcHHHHHHHHhcCCCC
Q 015680 170 LRLKQVESDITFHIGKHEAELALRFNSAAYHGDLYQLKGLIRAGADLNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDI 249 (403)
Q Consensus 170 ~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~ 249 (403)
+.....+... ...+.+..++|+.||..|+.++++.|++.|+++|..|..|+||||+|+..|+.+++++|+++|+++
T Consensus 509 v~~ll~~~~~----~~~~~~~~~~L~~Aa~~g~~~~l~~Ll~~G~d~n~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~gadi 584 (823)
T PLN03192 509 VGDLLGDNGG----EHDDPNMASNLLTVASTGNAALLEELLKAKLDPDIGDSKGRTPLHIAASKGYEDCVLVLLKHACNV 584 (823)
T ss_pred HHHHHhhccc----ccCCccchhHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcChHHHHHHHHhcCCCC
Confidence 1111111111 122334568899999999999999999999999999999999999999999999999999999999
Q ss_pred CcCCCCCCcHHHHHHHcCChHHHHHHHHcCCCccccCCCchHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCChHHHHHHH
Q 015680 250 NIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCIAVARGDSDLLKRVLSNGVDPNSRDYDHRTPLHVAAS 329 (403)
Q Consensus 250 ~~~~~~g~t~l~~A~~~~~~~~v~~L~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~~~~~~~~~~~g~t~Lh~A~~ 329 (403)
|.+|..|+||||+|+..|+.+++++|++.++..+..++.++||+|+..|+.++++.|+++|++++.+|.+|+||||+|+.
T Consensus 585 n~~d~~G~TpL~~A~~~g~~~iv~~L~~~~~~~~~~~~~~~L~~Aa~~g~~~~v~~Ll~~Gadin~~d~~G~TpLh~A~~ 664 (823)
T PLN03192 585 HIRDANGNTALWNAISAKHHKIFRILYHFASISDPHAAGDLLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATALQVAMA 664 (823)
T ss_pred CCcCCCCCCHHHHHHHhCCHHHHHHHHhcCcccCcccCchHHHHHHHhCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH
Confidence 99999999999999999999999999999888887888899999999999999999999999999999999999999999
Q ss_pred cCcHHHHHHHHHcCCCcccCCCCC-CCHHHHHHHcCCHH
Q 015680 330 EGLYLMAKLLLEAGASVFTKDRWG-NTPLDEGRMCGNKN 367 (403)
Q Consensus 330 ~~~~~~~~~Ll~~g~d~~~~~~~g-~t~l~~A~~~~~~~ 367 (403)
.|+.+++++|+++|+|++..|..| .||++++......+
T Consensus 665 ~g~~~iv~~Ll~~GAdv~~~~~~g~~t~~~l~~~~~~~~ 703 (823)
T PLN03192 665 EDHVDMVRLLIMNGADVDKANTDDDFSPTELRELLQKRE 703 (823)
T ss_pred CCcHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHHHHhh
Confidence 999999999999999999999988 89999887655444
|
|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11832 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 403 | ||||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-29 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-28 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-28 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-26 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-24 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-21 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 4e-21 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 4e-21 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 5e-11 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 1e-20 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 3e-19 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 7e-04 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 4e-19 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 6e-19 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 9e-19 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 1e-18 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 1e-18 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 8e-04 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 6e-18 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-17 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 4e-16 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 1e-07 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-17 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-17 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 5e-17 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 7e-17 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 1e-16 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 1e-16 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 3e-16 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 3e-07 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 3e-16 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 5e-16 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-05 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 6e-16 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 1e-05 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 7e-16 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 8e-16 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 8e-16 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 1e-05 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 1e-15 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-15 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 2e-14 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 8e-08 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 3e-14 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 5e-11 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 3e-14 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 4e-14 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 3e-11 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 4e-14 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 6e-11 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 2e-10 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 2e-13 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 2e-13 | ||
| 2f8y_A | 223 | Crystal Structure Of Human Notch1 Ankyrin Repeats T | 3e-12 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 5e-12 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-09 | ||
| 2f8x_K | 256 | Crystal Structure Of Activated Notch, Csl And Maml | 5e-12 | ||
| 1myo_A | 118 | Solution Structure Of Myotrophin, Nmr, 44 Structure | 1e-11 | ||
| 1yyh_A | 253 | Crystal Structure Of The Human Notch 1 Ankyrin Doma | 2e-11 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 2e-11 | ||
| 2he0_A | 253 | Crystal Structure Of A Human Notch1 Ankyrin Domain | 2e-11 | ||
| 3aaa_C | 123 | Crystal Structure Of Actin Capping Protein In Compl | 4e-11 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 4e-11 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 7e-05 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 4e-11 | ||
| 2rfm_A | 192 | Structure Of A Thermophilic Ankyrin Repeat Protein | 1e-10 | ||
| 2qc9_A | 210 | Mouse Notch 1 Ankyrin Repeat Intracellular Domain L | 1e-10 | ||
| 2zgd_A | 110 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 2e-10 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 3e-10 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 3e-10 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 1e-09 | ||
| 3zkj_A | 261 | Crystal Structure Of Ankyrin Repeat And Socs Box-co | 4e-10 | ||
| 1ot8_A | 239 | Structure Of The Ankyrin Domain Of The Drosophila N | 5e-10 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 5e-10 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 6e-10 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 9e-10 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 1e-09 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 9e-05 | ||
| 3hra_A | 201 | Crystal Structure Of Ef0377 An Ankyrin Repeat Prote | 2e-09 | ||
