Citrus Sinensis ID: 015687


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--
MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSSW
cccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccc
ccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHccc
mslrpnartevrrSKYKVAvdaeegrrrrEDNMVEIRKNKREESLLKKRREGlqahqpltnsaaldnkkleslpamvagvwsddrniqLDATTQFRKLLSiersppineviqsgvvprfieflsrddfpqLQFEAAWALTniasgtsentrvvidhgAVPIFVRLlssptddvREQAVWALGnvagdspkcrdlvlsngalmPLLAQFNEHAKLSMLRNATWTlsnfcrgkpqplfeqtrpalpaLERLihsnddevLTDACWALsylsdgtnDKIQAVIEAGVCPRLvellrhpspsvlipalrtvgnivtgddmqtqciinhqalPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISnatsggssw
mslrpnartevrrskykvavdaeegrrrrednmveirknkreesllkkrreglqahqpltnsaaldnkklESLPAMVAGVWSDDRNIQLDATTQFRKLlsiersppineviqsGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWAlgnvagdspKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLrhpspsvlipALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISnatsggssw
MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNqiqaiieagiigPLVNLLLNAEFEIKKEAAWAISNATSGGSSW
*************************************************************************PAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAI**********
************************************RK**REESLLK************************SLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGG***
*************SKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAIS*********
******************AVDAEEGRRRREDNMVEIRKNKREESLLKK***************ALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSSW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query402 2.2.26 [Sep-21-2011]
Q71VM4 526 Importin subunit alpha-1a yes no 0.995 0.760 0.872 0.0
O22478 527 Importin subunit alpha OS N/A no 0.995 0.759 0.838 0.0
Q96321 532 Importin subunit alpha-1 no no 0.995 0.751 0.810 0.0
Q9SLX0 534 Importin subunit alpha-1b no no 0.995 0.749 0.796 0.0
O04294 531 Importin subunit alpha-2 no no 0.995 0.753 0.757 1e-180
Q76P29 516 Importin subunit alpha-B yes no 0.975 0.759 0.638 1e-142
O94374 539 Importin subunit alpha-2 yes no 0.960 0.716 0.558 1e-116
O35345 536 Importin subunit alpha-7 yes no 0.910 0.682 0.579 1e-116
O14063 542 Importin subunit alpha-1 no no 0.965 0.715 0.567 1e-116
Q0V7M0 536 Importin subunit alpha-7 yes no 0.910 0.682 0.579 1e-116
>sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 Back     alignment and function desciption
 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/401 (87%), Positives = 375/401 (93%), Gaps = 1/401 (0%)

Query: 1   MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLT 60
           MSLRP+ R EVRR++YKVAVDAEEGRRRREDNMVEIRK++REESLLKKRREGLQA  P+ 
Sbjct: 1   MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVP 60

Query: 61  NSAALD-NKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRF 119
            SAA   +KKLESLPAM+ GV+SDD N+QL+ATTQFRKLLSIERSPPI EVIQSGVVPRF
Sbjct: 61  ASAATGVDKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRF 120

Query: 120 IEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVW 179
           ++FL+R+DFPQLQFEAAWALTNIASGTSENT+VVIDHGAVPIFV+LL S +DDVREQAVW
Sbjct: 121 VQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVW 180

Query: 180 ALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQT 239
           ALGNVAGDSPKCRDLVL+NGAL+PLLAQ NEH KLSMLRNATWTLSNFCRGKPQP FEQT
Sbjct: 181 ALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFEQT 240

Query: 240 RPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSV 299
           RPALPAL RLIHSND+EVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELL HPSPSV
Sbjct: 241 RPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSV 300

Query: 300 LIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVN 359
           LIPALRTVGNIVTGDD QTQCII+HQALPCLL LLTQN KKSIKKEACWTISNITAGN +
Sbjct: 301 LIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKD 360

Query: 360 QIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGS 400
           QIQA+I AGIIGPLVNLL  AEF+IKKEAAWAISNATSGGS
Sbjct: 361 QIQAVINAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGS 401




Functions in nuclear protein import. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Promotes docking of import substrates to the nuclear envelope.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 Back     alignment and function description
>sp|Q96321|IMA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=KAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 Back     alignment and function description
>sp|O04294|IMA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=KAP2 PE=1 SV=2 Back     alignment and function description
>sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 Back     alignment and function description
>sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 Back     alignment and function description
>sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 Back     alignment and function description
>sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 Back     alignment and function description
>sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
255542844 531 importin alpha, putative [Ricinus commun 0.990 0.749 0.880 0.0
118488338419 unknown [Populus trichocarpa] 0.995 0.954 0.867 0.0
125525217 526 hypothetical protein OsI_01208 [Oryza sa 0.995 0.760 0.875 0.0
224128392 538 predicted protein [Populus trichocarpa] 0.995 0.743 0.867 0.0
440690795 528 Chain A, Rimp_alpha1a 0.995 0.757 0.872 0.0
115435706 526 Os01g0253300 [Oryza sativa Japonica Grou 0.995 0.760 0.872 0.0
33337497 526 importin [Oryza sativa] 0.995 0.760 0.872 0.0
225437493 529 PREDICTED: importin subunit alpha [Vitis 0.995 0.756 0.875 0.0
356564581 530 PREDICTED: importin subunit alpha-1-like 0.987 0.749 0.870 0.0
225450645 527 PREDICTED: importin subunit alpha-1 isof 0.995 0.759 0.867 0.0
>gi|255542844|ref|XP_002512485.1| importin alpha, putative [Ricinus communis] gi|223548446|gb|EEF49937.1| importin alpha, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/403 (88%), Positives = 381/403 (94%), Gaps = 5/403 (1%)

Query: 1   MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPL- 59
           MSLRP+ARTEVRR++YKVAVDAEEGRRRREDNMVEIRKN+REESL KKRREGLQA QP+ 
Sbjct: 1   MSLRPSARTEVRRNRYKVAVDAEEGRRRREDNMVEIRKNRREESLQKKRREGLQA-QPMP 59

Query: 60  --TNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVP 117
              +S+A++ KKLE LP+MVAGVWSDD N+QL+ATTQFRKLLSIERSPPI EVIQ+GVVP
Sbjct: 60  ASLHSSAVE-KKLEHLPSMVAGVWSDDSNLQLEATTQFRKLLSIERSPPIEEVIQAGVVP 118

Query: 118 RFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQA 177
           RF+EFL R+DFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFV+LL+SP+DDVREQA
Sbjct: 119 RFVEFLMREDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVKLLASPSDDVREQA 178

Query: 178 VWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFE 237
           VWALGNVAGDSPKCRDLVL NGAL+PLLAQ NEHAKLSMLRNATWTLSNFCRGKPQP FE
Sbjct: 179 VWALGNVAGDSPKCRDLVLGNGALLPLLAQLNEHAKLSMLRNATWTLSNFCRGKPQPFFE 238

Query: 238 QTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSP 297
           Q +PALPAL RLIHSND+EVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELL HPSP
Sbjct: 239 QVKPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSP 298

Query: 298 SVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGN 357
           SVLIPALRTVGNIVTGDDMQTQCIINHQALPCLL+LLT NYKKSIKKEACWTISNITAGN
Sbjct: 299 SVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLNLLTNNYKKSIKKEACWTISNITAGN 358

Query: 358 VNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGS 400
             QIQA+IEA IIGPLV+LL NAEF+IKKEAAWAISNATSGG+
Sbjct: 359 KEQIQAVIEANIIGPLVHLLENAEFDIKKEAAWAISNATSGGT 401