| 3hra_A | 201 | Crystal Structure Of Ef0377 An Ankyrin Repeat Prote | 6e-07 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 2e-09 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 3e-09 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 7e-09 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-08 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 8e-09 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 3e-08 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 8e-09 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-08 | ||
| 1bi8_B | 166 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 9e-09 | ||
| 1bi8_B | 166 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 5e-06 | ||
| 3d9h_A | 285 | Crystal Structure Of The Splice Variant Of Human As | 9e-09 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 1e-08 | ||
| 1bd8_A | 156 | Structure Of Cdk Inhibitor P19ink4d Length = 156 | 2e-08 | ||
| 1bd8_A | 156 | Structure Of Cdk Inhibitor P19ink4d Length = 156 | 7e-06 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 2e-08 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 2e-08 | ||
| 3v30_A | 172 | Crystal Structure Of The Peptide Bound Complex Of T | 2e-08 | ||
| 3v30_A | 172 | Crystal Structure Of The Peptide Bound Complex Of T | 4e-06 | ||
| 1ap7_A | 168 | P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 | 2e-08 | ||
| 1ap7_A | 168 | P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 | 1e-07 | ||
| 1blx_B | 166 | P19ink4dCDK6 COMPLEX Length = 166 | 3e-08 | ||
| 1blx_B | 166 | P19ink4dCDK6 COMPLEX Length = 166 | 9e-08 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 3e-08 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 5e-08 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 4e-06 | ||
| 2dzn_A | 228 | Crystal Structure Analysis Of Yeast Nas6p Complexed | 2e-07 | ||
| 1wg0_A | 243 | Structural Comparison Of Nas6p Protein Structures I | 2e-07 | ||
| 1ixv_A | 231 | Crystal Structure Analysis Of Homolog Of Oncoprotei | 3e-07 | ||
| 1wdy_A | 285 | Crystal Structure Of Ribonuclease Length = 285 | 8e-07 | ||
| 3jue_A | 368 | Crystal Structure Of Arfgap And Ank Repeat Domain O | 9e-07 | ||
| 3t9k_A | 390 | Crystal Structure Of Acap1 C-portion Mutant S554d F | 9e-07 | ||
| 4f1p_A | 368 | Crystal Structure Of Mutant S554d For Arfgap And An | 9e-07 | ||
| 4g8k_A | 337 | Intact Sensor Domain Of Human Rnase L In The Inacti | 1e-06 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 3e-06 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 1e-05 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 6e-06 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 9e-06 | ||
| 1mx6_A | 168 | Structure Of P18ink4c (F92n) Length = 168 | 6e-06 | ||
| 1ymp_A | 135 | The Crystal Structure Of A Partial Mouse Notch-1 An | 1e-05 | ||
| 1mx2_A | 168 | Structure Of F71n Mutant Of P18ink4c Length = 168 | 1e-05 | ||
| 4hbd_A | 276 | Crystal Structure Of Kank2 Ankyrin Repeats Length = | 1e-05 | ||
| 2fo1_E | 373 | Crystal Structure Of The Csl-Notch-Mastermind Terna | 2e-05 | ||
| 1mx4_A | 168 | Structure Of P18ink4c (F82q) Length = 168 | 3e-05 | ||
| 1ihb_A | 162 | Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | 5e-05 | ||
| 1bu9_A | 168 | Solution Structure Of P18-Ink4c, 21 Structures Leng | 7e-05 | ||
| 3etq_A | 204 | X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 | 8e-05 | ||
| 1nfi_E | 213 | I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | 1e-04 | ||
| 1nfi_E | 213 | I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | 4e-04 | ||
| 3otf_A | 220 | Structural Basis For The Camp-Dependent Gating In H | 1e-04 | ||
| 1ikn_D | 236 | IkappabalphaNF-Kappab Complex Length = 236 | 2e-04 | ||
| 1ikn_D | 236 | IkappabalphaNF-Kappab Complex Length = 236 | 5e-04 | ||
| 1d9s_A | 136 | Tumor Suppressor P15(Ink4b) Structure By Comparativ | 2e-04 | ||
| 3ljn_A | 364 | Ankyrin Repeat Protein From Leishmania Major Length | 3e-04 | ||
| 1bi7_B | 156 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 4e-04 | ||
| 2vge_A | 229 | Crystal Structure Of The C-Terminal Region Of Human | 4e-04 |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
|
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 | Back alignment and structure |
| >pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 | Back alignment and structure |
| >pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 | Back alignment and structure |
| >pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 | Back alignment and structure |
| >pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 | Back alignment and structure |
| >pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 | Back alignment and structure |
| >pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 | Back alignment and structure |
| >pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 | Back alignment and structure |
| >pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 | Back alignment and structure |
| >pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 | Back alignment and structure |
| >pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 | Back alignment and structure |
| >pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 | Back alignment and structure |
| >pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 | Back alignment and structure |
| >pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 | Back alignment and structure |
| >pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 | Back alignment and structure |
| >pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
| >pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 | Back alignment and structure |
| >pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 | Back alignment and structure |
| >pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 | Back alignment and structure |
| >pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 | Back alignment and structure |
| >pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 | Back alignment and structure |
| >pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
| >pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 | Back alignment and structure |
| >pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 | Back alignment and structure |
| >pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 | Back alignment and structure |
| >pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 | Back alignment and structure |
| >pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 | Back alignment and structure |
| >pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 | Back alignment and structure |
| >pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 | Back alignment and structure |
| >pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 | Back alignment and structure |
| >pdb|3ETQ|A Chain A, X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 C- Terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations Length = 204 | Back alignment and structure |
| >pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | Back alignment and structure |
| >pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | Back alignment and structure |
| >pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 | Back alignment and structure |
| >pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 | Back alignment and structure |
| >pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 | Back alignment and structure |
| >pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 | Back alignment and structure |
| >pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 | Back alignment and structure |
| >pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 403 | |||
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-48 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-37 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-37 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-26 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-20 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-48 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 3e-47 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-46 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-45 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-43 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-41 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-28 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-12 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 8e-48 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-44 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-35 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 7e-35 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 7e-46 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-36 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 7e-45 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-43 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-37 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-44 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-40 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-31 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-25 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 7e-21 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-44 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-42 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-36 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-35 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-43 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-40 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-29 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-24 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 5e-11 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-43 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-39 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 8e-37 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-29 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-42 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 6e-35 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-25 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-21 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-42 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-31 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-19 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-14 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-42 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-39 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-28 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 6e-42 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 6e-37 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 9e-36 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-33 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-33 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-29 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-27 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-41 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-38 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-33 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 1e-27 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-41 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-36 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-27 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-26 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-41 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-38 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 8e-34 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-31 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-41 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-32 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-20 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 3e-14 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 5e-08 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 5e-40 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-28 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 7e-40 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-39 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-36 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-33 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-26 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-16 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-40 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-32 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-39 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-35 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-34 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 9e-34 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 9e-26 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 5e-22 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-14 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 9e-10 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 7e-39 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 9e-18 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-11 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 8e-39 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-32 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-38 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-35 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-33 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-38 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-35 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 7e-33 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 4e-17 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-06 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-38 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 4e-08 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 6e-38 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-33 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-13 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-37 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-36 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-28 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-21 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-20 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-36 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 5e-29 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-21 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-13 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 1e-35 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-35 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-29 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-23 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-20 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-35 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-30 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-30 