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118488338|gb|ABK95987.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|125525217|gb|EAY73331.1| hypothetical protein OsI_01208 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|224128392|ref|XP_002320318.1| predicted protein [Populus trichocarpa] gi|222861091|gb|EEE98633.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|440690795|pdb|4B8J|A Chain A, Rimp_alpha1a Back     alignment and taxonomy information
>gi|115435706|ref|NP_001042611.1| Os01g0253300 [Oryza sativa Japonica Group] gi|62900360|sp|Q71VM4.2|IMA1A_ORYSJ RecName: Full=Importin subunit alpha-1a gi|3273243|dbj|BAA31165.1| NLS receptor [Oryza sativa] gi|3273245|dbj|BAA31166.1| NLS receptor [Oryza sativa Japonica Group] gi|6498466|dbj|BAA87855.1| putative importin alpha 2 [Oryza sativa Japonica Group] gi|113532142|dbj|BAF04525.1| Os01g0253300 [Oryza sativa Japonica Group] gi|125569759|gb|EAZ11274.1| hypothetical protein OsJ_01128 [Oryza sativa Japonica Group] gi|215687001|dbj|BAG90815.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|33337497|gb|AAQ13406.1|AF005265_1 importin [Oryza sativa] Back     alignment and taxonomy information
>gi|225437493|ref|XP_002274422.1| PREDICTED: importin subunit alpha [Vitis vinifera] gi|147778789|emb|CAN75951.1| hypothetical protein VITISV_028605 [Vitis vinifera] gi|297743948|emb|CBI36918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356564581|ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max] Back     alignment and taxonomy information
>gi|225450645|ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 isoform 1 [Vitis vinifera] gi|296089748|emb|CBI39567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
TAIR|locus:505006475 535 IMPA-2 "importin alpha isoform 0.992 0.745 0.803 2.1e-171
TAIR|locus:2083313 532 IMPA-1 "importin alpha isoform 0.992 0.75 0.793 7.4e-169
TAIR|locus:2132238 531 MOS6 "MODIFIER OF SNC1, 6" [Ar 0.995 0.753 0.735 1.4e-156
TAIR|locus:2196140 539 IMPA-6 "importin alpha isoform 0.995 0.742 0.736 7.2e-155
TAIR|locus:2195351 538 IMPA-4 "AT1G09270" [Arabidopsi 0.995 0.743 0.735 8.2e-154
TAIR|locus:2155929 519 IMPA-5 "importin alpha isoform 0.985 0.763 0.627 5e-131
DICTYBASE|DDB_G0272318 516 DDB_G0272318 "putative importi 0.975 0.759 0.618 3e-124
TAIR|locus:2078122 528 IMPA-7 "importin alpha isoform 0.945 0.719 0.636 1.9e-122
UNIPROTKB|G4MZS0 551 MGG_15072 "Importin subunit al 0.965 0.704 0.622 1.8e-117
ASPGD|ASPL0000045550 553 kapA [Emericella nidulans (tax 0.965 0.701 0.608 6.2e-117
TAIR|locus:505006475 IMPA-2 "importin alpha isoform 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1666 (591.5 bits), Expect = 2.1e-171, P = 2.1e-171
 Identities = 327/407 (80%), Positives = 364/407 (89%)

Query:     1 MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQ--- 57
             MSLRPNA+TEVRR++YKVAVDAEEGRRRREDNMVEIRK+KREESL KKRREGLQA+Q   
Sbjct:     1 MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLQKKRREGLQANQLPQ 60

Query:    58 ----PLTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQS 113
                 P+  S+ ++ KKLESLPAMV GVWSDDR++QL+ATTQFRKLLSIERSPPI EVI +
Sbjct:    61 FAPSPVPASSTVE-KKLESLPAMVGGVWSDDRSLQLEATTQFRKLLSIERSPPIEEVIDA 119

Query:   114 GVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDV 173
             GVVPRF+EFL+R+D+PQLQFEAAWALTNIASGTSENT+VVI+HGAVPIFV+LL+S +DDV
Sbjct:   120 GVVPRFVEFLTREDYPQLQFEAAWALTNIASGTSENTKVVIEHGAVPIFVQLLASQSDDV 179

Query:   174 REQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQ 233
             REQAVWALGNVAGDSP+CRDLVL  GAL+PLL+Q NEHAKLSMLRNATWTLSNFCRGKPQ
Sbjct:   180 REQAVWALGNVAGDSPRCRDLVLGQGALIPLLSQLNEHAKLSMLRNATWTLSNFCRGKPQ 239

Query:   234 PLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLR 293
             P F+Q RPALPALERLIHS D+EVLTDACWALSYLSDGTNDKIQ+VIEAGV PRLVELL+
Sbjct:   240 PPFDQVRPALPALERLIHSTDEEVLTDACWALSYLSDGTNDKIQSVIEAGVVPRLVELLQ 299

Query:   294 HPSPSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNI 353
             H SPSVLIPALR++GNIVTGDD+QTQC+I+H AL  LL LLT N+KKSIKKEACWTISNI
Sbjct:   300 HQSPSVLIPALRSIGNIVTGDDLQTQCVISHGALLSLLSLLTHNHKKSIKKEACWTISNI 359

Query:   354 TAGNVNXXXXXXXXXXXXPLVNLLLNAEFEIKKEAAWAISNATSGGS 400
             TAGN +            PLVNLL NAEF+IKKEAAWAISNATSGGS
Sbjct:   360 TAGNRDQIQAVCEAGLICPLVNLLQNAEFDIKKEAAWAISNATSGGS 406


GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006606 "protein import into nucleus" evidence=IEA;ISS
GO:0006886 "intracellular protein transport" evidence=ISS
GO:0008565 "protein transporter activity" evidence=IEA;ISS
GO:0005730 "nucleolus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0009407 "toxin catabolic process" evidence=RCA
TAIR|locus:2083313 IMPA-1 "importin alpha isoform 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132238 MOS6 "MODIFIER OF SNC1, 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196140 IMPA-6 "importin alpha isoform 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195351 IMPA-4 "AT1G09270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155929 IMPA-5 "importin alpha isoform 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272318 DDB_G0272318 "putative importin subunit alpha B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2078122 IMPA-7 "importin alpha isoform 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MZS0 MGG_15072 "Importin subunit alpha" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000045550 kapA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O35345IMA7_MOUSENo assigned EC number0.57970.91040.6828yesno
O60684IMA7_HUMANNo assigned EC number0.57710.91040.6828yesno
Q5RBV0IMA7_PONABNo assigned EC number0.57710.91040.6828yesno
Q02821IMA1_YEASTNo assigned EC number0.54220.96510.7158yesno
O94374IMA2_SCHPONo assigned EC number0.55880.96010.7161yesno
Q76P29IMAB_DICDINo assigned EC number0.63880.97510.7596yesno
O22478IMA_SOLLCNo assigned EC number0.83830.99500.7590N/Ano
Q0V7M0IMA7_BOVINNo assigned EC number0.57970.91040.6828yesno
Q71VM4IMA1A_ORYSJNo assigned EC number0.87280.99500.7604yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
COG5064 526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-171
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 8e-33
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 9e-32
pfam0174997 pfam01749, IBB, Importin beta binding domain 1e-30
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 9e-21
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-13
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 1e-09
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 1e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 2e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-08
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 1e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 2e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 2e-07
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 4e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 1e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 2e-06
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 4e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 2e-05
pfam1364688 pfam13646, HEAT_2, HEAT repeats 2e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 8e-05
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 8e-05
COG5116 926 COG5116, RPN2, 26S proteasome regulatory complex c 5e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 9e-04
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 0.003
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 0.004
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
 Score =  489 bits (1259), Expect = e-171
 Identities = 230/394 (58%), Positives = 281/394 (71%), Gaps = 5/394 (1%)

Query: 10  EVRRSKY--KVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLTNSAALDN 67
           E RR  +  K    A+E RRRRE+  VE+RK KREE L K+R     + +  ++   ++ 
Sbjct: 8   EARRYNFKGKGRFSADELRRRREEQQVELRKQKREELLNKRRNLADVSEEAESSFIPMEQ 67

Query: 68  KKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDD 127
           +    LP +   ++SDD   QL A  +FRKLLS E SPPI  VI +GVVPRF+EF+    
Sbjct: 68  QFYSELPQLTQQLFSDDIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFMDEIQ 127

Query: 128 FPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVWALGNVAGD 187
              LQFEAAWALTNIASGT++ T+VV+D GAVP+F++LLSS  DDVREQAVWALGN+AGD
Sbjct: 128 RDMLQFEAAWALTNIASGTTQQTKVVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGD 187

Query: 188 SPKCRDLVLSNGALMPLLAQFNEHA-KLSMLRNATWTLSNFCRGK-PQPLFEQTRPALPA 245
           S  CRD VL  GAL PLL      A  +SMLRNATWTLSN CRGK P P +     ALP 
Sbjct: 188 SEGCRDYVLQCGALEPLLGLLLSSAIHISMLRNATWTLSNLCRGKNPPPDWSNISQALPI 247

Query: 246 LERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALR 305
           L +LI+S D EVL DACWA+SYLSDG N+KIQAV++ G+  RLVELL H S  +  PALR
Sbjct: 248 LAKLIYSRDPEVLVDACWAISYLSDGPNEKIQAVLDVGIPGRLVELLSHESAKIQTPALR 307

Query: 306 TVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAII 365
           +VGNIVTG D QTQ IIN  AL     LL+ + K++I+KEACWTISNITAGN  QIQA+I
Sbjct: 308 SVGNIVTGSDDQTQVIINCGALKAFRSLLS-SPKENIRKEACWTISNITAGNTEQIQAVI 366

Query: 366 EAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGG 399
           +A +I PL++LL +AE++IKKEA WAISNATSGG
Sbjct: 367 DANLIPPLIHLLSSAEYKIKKEACWAISNATSGG 400


Length = 526

>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201951 pfam01749, IBB, Importin beta binding domain Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227446 COG5116, RPN2, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 402
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.97
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.96
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
PF05804708 KAP: Kinesin-associated protein (KAP) 99.89
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.81
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.8
KOG1048717 consensus Neural adherens junction protein Plakoph 99.78
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.74
PRK09687280 putative lyase; Provisional 99.74
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.73
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.72
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.72
KOG1048 717 consensus Neural adherens junction protein Plakoph 99.71
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.7
PRK09687280 putative lyase; Provisional 99.68
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.65
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.65
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.64
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.63
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.62
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.6
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.59
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.58
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.56
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.54
PF0174997 IBB: Importin beta binding domain; InterPro: IPR00 99.54
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.53
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.52
KOG1293 678 consensus Proteins containing armadillo/beta-caten 99.45
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.44
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.43
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.42
PTZ00429 746 beta-adaptin; Provisional 99.41
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.39
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.35
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.33
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.33
PTZ00429 746 beta-adaptin; Provisional 99.33
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 99.31
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.27
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.25
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 99.24
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.22
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 99.22
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.16
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 99.16
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 99.11
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.06
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.05
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 99.04
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.03
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.97
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.9
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.88
TIGR02270 410 conserved hypothetical protein. Members are found 98.85
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.85
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.83
COG5369743 Uncharacterized conserved protein [Function unknow 98.79
KOG1242 569 consensus Protein containing adaptin N-terminal re 98.76
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.74
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.72
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.72
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.69
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.67
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.67
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.67
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.67
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.64
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.62
KOG0212 675 consensus Uncharacterized conserved protein [Funct 98.59
KOG1242 569 consensus Protein containing adaptin N-terminal re 98.59
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.58
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.58
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.58
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.58
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.54
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.54
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.52
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.49
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.48
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.48
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 98.46
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.45
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.43
KOG2259 823 consensus Uncharacterized conserved protein [Funct 98.42
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.42
TIGR02270410 conserved hypothetical protein. Members are found 98.41
PF05536 543 Neurochondrin: Neurochondrin 98.39
KOG4646173 consensus Uncharacterized conserved protein, conta 98.37
KOG4646173 consensus Uncharacterized conserved protein, conta 98.37
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.36
COG5369 743 Uncharacterized conserved protein [Function unknow 98.35
KOG0212 675 consensus Uncharacterized conserved protein [Funct 98.29
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.25
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.25
PF05536 543 Neurochondrin: Neurochondrin 98.22
KOG0567289 consensus HEAT repeat-containing protein [General 98.21
KOG2062 929 consensus 26S proteasome regulatory complex, subun 98.2
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 98.19
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.18
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.18
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.16
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.15
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.15
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.08
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.05
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 98.03
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.02
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.01
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 98.0
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 97.99
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.99
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.99
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 97.97
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.95
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.95
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.93
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.9
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.88
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 97.87
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.83
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.83
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.82
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.81
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.8
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.78
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.77
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.75
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 97.75
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.73
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 97.7
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 97.69
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.64
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.63
PF05004309 IFRD: Interferon-related developmental regulator ( 97.61
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 97.6
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 97.56
KOG0567289 consensus HEAT repeat-containing protein [General 97.56
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.52
COG5116 926 RPN2 26S proteasome regulatory complex component [ 97.5
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 97.48
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 97.44
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 97.44
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 97.41
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.39
KOG4653982 consensus Uncharacterized conserved protein [Funct 97.34
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.33
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 97.33
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.3
PF05004309 IFRD: Interferon-related developmental regulator ( 97.29
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.29
KOG2956516 consensus CLIP-associating protein [General functi 97.29
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.28
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.27
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.27
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.27
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.26
KOG0414 1251 consensus Chromosome condensation complex Condensi 97.21
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.2
PF11864 464 DUF3384: Domain of unknown function (DUF3384); Int 97.16
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 97.11
KOG2062 929 consensus 26S proteasome regulatory complex, subun 97.06
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.05
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 97.03
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 97.02
KOG3036293 consensus Protein involved in cell differentiation 96.98
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.96
COG5656 970 SXM1 Importin, protein involved in nuclear import 96.92
KOG04141251 consensus Chromosome condensation complex Condensi 96.91
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.89
KOG4653982 consensus Uncharacterized conserved protein [Funct 96.87
KOG3036293 consensus Protein involved in cell differentiation 96.84
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.84
KOG2956516 consensus CLIP-associating protein [General functi 96.81
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.79
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 96.77
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 96.68
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 96.65
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.65
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 96.64
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.59
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.57
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 96.57
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.5
PF12719 298 Cnd3: Nuclear condensing complex subunits, C-term 96.48
PRK14707 2710 hypothetical protein; Provisional 96.46
PF11701157 UNC45-central: Myosin-binding striated muscle asse 96.43
PF07814361 WAPL: Wings apart-like protein regulation of heter 96.36
COG50981128 Chromosome condensation complex Condensin, subunit 96.35
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 96.33
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 96.14
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 96.07
KOG1243 690 consensus Protein kinase [General function predict 95.93
KOG2137 700 consensus Protein kinase [Signal transduction mech 95.9
PF14500262 MMS19_N: Dos2-interacting transcription regulator 95.89
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 95.88
KOG1566342 consensus Conserved protein Mo25 [Function unknown 95.88
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.87
PF06025 379 DUF913: Domain of Unknown Function (DUF913); Inter 95.85
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 95.85
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 95.84
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.82
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 95.79
PRK14707 2710 hypothetical protein; Provisional 95.78
KOG1566342 consensus Conserved protein Mo25 [Function unknown 95.74
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.68
KOG2025 892 consensus Chromosome condensation complex Condensi 95.61
COG5116 926 RPN2 26S proteasome regulatory complex component [ 95.5
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 95.5
KOG1243 690 consensus Protein kinase [General function predict 95.42
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 95.31
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.25
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 95.25
KOG2025 892 consensus Chromosome condensation complex Condensi 95.22
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 95.14
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.1
KOG2032 533 consensus Uncharacterized conserved protein [Funct 95.1
KOG2032533 consensus Uncharacterized conserved protein [Funct 94.93
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 94.85
COG50981128 Chromosome condensation complex Condensin, subunit 94.85
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 94.77
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 94.77
PF13251182 DUF4042: Domain of unknown function (DUF4042) 94.73
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.57
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 94.55
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.53
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 94.49
PF14500262 MMS19_N: Dos2-interacting transcription regulator 94.43
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 94.4
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 94.28
PF08167165 RIX1: rRNA processing/ribosome biogenesis 94.25
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 94.2
smart00638574 LPD_N Lipoprotein N-terminal Domain. 94.18
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 94.15
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 93.88
PF13251182 DUF4042: Domain of unknown function (DUF4042) 93.62
KOG2933334 consensus Uncharacterized conserved protein [Funct 93.56
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 93.47
KOG2137700 consensus Protein kinase [Signal transduction mech 93.46
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 93.44
PF07814361 WAPL: Wings apart-like protein regulation of heter 93.43
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.3
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 93.18
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 93.17
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 92.92
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 92.88
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 92.85
KOG2005 878 consensus 26S proteasome regulatory complex, subun 92.84
smart00638574 LPD_N Lipoprotein N-terminal Domain. 92.81
COG5656 970 SXM1 Importin, protein involved in nuclear import 92.81
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 92.73
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 92.64
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 92.62
COG5209315 RCD1 Uncharacterized protein involved in cell diff 92.54
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 92.35
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 92.34
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 92.32
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 91.78
PF03378 435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 91.65
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 91.53
PF04388 668 Hamartin: Hamartin protein; InterPro: IPR007483 Th 91.45
KOG2933334 consensus Uncharacterized conserved protein [Funct 91.43
PF1153840 Snurportin1: Snurportin1; InterPro: IPR024721 Snur 91.4
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 91.25
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 91.07
PF11707 330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 90.88
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 90.59
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 90.49
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 90.44
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 90.2
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 90.04
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 89.92
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 89.44
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 89.12
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 89.07
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 88.9
cd03561133 VHS VHS domain family; The VHS domain is present i 88.68
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 88.51
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 88.21
COG5209315 RCD1 Uncharacterized protein involved in cell diff 87.99
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 87.84
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 87.67
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 87.61
cd03561133 VHS VHS domain family; The VHS domain is present i 87.57
PF08167165 RIX1: rRNA processing/ribosome biogenesis 87.51
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 87.41
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 86.92
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 86.54
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 86.26
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 86.06
PF04869312 Uso1_p115_head: Uso1 / p115 like vesicle tethering 85.82
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 85.65
KOG1410 1082 consensus Nuclear transport receptor RanBP16 (impo 85.36
KOG0413 1529 consensus Uncharacterized conserved protein relate 85.07
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 84.84
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 84.48
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 83.87
PF12726727 SEN1_N: SEN1 N terminal; InterPro: IPR024481 The y 83.5
KOG1988 970 consensus Uncharacterized conserved protein [Funct 82.79
KOG4464 532 consensus Signaling protein RIC-8/synembryn (regul 82.19
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 82.08
KOG0301745 consensus Phospholipase A2-activating protein (con 82.03
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 81.08
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 80.79
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
Probab=100.00  E-value=1.3e-77  Score=504.63  Aligned_cols=392  Identities=58%  Similarity=0.892  Sum_probs=362.9