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 5e-19 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 5e-12 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-06 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-35 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 8e-32 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-20 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 6e-35 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-24 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-15 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 7e-35 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 4e-29 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 6e-29 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 7e-35 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 6e-33 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-32 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 4e-08 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 7e-35 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 1e-30 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-27 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-33 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-32 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-19 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-15 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 2e-33 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 2e-32 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-31 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-26 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-17 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-31 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-14 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-31 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-30 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 1e-30 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 6e-30 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-27 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-16 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 7e-30 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 9e-26 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 2e-13 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 7e-13 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 6e-29 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-27 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-20 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-10 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-26 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 6e-26 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 6e-24 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 3e-15 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-13 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 4e-25 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 6e-24 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-14 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 2e-08 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-24 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 6e-23 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 4e-17 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 1e-09 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-06 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 1e-23 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-23 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-23 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 5e-20 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 9e-20 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 1e-19 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 5e-16 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 1e-19 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 2e-19 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 3e-19 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 6e-19 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 3e-18 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-18 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 8e-17 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 3e-10 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 5e-08 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 1e-18 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 2e-14 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 1e-18 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 3e-18 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 4e-16 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 7e-18 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 1e-17 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 2e-14 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 4e-17 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 5e-16 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 5e-14 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 9e-16 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 2e-15 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 2e-15 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 6e-13 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 3e-15 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 5e-15 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 7e-15 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 2e-14 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 2e-13 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 2e-14 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 3e-14 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 3e-14 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 3e-14 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 6e-14 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 1e-13 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 4e-13 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 3e-10 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 9e-10 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 6e-13 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-12 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-12 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 3e-12 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 6e-12 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 2e-11 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 6e-11 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 2e-10 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 5e-10 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 9e-10 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 1e-09 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 5e-09 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 3e-08 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 4e-08 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 2byv_E | 999 | RAP guanine nucleotide exchange factor 4; EPAC2, C | 3e-07 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 3e-06 | |
| 3uo9_A | 534 | Glutaminase kidney isoform, mitochondrial; hydrola | 5e-06 | |
| 3uo9_A | 534 | Glutaminase kidney isoform, mitochondrial; hydrola | 6e-04 |
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
Score = 164 bits (418), Expect = 4e-48
Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 2/177 (1%)