Q ss_pred             CccHHHhhhccC-C-CCchHHhhhhHHHHHHHHHHhhhHHHHhhhhcc-ccCCCCCcchhhhhhhhhccHHHHHHhhcCC
Q 015687            7 ARTEVRRSKYKV-A-VDAEEGRRRREDNMVEIRKNKREESLLKKRREG-LQAHQPLTNSAALDNKKLESLPAMVAGVWSD   83 (402)
Q Consensus         7 ~~~~~~~~~~k~-~-~~~~~~r~~r~~~~~~lRk~~r~~~~~~kr~~~-~~~~~~~~~~~~~~~~~~~~i~~l~~~l~s~   83 (402)
                      +.++.|+..||+ | ++++|+||+|++.++||||+||||.++||||.. ..++..+. .....++....+|.+.+.|.|+
T Consensus         5 f~p~~Rr~~fk~Kg~f~adelRr~ReeQQvElRkqKreE~LnKrRNl~dv~e~a~ss-~i~meqq~~~elp~lt~~l~Sd   83 (526)
T COG5064           5 FVPEARRYNFKGKGRFSADELRRRREEQQVELRKQKREELLNKRRNLADVSEEAESS-FIPMEQQFYSELPQLTQQLFSD   83 (526)
T ss_pred             cchHHHHhcccCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccchhhhc-cCchhHHhhhhhHHHHHHHhhh
Confidence            467889999998 4 779999999999999999999999999999973 22222211 1122223335789999999999


Q ss_pred             CHHHHHHHHHHHHHHhccCCCCchhHHhhcCcHHHHHHhhcCCCCHHHHHHHHHHHHHhhcCCCcchHHHHhCCchHHHH
Q 015687           84 DRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFV  163 (402)
Q Consensus        84 ~~~~~~~a~~~l~~l~s~~~~~~~~~~~~~g~i~~L~~lL~~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~g~i~~L~  163 (402)
                      |-+.+..|...+++++|.+..||++.+++.|++|.|++++.+.....++++|+|+|+|+++++..++..+++.|++|.++
T Consensus        84 Die~q~qav~kFR~~LS~E~~PPIq~VIdaGvVpRfvefm~~~q~~mlqfEAaWalTNiaSGtt~QTkvVvd~~AVPlfi  163 (526)
T COG5064          84 DIEQQLQAVYKFRKLLSKETSPPIQPVIDAGVVPRFVEFMDEIQRDMLQFEAAWALTNIASGTTQQTKVVVDAGAVPLFI  163 (526)
T ss_pred             HHHHHHHHHHHHHHHhccccCCCchhHHhccccHHHHHHHHhcchhHHHHHHHHHHhhhccCcccceEEEEeCCchHHHH
Confidence            99999999999999999999999999999999999999996544378899999999999999999999999999999999


Q ss_pred             HhhCCCCHHHHHHHHHHHHHhhCCCchhhHHHHhcCChHHHHHHhccc-hhhHHHHHHHHHHHHhhhCC-CCCchhhhhc
Q 015687          164 RLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEH-AKLSMLRNATWTLSNFCRGK-PQPLFEQTRP  241 (402)
Q Consensus       164 ~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~~l~~~-~~~~~~~~a~~~L~~l~~~~-~~~~~~~~~~  241 (402)
                      ++|.+++.+++++++|+|||++++++.+|+.+++.|++++++.++..+ .+..+.+++.|+|+|||+++ |.+....+..
T Consensus       164 qlL~s~~~~V~eQavWALGNiAGDS~~~RD~vL~~galeplL~ll~ss~~~ismlRn~TWtLSNlcRGknP~P~w~~isq  243 (526)
T COG5064         164 QLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLLSSAIHISMLRNATWTLSNLCRGKNPPPDWSNISQ  243 (526)
T ss_pred             HHHcCchHHHHHHHHHHhccccCCchhHHHHHHhcCchHHHHHHHHhccchHHHHHHhHHHHHHhhCCCCCCCchHHHHH
Confidence            999999999999999999999999999999999999999999999544 36799999999999999998 8888889999