Query: 197 AAYHGDLYQLKGLIRAGADLNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFG 256
AA HG L+ LI G +N D SPLH A G+ L++ G +N
Sbjct: 66 AAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADW 125
Query: 257 NTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSF-LCIAVARGDSDLLKRVLSNGVDPNS 315
+TPL A G +LL++ GAS+ + + + A RG + + +++ G + +
Sbjct: 126 HTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNIDH 185
Query: 316 RDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLL 372
+ TPL++A K LLE+GA V + + ++PL ++ L LL
Sbjct: 186 KISHLGTPLYLACENQQRACVKKLLESGADV-NQGKGQDSPLHAVVRTASEELACLL 241
|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 | Back alignment and structure |
|---|
| >3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 | Back alignment and structure |
|---|
| >3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 100.0 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 100.0 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 100.0 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 100.0 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 100.0 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.98 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.98 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.97 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.97 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.97 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.97 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.97 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.97 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.97 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.97 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.97 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.97 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.97 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.97 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.97 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.97 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.97 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.97 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.97 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.96 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.96 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.96 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.96 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.96 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.96 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.95 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.95 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.95 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.95 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.94 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.94 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.94 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.94 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.93 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.93 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.93 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.93 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.93 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.92 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.92 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.91 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.91 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.91 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.9 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.9 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.9 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.9 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.9 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.89 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.89 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.89 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.87 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.87 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.87 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.87 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.87 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.85 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.84 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 99.84 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 99.83 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 99.83 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.82 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 99.8 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 99.8 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 99.8 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 99.79 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 99.79 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 99.78 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.78 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 99.77 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 99.76 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.75 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 99.75 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 99.75 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 99.74 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 99.74 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 99.74 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 99.73 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.73 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 99.73 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 99.72 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 99.72 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 99.71 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.71 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 99.7 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 99.7 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 99.69 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 99.69 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 99.67 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 99.66 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.66 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.65 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.65 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 99.65 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 99.64 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 99.64 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 99.61 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 99.61 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 99.61 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 99.6 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.59 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 99.57 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 99.57 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 99.56 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 99.54 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 99.54 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 99.48 | |