Q ss_pred             hHHHHHHhccCCChhHHHHHHHHHHHhccCChHHHHHHHHhCcHHHHHHhcCCCChhhHHHHHHHHHHhhcCChHHHHHH
Q 015687          242 ALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDDMQTQCI  321 (402)
Q Consensus       242 ~l~~L~~lL~~~~~~v~~~a~~~l~~l~~~~~~~~~~~~~~~~i~~L~~~L~~~~~~v~~~a~~~l~nl~~~~~~~~~~i  321 (402)
                      .+|.|.+++.+.|+++..+|||+++|+++++.+.++.+++.|+..+|+++|.+++..++.+|++.+||+++|++.+++.+
T Consensus       244 alpiL~KLiys~D~evlvDA~WAiSYlsDg~~E~i~avld~g~~~RLvElLs~~sa~iqtPalR~vGNIVTG~D~QTqvi  323 (526)
T COG5064         244 ALPILAKLIYSRDPEVLVDACWAISYLSDGPNEKIQAVLDVGIPGRLVELLSHESAKIQTPALRSVGNIVTGSDDQTQVI  323 (526)
T ss_pred             HHHHHHHHHhhcCHHHHHHHHHHHHHhccCcHHHHHHHHhcCCcHHHHHHhcCccccccCHHHHhhcCeeecCccceehh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhCCChHHHHHHhcCCCchhHHHHHHHHHHHHhcCCHHHHHHHHHcCCHHHHHHHhccCCHHHHHHHHHHHHHhhcCCC
Q 015687          322 INHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGS  400 (402)
Q Consensus       322 ~~~~~l~~L~~ll~~~~~~~v~~~a~~~L~nl~~~~~~~~~~l~~~~~i~~L~~ll~~~~~~v~~~a~~aL~nl~~~~~  400 (402)
                      ++.|+++.+..+|+++ ...+|++|||+++||++|+.++++.+++.+++|+|+.+|.+.+.+++++||||+.|..+||.
T Consensus       324 I~~G~L~a~~~lLs~~-ke~irKEaCWTiSNITAGnteqiqavid~nliPpLi~lls~ae~k~kKEACWAisNatsgg~  401 (526)
T COG5064         324 INCGALKAFRSLLSSP-KENIRKEACWTISNITAGNTEQIQAVIDANLIPPLIHLLSSAEYKIKKEACWAISNATSGGL  401 (526)
T ss_pred             eecccHHHHHHHhcCh-hhhhhhhhheeecccccCCHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Confidence            9999999999999999 88999999999999999999999999999999999999999999999999999999999985



>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF01749 IBB: Importin beta binding domain; InterPro: IPR002652 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG2005 consensus 26S proteasome regulatory complex, subunit RPN1/PSMD2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF04388 Hamartin: Hamartin protein; InterPro: IPR007483 This family includes the hamartin protein which is thought to function as a tumour suppressor Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11538 Snurportin1: Snurportin1; InterPro: IPR024721 Snurportin-1 is a nuclear import receptor that contains an N-terminal importin beta binding domain which is essential for its function as an snRNP-specific nuclear import receptor [] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF04869 Uso1_p115_head: Uso1 / p115 like vesicle tethering protein, head region; InterPro: IPR006953 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associated protein (TAP) or Vesicle docking protein, this myosin-shaped molecule consists of an N-terminal globular head region, a coiled-coil tail which mediates dimerisation, and a short C-terminal acidic region [] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG1410 consensus Nuclear transport receptor RanBP16 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>PF12726 SEN1_N: SEN1 N terminal; InterPro: IPR024481 The yeast helicase Sen1 is an RNA polymerase II termination factor for noncoding RNA genes [] Back     alignment and domain information
>KOG1988 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
4b8j_A 528 Rimp_alpha1a Length = 528 0.0
4b8j_A528 Rimp_alpha1a Length = 528 4e-13
2yns_A 490 Rimp_alpha_b54nls Length = 490 1e-170
1wa5_B 530 Crystal Structure Of The Exportin Cse1p Complexed W 1e-106
1wa5_B 530 Crystal Structure Of The Exportin Cse1p Complexed W 7e-04
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 1e-98
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 1e-98
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 3e-98
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 4e-98
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-97
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 2e-97
1un0_A 443 Crystal Structure Of Yeast Karyopherin (Importin) A 3e-97
2c1t_A 454 Structure Of The Kap60p:nup2 Complex Length = 454 3e-97
3tpo_A 529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 6e-93
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 1e-88
4ba3_A 496 Mimp_alphadibb_a89nls Length = 496 1e-88
3rz9_A 510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 2e-88
1ial_A453 Importin Alpha, Mouse Length = 453 2e-88
1q1s_C 466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 2e-88
4htv_A 509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 2e-88
3ukw_B 510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 2e-88
1ejl_I 460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 2e-88
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 2e-88
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 2e-88
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 2e-88
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 2e-88
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 3e-88
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 3e-88
3fex_C 467 Crystal Structure Of The Cbc-Importin Alpha Complex 1e-86
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 5e-36
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 6e-34
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 7e-27
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 8e-26
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 4e-22
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 1e-22
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 2e-22
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 3e-22
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 2e-21
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 9e-15
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure

Iteration: 1

Score = 699 bits (1803), Expect = 0.0, Method: Compositional matrix adjust. Identities = 340/401 (84%), Positives = 364/401 (90%), Gaps = 1/401 (0%) Query: 1 MSLRPNARTEVRRSKYKVAVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQPLT 60 MSLRP+ R EVRR++YKVAVDAEEGRRRREDNMVEIRK++REESLLKKRREGLQA P+ Sbjct: 3 MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAPVP 62 Query: 61 NSAALD-NKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRF 119 SAA +KKLESLPAM+ GV+SDD N+QL+ATTQFRKLLSIERSPPI EVIQSGVVPRF Sbjct: 63 ASAATGVDKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVPRF 122 Query: 120 IEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAVW 179 ++FL+R+DFPQLQFEAAWALTNIASGTSENT+VVIDHGAVPIFV+LL S +DDVREQAVW Sbjct: 123 VQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQAVW 182 Query: 180 ALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGKPQPLFEQT 239 ALGNVAGDSPKCRDLVL+NGAL+PLLAQ NEH KLSMLRNATWTLSNFCRGKPQP FEQT Sbjct: 183 ALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFEQT 242 Query: 240 RPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSV 299 RPALPAL RLIHSND+EVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELL HPSPSV Sbjct: 243 RPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSPSV 302 Query: 300 LIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVN 359 LIPALRTVGNIVTGDD QTQCII+HQALPCLL LLTQN KKSIKKEACWTISNITAGN + Sbjct: 303 LIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGNKD 362 Query: 360 XXXXXXXXXXXXPLVNLLLNAEFEIKKEAAWAISNATSGGS 400 PLVNLL AEF+IKKEAAWAISNATSGGS Sbjct: 363 QIQAVINAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGS 403
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-162
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-48
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 1e-152
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-51
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-42
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-40
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-21
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-148
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-63
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-53
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-39
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-94
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-64
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-62
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-60
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-54
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-53
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-33
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-20
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-18
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-04
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 4e-94
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 6e-71
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-63
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-58
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-55
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-52
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-28
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-89
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 5e-67
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-50
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-77
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-67
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-62
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-58
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-38
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-72
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-54
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 4e-49
4db6_A 210 Armadillo repeat protein; solenoid repeat, armadil 2e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-69
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-56
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 2e-16
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 2e-07
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-59
3nmz_A458 APC variant protein; protein-protein complex, arma 6e-34
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-23
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-54
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-28
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 5e-19
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-16
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 4e-49
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-23
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-20
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-16
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-07
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-49
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 7e-24
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-23
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-20
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-40
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-36
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-33
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 6e-28
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-16
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-37
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 6e-20
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-20
2db0_A253 253AA long hypothetical protein; heat repeats, hel 2e-14
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 4e-12
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 5e-04
1qgk_B44 Protein (importin alpha-2 subunit); transport rece 2e-11
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-11
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-09
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 6e-10
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 1e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 7e-10
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-05
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-09
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 2e-06
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 2e-09
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-06
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 2e-08
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 4e-08
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 9e-08
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 3e-04
3grl_A 651 General vesicular transport factor P115; vesicle t 2e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-06
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-06
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 7e-06
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-05
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 1e-04
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 1e-05
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 3e-04
1qgr_A 876 Protein (importin beta subunit); transport recepto 1e-05
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
 Score =  464 bits (1196), Expect = e-162
 Identities = 215/405 (53%), Positives = 272/405 (67%), Gaps = 14/405 (3%)