| 3cf6_E | 694 | RAP guanine nucleotide exchange factor (GEF) 4; EP | 99.47 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.47 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 99.43 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.38 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 99.34 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 99.22 |
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
Probab=100.00 E-value=8.9e-39 Score=289.48 Aligned_cols=210 Identities=24% Similarity=0.245 Sum_probs=186.1
Q ss_pred CcchhhHhhhHHHhhccCCHHHHHHHHHcCCC---ccccCCCCCcHHHHHHHcCcHHHHHHHHhcCCCCCcCCCCCCcHH
Q 015680 184 GKHEAELALRFNSAAYHGDLYQLKGLIRAGAD---LNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPL 260 (403)
Q Consensus 184 ~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~---~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~g~t~l 260 (403)
+..+..|.||||+|+..|+.+++++|++.|++ ++.++..|+||||+|+..|+.+++++|+++|++++.+|..|.|||
T Consensus 3 ~~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~tpL 82 (282)
T 1oy3_D 3 GYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTAL 82 (282)
T ss_dssp CCCCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHH
T ss_pred CccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHH
Confidence 34567889999999999999999999999988 788899999999999999999999999999999999999999999
Q ss_pred HHHHHcCChHHHHHHHHcCCC-----------------------------------------------ccc--cCCCchH
Q 015680 261 LEAIKCGHDGVTSLLVKEGAS-----------------------------------------------LNV--DDAGSFL 291 (403)
Q Consensus 261 ~~A~~~~~~~~v~~L~~~~~~-----------------------------------------------~~~--~~~~~~l 291 (403)
|+|+..|+.+++++|++++++ ++. ..|.|||
T Consensus 83 ~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~L 162 (282)
T 1oy3_D 83 HLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPL 162 (282)
T ss_dssp HHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHH
T ss_pred HHHHHcCCcchhHhhhccCCCCchhhHHHHhhcccccCcchhcchhhhccccccchhhhhhhhhhhhcCCCcCCCCcCHH
Confidence 999999999999999998765 222 2477999
Q ss_pred HHHHHcCCHHHHHHHHHCCCCCCCCCCC-CChHHHHHHHcCcHHHHHHHHHcCCCcccCCCCCCCHHHHHHHcCCHHHHH
Q 015680 292 CIAVARGDSDLLKRVLSNGVDPNSRDYD-HRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIK 370 (403)
Q Consensus 292 ~~a~~~~~~~~v~~Ll~~~~~~~~~~~~-g~t~Lh~A~~~~~~~~~~~Ll~~g~d~~~~~~~g~t~l~~A~~~~~~~~v~ 370 (403)
|+|+..|+.+++++|+++|++++..+.. |+||||+|+..|+.+++++|+++|++++.+|..|.||||+|+.+|+.++++
T Consensus 163 ~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~~~~v~~Ll~~gad~~~~d~~g~tpL~~A~~~~~~~~v~ 242 (282)
T 1oy3_D 163 HVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILAR 242 (282)
T ss_dssp HHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHHH
T ss_pred HHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcCHHHHHHHcCCHHHHHHHHHcCCCCcccccCCCCHHHHHHHcCCcHHHH
Confidence 9999999999999999999999999854 999999999999999999999999999999999999999999999999999
Q ss_pred HHHHccccccccccccccchhhhh
Q 015680 371 LLEDAKCTQLSEFHYCSQGMIGIA 394 (403)
Q Consensus 371 ~Ll~~~~~~~~~~~~~~~~~~~~~ 394 (403)
+|+++|++..... ..+.+++.++
T Consensus 243 ~Ll~~ga~~~~~~-~~g~tpl~~a 265 (282)
T 1oy3_D 243 LLRAHGAPEPEDG-GDKLSPCSSS 265 (282)
T ss_dssp HHHHTTCCCCCCC-----------
T ss_pred HHHHcCCCcCcCC-Cccccccccc
Confidence 9999999866543 4445555554
|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 403 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-35 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 6e-28 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-26 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 7e-25 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 8e-21 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 8e-19 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-16 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-16 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-16 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-09 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-26 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 6e-24 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-24 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-20 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-17 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-13 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-21 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-17 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-13 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-13 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 9e-13 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-19 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-14 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 5e-13 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 9e-11 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-18 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-16 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 5e-15 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-10 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.001 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 4e-18 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 2e-05 | |
| d1cx4a1 | 136 | b.82.3.2 (A:130-265) Regulatory subunit of Protein | 3e-16 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 8e-16 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-11 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-09 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-08 | |
| d1ne6a2 | 132 | b.82.3.2 (A:245-376) Regulatory subunit of Protein | 2e-15 | |
| d1ne6a1 | 136 | b.82.3.2 (A:109-244) Regulatory subunit of Protein | 2e-15 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-15 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-14 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-12 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-10 | |
| d1cx4a2 | 147 | b.82.3.2 (A:266-412) Regulatory subunit of Protein | 7e-15 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 8e-15 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 6e-14 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 1e-09 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 7e-08 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 5e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 5e-05 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 9e-15 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-11 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-07 | |
| d1vp6a_ | 133 | b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo | 1e-12 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 2e-12 | |
| d1wgpa_ | 137 | b.82.3.2 (A:) Probable cyclic nucleotide-gated ion | 2e-12 | |
| d2gaua2 | 142 | b.82.3.2 (A:10-151) Transcriptional regulator PG03 | 8e-12 | |
| d1o7fa2 | 155 | b.82.3.2 (A:13-167) Regulatory domain of Epac2, do | 1e-11 | |
| d1i5za2 | 132 | b.82.3.2 (A:6-137) Catabolite gene activator prote | 7e-11 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 8e-11 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 6e-09 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-04 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-11 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-10 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-09 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-07 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-06 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 8e-10 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 6e-09 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 1e-04 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 1e-09 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 3e-09 | |
| d1o7fa3 | 124 | b.82.3.2 (A:322-445) Regulatory domain of Epac2, d | 2e-09 | |
| d2oz6a2 | 134 | b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei | 6e-09 | |
| d1zyba2 | 147 | b.82.3.2 (A:1-147) Probable transcription regulato | 6e-09 | |
| d1q3ea_ | 193 | b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu | 2e-08 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 2e-06 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 5e-04 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 6e-04 | |
| d2zcwa2 | 112 | b.82.3.2 (A:6-117) Transcriptional regulator TTHA1 | 6e-06 | |
| d1o5la1 | 129 | b.82.3.2 (A:1-129) CRP-like transcriptional regula | 8e-06 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 2e-05 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 0.003 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 132 bits (332), Expect = 3e-35
Identities = 52/218 (23%), Positives = 84/218 (38%), Gaps = 35/218 (16%)
Query: 197 AAYHGDLYQLKGLIRAGADLNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFG 256
A++ G L +K L++ GA N ++ +PLH+A G+ ++ +L+Q +N K K
Sbjct: 7 ASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD 66
Query: 257 NTPLLEAIKCGHDGVTSLLVKEGASLN--------------------------------- 283
TPL A + GH + LL++ A+ N
Sbjct: 67 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQA 126
Query: 284 -VDDAGSF-LCIAVARGDSDLLKRVLSNGVDPNSRDYDHRTPLHVAASEGLYLMAKLLLE 341
+ G L +A G + + +L PN+ + TPLHVA + KLLL
Sbjct: 127 CMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP 186
Query: 342 AGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAKCTQ 379
G S + G TPL + + L +
Sbjct: 187 RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA 224
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 100.0 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.98 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.97 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.97 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.97 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.97 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.97 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.96 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.96 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.96 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.96 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.96 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.95 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.95 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.95 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.95 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.95 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.94 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.93 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.93 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.92 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.92 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.91 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.91 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.91 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.9 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.88 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.87 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.81 | |
| d1ne6a2 | 132 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.8 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 99.79 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 99.79 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 99.78 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 99.77 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 99.77 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 99.76 | |
| d1o7fa2 | 155 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.74 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 99.73 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 99.72 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 99.71 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 99.7 | |
| d1wgpa_ | 137 | Probable cyclic nucleotide-gated ion channel 6 {Th | 99.69 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 99.67 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 99.65 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 99.63 | |
| d2bgca2 | 131 | Listeriolysin regulatory protein PrfA, N-terminal | 96.48 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 90.4 |
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Transcription factor inhibitor I-kappa-B-beta, IKBB species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=1.4e-37 Score=275.55 Aligned_cols=192 Identities=25% Similarity=0.270 Sum_probs=176.2
Q ss_pred hhhHhhhHHHhhccCCHHHHHHHHHcCCC---ccccCCCCCcHHHHHHHcCcHHHHHHHHhcCCCCCcCCCCCCcHHHHH
Q 015680 187 EAELALRFNSAAYHGDLYQLKGLIRAGAD---LNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEA 263 (403)
Q Consensus 187 ~~~~~~~l~~a~~~~~~~~~~~ll~~~~~---~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~g~t~l~~A 263 (403)
+.+|.||||+||..|+.+++++|+++|++ ++..+..|.||||+|+..|+.+++++|+++|++++.+|..|.||||+|
T Consensus 6 ~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A 85 (255)
T d1oy3d_ 6 TEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLA 85 (255)
T ss_dssp CTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHH
T ss_pred CcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhhh
Confidence 46789999999999999999999999887 667788999999999999999999999999999999999999999999
Q ss_pred HHcCChHHHHHHHHcCCCc-----------------------------------------------cc--cCCCchHHHH
Q 015680 264 IKCGHDGVTSLLVKEGASL-----------------------------------------------NV--DDAGSFLCIA 294 (403)
Q Consensus 264 ~~~~~~~~v~~L~~~~~~~-----------------------------------------------~~--~~~~~~l~~a 294 (403)
+..++.+++++|++.+... +. .+|.||||+|
T Consensus 86 ~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A 165 (255)
T d1oy3d_ 86 CRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVA 165 (255)
T ss_dssp TTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHH
T ss_pred hccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccccccc
Confidence 9999999999997653210 11 2356999999
Q ss_pred HHcCCHHHHHHHHHCCCCCCCC-CCCCChHHHHHHHcCcHHHHHHHHHcCCCcccCCCCCCCHHHHHHHcCCHHHHHHHH
Q 015680 295 VARGDSDLLKRVLSNGVDPNSR-DYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLE 373 (403)
Q Consensus 295 ~~~~~~~~v~~Ll~~~~~~~~~-~~~g~t~Lh~A~~~~~~~~~~~Ll~~g~d~~~~~~~g~t~l~~A~~~~~~~~v~~Ll 373 (403)
+..++.+++++|++.+++.+.. +..|.||||+|+..|+.+++++|+++|+|++.+|..|.||||+|+.+++.+++++|+
T Consensus 166 ~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i~~~Ll 245 (255)
T d1oy3d_ 166 VIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLR 245 (255)
T ss_dssp HHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHHHHHH
T ss_pred ccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHH
Confidence 9999999999999999988754 578999999999999999999999999999999999999999999999999999999
Q ss_pred Hcccc
Q 015680 374 DAKCT 378 (403)
Q Consensus 374 ~~~~~ 378 (403)
++||+
T Consensus 246 ~~Ga~ 250 (255)
T d1oy3d_ 246 AHGAP 250 (255)
T ss_dssp HTTCC
T ss_pred HcCCC
Confidence 99996
|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|