Query: 9   TEVRRSKYK--VAVDAEEGRRRREDNMVEIRKNKREESLLKKRR---------EGLQAHQ 57
            E RR+ +K      A+E RRRR+   VE+RK KR+E+L K+R             +   
Sbjct: 14  PEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDES 73

Query: 58  PLTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVP 117
            ++      ++  + LP M   + SDD   QL AT +FR++LS E  PPI+ VIQ+GVVP
Sbjct: 74  SVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVP 133

Query: 118 RFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQA 177
           R +EF+  +    LQ EAAWALTNIASGTS  T+VV+D  AVP+F++LL + + +V+EQA
Sbjct: 134 RLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQA 193

Query: 178 VWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGK-PQPLF 236
           +WALGNVAGDS   RD VL   A+ P+L  FN + K S++R ATWTLSN CRGK PQP +
Sbjct: 194 IWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSN-KPSLIRTATWTLSNLCRGKKPQPDW 252

Query: 237 EQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPS 296
                ALP L +LI+S D E L DACWA+SYLSDG  + IQAVI+  +  RLVELL H S
Sbjct: 253 SVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHES 312

Query: 297 PSVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAG 356
             V  PALR VGNIVTG+D+QTQ +IN   LP L  LL  + K++IKKEACWTISNITAG
Sbjct: 313 TLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLL-SSPKENIKKEACWTISNITAG 371

Query: 357 NVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSS 401
           N  QIQA+I+A +I PLV LL  AE++ KKEA WAISNA+SGG  
Sbjct: 372 NTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQ 416


>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1qgk_B Protein (importin alpha-2 subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.50A {Homo sapiens} Length = 44 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} Length = 963 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Length = 265 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Length = 265 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 100.0
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 100.0
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 100.0
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 100.0
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.98
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.98
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.97
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.97
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.97
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.97
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.95
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.94
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.94
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.93
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.9
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.9
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.88
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.79
3grl_A 651 General vesicular transport factor P115; vesicle t 99.77
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.76
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.76
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.75
3grl_A 651 General vesicular transport factor P115; vesicle t 99.75
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.68
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.68
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.65
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.65
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.63
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.63
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.62
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.62
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.59
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.59
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.58
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.58
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.57
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.57
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.56
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.48
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.48
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.4
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.4
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.31
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.27
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.17
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.16
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 99.08
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.07
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.04
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.98
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.93
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.91
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.87
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.87
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.86
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.85
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.81
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.8
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.7
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 98.69
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.67
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.57
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.39
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.34
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.33
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.25
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.15
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 98.12
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.11
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 98.09
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.05
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.01
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.97
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 97.9
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.86
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.84
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.77
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 97.7
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.69
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.5
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.47
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.42
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 97.36
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.22
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.13
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.11
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.04
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.78
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 96.68
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.64
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 96.58
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.54
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.51
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.35
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 96.17
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.11
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 96.03
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.94
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.43
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 95.42
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 95.3
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 95.27
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 94.98
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 94.97
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 94.61
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 94.59
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 94.52
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 94.32
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 94.14
2p8q_B40 Snurportin-1; heat repeat, IBB-domain, importin, k 94.11
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 91.94
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 91.71
3qml_C 315 Protein SLS1, nucleotide exchange factor SIL1; arm 91.68
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 91.23
3fga_B403 Serine/threonine-protein phosphatase 2A 56 kDa RE 90.04
3fga_B403 Serine/threonine-protein phosphatase 2A 56 kDa RE 89.1
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 86.73
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 85.01
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 84.77
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 84.27
1vsy_5 997 Proteasome activator BLM10; 20S proteasome BLM10, 83.5
3g2s_A149 C-terminal fragment of sortilin-related receptor; 83.02
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 80.7
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 80.68
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
Probab=100.00  E-value=1.2e-62  Score=477.12  Aligned_cols=399  Identities=48%  Similarity=0.775  Sum_probs=322.2

Q ss_pred             CCCCCCC-ccHHHhhhccC-CCCchHHhhhhHHHHHHHHHHhhhHHHHhhhhccccCCCC-Ccchh--hhhhhhhccHHH
Q 015687            1 MSLRPNA-RTEVRRSKYKV-AVDAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQP-LTNSA--ALDNKKLESLPA   75 (402)
Q Consensus         1 ~~~~~~~-~~~~~~~~~k~-~~~~~~~r~~r~~~~~~lRk~~r~~~~~~kr~~~~~~~~~-~~~~~--~~~~~~~~~i~~   75 (402)
                      |++++|. .+++|+++||+ |++++|+||||++++++|||+||||++.|||++....++. ++...  .........++.
T Consensus         1 ~~~~~~~~~~~~r~~~~k~~~~~~~e~r~~R~~~~v~lRk~kr~e~l~krR~~~~~~~~~~~~~~~~~~~~~~~~~~l~~   80 (529)
T 3tpo_A            1 MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVED   80 (529)
T ss_dssp             -------------------------------------------CCSCSCCCCCC---------------CGGGSSCCHHH
T ss_pred             CCCCCCCCCcHHHHHHhccCCCChHHHHHHHhHHHHHHHHHHHHHHHHhccCCCCCcccccChhhhccchhhhHHHHHHH
Confidence            7776655 67899999998 9999999999999999999999999999999875432222 22111  111111246899


Q ss_pred             HHHhhcCCCHHHHHHHHHHHHHHhccCCCCchhHHhhcCcHHHHHHhhcCCCCHHHHHHHHHHHHHhhcCCCcchHHHHh
Q 015687           76 MVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVID  155 (402)
Q Consensus        76 l~~~l~s~~~~~~~~a~~~l~~l~s~~~~~~~~~~~~~g~i~~L~~lL~~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~  155 (402)
                      +++.++|+|++.++.|+..++++++.+++++++.+++.|++|.|+++|..++++.++..|+|+|+||+.++++++..+++
T Consensus        81 lv~~l~s~d~~~q~~a~~~~rklLs~~~~~~i~~ii~~G~ip~Lv~lL~~~~~~~~q~~Aa~aL~nia~~~~~~~~~vv~  160 (529)
T 3tpo_A           81 IVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVD  160 (529)
T ss_dssp             HHHHHTSSCHHHHHHHHHHHHHHHTSSSCCCHHHHHHTTHHHHHHHHHTCTTCHHHHHHHHHHHHHHHTSCHHHHHHHHH
T ss_pred             HHHHhcCCCHHHHHHHHHHHHHHHcCCCCchHHHHHHCCCHHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            99999999999999999999999999889999999999999999999987666899999999999999999999999999


Q ss_pred             CCchHHHHHhhCCCCHHHHHHHHHHHHHhhCCCchhhHHHHhcCChHHHHHHhccch----hhHHHHHHHHHHHHhhhCC
Q 015687          156 HGAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHA----KLSMLRNATWTLSNFCRGK  231 (402)
Q Consensus       156 ~g~i~~L~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~~l~~~~----~~~~~~~a~~~L~~l~~~~  231 (402)
                      .|++|.|+.+|.+++.++++.|+|+|+||+.+++.+|+.+.+.|++++|+.++....    ...+++.++|++++++.+.
T Consensus       161 ~Gaip~Lv~LL~s~~~~v~e~A~~aL~nLa~~~~~~r~~i~~~g~i~~Ll~lL~~~~~~~~~~~~~~~a~~~L~nl~~~~  240 (529)
T 3tpo_A          161 GGAIPAFISLLASPHAHISEQAVWALGNIAGAGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNK  240 (529)
T ss_dssp             TTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHTTCSSCGGGSCHHHHHHHHHHHHHHHCCC
T ss_pred             CCCHHHHHHHHcCCCHHHHHHHHHHHHHHhccCHHHHHHHHHcCCcHHHHHHHhccchhHhHHHHHHHHHHHHHHHHhcc
Confidence            999999999999999999999999999999999999999999999999999995432    3467899999999999987


Q ss_pred             -CCCchhhhhchHHHHHHhccCCChhHHHHHHHHHHHhccCChHHHHHHHHhCcHHHHHHhcCCCChhhHHHHHHHHHHh
Q 015687          232 -PQPLFEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNI  310 (402)
Q Consensus       232 -~~~~~~~~~~~l~~L~~lL~~~~~~v~~~a~~~l~~l~~~~~~~~~~~~~~~~i~~L~~~L~~~~~~v~~~a~~~l~nl  310 (402)
                       +........+++|.|+.++.+++++++..++|+|++++.+.++..+.+.+.|+++.|+.+|.++++.++.+++++|+|+
T Consensus       241 ~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~a~~aL~~l~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~nl  320 (529)
T 3tpo_A          241 NPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNI  320 (529)
T ss_dssp             TTCCCHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHHTTTCHHHHHHHHTCSCHHHHHHHHHHHHHH
T ss_pred             cchhhHHHHhhHHHHHHHHhcCCcHHHHHHHHHHHHHhhhhhhhhHHHHHhccchHHHHHHhcCCChhHHHHHHHHHHHH
Confidence             6666777789999999999999999999999999999999998888899999999999999999999999999999999


Q ss_pred             hcCChHHHHHHHhCCChHHHHHHhcCCCchhHHHHHHHHHHHHhcCCHHHHHHHHHcCCHHHHHHHhccCCHHHHHHHHH
Q 015687          311 VTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAW  390 (402)
Q Consensus       311 ~~~~~~~~~~i~~~~~l~~L~~ll~~~~~~~v~~~a~~~L~nl~~~~~~~~~~l~~~~~i~~L~~ll~~~~~~v~~~a~~  390 (402)
                      +.+++..+..+++.|+++.|+.+|.++ ++.++++|+|+|+||+.++++++..+++.|++|.|+.++.+++++++++|+|
T Consensus       321 ~~~~~~~~~~i~~~g~l~~L~~LL~~~-~~~i~~~a~~aL~nl~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~A~~  399 (529)
T 3tpo_A          321 VTGTDEQTQKVIDAGALAVFPSLLTNP-KTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKAAAW  399 (529)
T ss_dssp             TTSCHHHHHHHHHTTGGGGHHHHTTCS-SHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHHHSSCHHHHHHHHH
T ss_pred             HccchHHHHHHhhcccHHHHHHHHcCC-CHHHHHHHHHHHHHHhcccHHHHHHHHhcCcHHHHHHHhcCCCHHHHHHHHH
Confidence            999999999999999999999999998 9999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCCC
Q 015687          391 AISNATSGGS  400 (402)
Q Consensus       391 aL~nl~~~~~  400 (402)
                      +|+|++.+|+
T Consensus       400 aL~nl~~~~~  409 (529)
T 3tpo_A          400 AITNYTSGGT  409 (529)
T ss_dssp             HHHHHHHHSC
T ss_pred             HHHHHHcCCC
Confidence            9999998765



>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2p8q_B Snurportin-1; heat repeat, IBB-domain, importin, karyopherin, transport; 2.35A {Homo sapiens} PDB: 2q5d_C 3lww_B Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3fga_B Serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; PP2A, shugoshin, nucleus, phosphoprotein, hydrolase, iron, M metal-binding, methylation, protein phosphatase, cell cycle division; HET: 1ZN; 2.70A {Homo sapiens} PDB: 2iae_B* 2nym_B* 2nyl_B* Back     alignment and structure
>3fga_B Serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; PP2A, shugoshin, nucleus, phosphoprotein, hydrolase, iron, M metal-binding, methylation, protein phosphatase, cell cycle division; HET: 1ZN; 2.70A {Homo sapiens} PDB: 2iae_B* 2nym_B* 2nyl_B* Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 402
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-92
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-10
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 5e-06
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-58
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-11
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-08
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-38
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-16
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-13
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-12
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-08
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 3e-21
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-18
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 6e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-11
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-08
d2vgla_ 584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 1e-12
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 7e-12
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 0.001
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-11
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-08
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-08
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-04
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 4e-11
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 8e-08
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 6e-07
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 9e-06
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 7e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.001
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 2e-04
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  284 bits (726), Expect = 3e-92
 Identities = 215/405 (53%), Positives = 272/405 (67%), Gaps = 14/405 (3%)

Query: 10  EVRRSKYKVA--VDAEEGRRRREDNMVEIRKNKREESLLKKRR---------EGLQAHQP 58
           E RR+ +K      A+E RRRR+   VE+RK KR+E+L K+R             +    
Sbjct: 4   EYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESS 63

Query: 59  LTNSAALDNKKLESLPAMVAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPR 118
           ++      ++  + LP M   + SDD   QL AT +FR++LS E  PPI+ VIQ+GVVPR
Sbjct: 64  VSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPR 123

Query: 119 FIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDHGAVPIFVRLLSSPTDDVREQAV 178
            +EF+  +    LQ EAAWALTNIASGTS  T+VV+D  AVP+F++LL + + +V+EQA+
Sbjct: 124 LVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAI 183

Query: 179 WALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGK-PQPLFE 237
           WALGNVAGDS   RD VL   A+ P+L  FN + K S++R ATWTLSN CRGK PQP + 
Sbjct: 184 WALGNVAGDSTDYRDYVLQCNAMEPILGLFNSN-KPSLIRTATWTLSNLCRGKKPQPDWS 242

Query: 238 QTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSP 297
               ALP L +LI+S D E L DACWA+SYLSDG  + IQAVI+  +  RLVELL H S 
Sbjct: 243 VVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHEST 302

Query: 298 SVLIPALRTVGNIVTGDDMQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGN 357
            V  PALR VGNIVTG+D+QTQ +IN   LP L  LL  + K++IKKEACWTISNITAGN
Sbjct: 303 LVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLL-SSPKENIKKEACWTISNITAGN 361

Query: 358 VNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSSW 402
             QIQA+I+A +I PLV LL  AE++ KKEA WAISNA+SGG   
Sbjct: 362 TEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQR 406


>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.87
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.84
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.59
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.53
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.5
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.49
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.47
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.45
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.39
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.35
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.34
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.34
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.06
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.02
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.97
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.97
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.93
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.86
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.77
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.67
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.49
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.57
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.64
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 96.51
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 96.35
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.16
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.83
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 95.73
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 94.17
d2jaka1343 Serine/threonine-protein phosphatase 2A regulatory 91.34
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 88.24
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 85.68
d2jaka1343 Serine/threonine-protein phosphatase 2A regulatory 84.74
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 82.87
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 80.86
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=2.1e-54  Score=415.91  Aligned_cols=392  Identities=55%  Similarity=0.827  Sum_probs=343.7

Q ss_pred             ccHHHhhhccC-CC-CchHHhhhhHHHHHHHHHHhhhHHHHhhhhccccCCCC-Ccc--------hhhhhhhhhccHHHH
Q 015687            8 RTEVRRSKYKV-AV-DAEEGRRRREDNMVEIRKNKREESLLKKRREGLQAHQP-LTN--------SAALDNKKLESLPAM   76 (402)
Q Consensus         8 ~~~~~~~~~k~-~~-~~~~~r~~r~~~~~~lRk~~r~~~~~~kr~~~~~~~~~-~~~--------~~~~~~~~~~~i~~l   76 (402)
                      .+++|++.||+ |+ +++|+||||+++++||||+||++.++|||+.....+.. ++.        ......+..+.++.+
T Consensus         2 ~~~~~~~~~~~~~~~~~~e~r~kR~~~~veiRk~kr~e~l~kkR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~   81 (503)
T d1wa5b_           2 VPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEEDESSVSADQQFYSQLQQELPQM   81 (503)
T ss_dssp             CCGGGCC-----------CCCCCTTSSCCCCSCCCCCSCCSCCCCC----------------------------CCHHHH
T ss_pred             CchHHhHHhccCCCCChHHHHHHHHHHHHHHhHHHHHHHHHhhcCCCcccccccccchhccccchhhHHHHHHHHHHHHH
Confidence            57889999999 75 99999999999999999999999999999764322211 110        011112233578999


Q ss_pred             HHhhcCCCHHHHHHHHHHHHHHhccCCCCchhHHhhcCcHHHHHHhhcCCCCHHHHHHHHHHHHHhhcCCCcchHHHHhC
Q 015687           77 VAGVWSDDRNIQLDATTQFRKLLSIERSPPINEVIQSGVVPRFIEFLSRDDFPQLQFEAAWALTNIASGTSENTRVVIDH  156 (402)
Q Consensus        77 ~~~l~s~~~~~~~~a~~~l~~l~s~~~~~~~~~~~~~g~i~~L~~lL~~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~  156 (402)
                      ++.++++|...+..|+..++++++.+..++++.+++.|++|.|+++++.+.++.++..|+|+|++++.+++..+..+.+.
T Consensus        82 ~~~~~s~~~~~~~~a~~~~r~~ls~~~~~~i~~ii~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~  161 (503)
T d1wa5b_          82 TQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDA  161 (503)
T ss_dssp             HHHHSCSSHHHHHHHHHHHHHHTCCSSSCSHHHHHHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHT
T ss_pred             HHHhcCCCHHHHHHHHHHHHHHHhcCCCchHHHHHHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhC
Confidence            99999999999999999999999888888999999999999999999876558899999999999999888899999999


Q ss_pred             CchHHHHHhhCCCCHHHHHHHHHHHHHhhCCCchhhHHHHhcCChHHHHHHhccchhhHHHHHHHHHHHHhhhCC-CCCc
Q 015687          157 GAVPIFVRLLSSPTDDVREQAVWALGNVAGDSPKCRDLVLSNGALMPLLAQFNEHAKLSMLRNATWTLSNFCRGK-PQPL  235 (402)
Q Consensus       157 g~i~~L~~lL~~~~~~v~~~a~~~L~nl~~~~~~~~~~~~~~g~i~~L~~~l~~~~~~~~~~~a~~~L~~l~~~~-~~~~  235 (402)
                      |+++.++.+|.+++.++++.|+|+|+||+.+++.+++.+.+.|++++++.++ .+.+..+++.++|++.+++.+. +...
T Consensus       162 g~i~~l~~lL~s~~~~i~~~a~~~L~nia~~~~~~r~~l~~~~~~~~L~~ll-~~~~~~~~~~~~~~l~nl~~~~~~~~~  240 (503)
T d1wa5b_         162 DAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF-NSNKPSLIRTATWTLSNLCRGKKPQPD  240 (503)
T ss_dssp             TCHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHGG-GSCCHHHHHHHHHHHHHHHCCSSSCCC
T ss_pred             CChHHHHHHhcCCChhHHHHHHHHHHHHhhhhHHHHHHHHhhcccccchhhc-ccCCHHHHHHHHHHHHHHhcCCccchH
Confidence            9999999999999999999999999999999999999999999999999999 6677889999999999999886 5566


Q ss_pred             hhhhhchHHHHHHhccCCChhHHHHHHHHHHHhccCChHHHHHHHHhCcHHHHHHhcCCCChhhHHHHHHHHHHhhcCCh
Q 015687          236 FEQTRPALPALERLIHSNDDEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLRHPSPSVLIPALRTVGNIVTGDD  315 (402)
Q Consensus       236 ~~~~~~~l~~L~~lL~~~~~~v~~~a~~~l~~l~~~~~~~~~~~~~~~~i~~L~~~L~~~~~~v~~~a~~~l~nl~~~~~  315 (402)
                      .....+++|.++.++.+.|++++..++|++.+++...++.+..+++.|+++.++.++.++++.++.+++.++++++.+.+
T Consensus       241 ~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~nl~~~~~  320 (503)
T d1wa5b_         241 WSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGND  320 (503)
T ss_dssp             HHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSCH
T ss_pred             HHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhccCCchhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHHHHHHHHH
Confidence            67778999999999999999999999999999999988888889999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCChHHHHHHhcCCCchhHHHHHHHHHHHHhcCCHHHHHHHHHcCCHHHHHHHhccCCHHHHHHHHHHHHHh
Q 015687          316 MQTQCIINHQALPCLLDLLTQNYKKSIKKEACWTISNITAGNVNQIQAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNA  395 (402)
Q Consensus       316 ~~~~~i~~~~~l~~L~~ll~~~~~~~v~~~a~~~L~nl~~~~~~~~~~l~~~~~i~~L~~ll~~~~~~v~~~a~~aL~nl  395 (402)
                      ..+..+++.|+++.+..++.++ ++.++++++|+|+|++.++++++..+++.|+++.++.++.+++++++++|+|+|+|+
T Consensus       321 ~~~~~~~~~~~l~~l~~ll~~~-~~~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~~~l~nl  399 (503)
T d1wa5b_         321 LQTQVVINAGVLPALRLLLSSP-KENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNA  399 (503)
T ss_dssp             HHHHHHHHTTHHHHHHHHTTCS-CHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHHHHHHHH
T ss_pred             HHHHhhhccchHHHHHHHhcCC-CHHHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccCChhHHHHHHHHHHHH
Confidence            9999999999999999999998 999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCC
Q 015687          396 TSGGSS  401 (402)
Q Consensus       396 ~~~~~~  401 (402)
                      +.+++.
T Consensus       400 ~~~~~~  405 (503)
T d1wa5b_         400 SSGGLQ  405 (503)
T ss_dssp             HHHTTT
T ss_pred             Hhcccc
Confidence            987753



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure