Citrus Sinensis ID: 015690
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 402 | ||||||
| 4210948 | 415 | DnaJ protein [Hevea brasiliensis] | 0.980 | 0.949 | 0.913 | 0.0 | |
| 4008159 | 420 | DnaJ homolog [Salix gilgiana] | 0.982 | 0.940 | 0.902 | 0.0 | |
| 255546721 | 418 | Chaperone protein dnaJ, putative [Ricinu | 0.982 | 0.944 | 0.934 | 0.0 | |
| 350536331 | 419 | DnaJ-like protein [Solanum lycopersicum] | 0.982 | 0.942 | 0.896 | 0.0 | |
| 225463715 | 416 | PREDICTED: dnaJ protein homolog [Vitis v | 0.980 | 0.947 | 0.916 | 0.0 | |
| 161137763 | 417 | DnaJ [Viola baoshanensis] | 0.982 | 0.947 | 0.909 | 0.0 | |
| 224097588 | 420 | predicted protein [Populus trichocarpa] | 0.982 | 0.940 | 0.904 | 0.0 | |
| 224113389 | 422 | predicted protein [Populus trichocarpa] | 0.982 | 0.936 | 0.900 | 0.0 | |
| 449525882 | 413 | PREDICTED: dnaJ protein homolog [Cucumis | 0.975 | 0.949 | 0.916 | 0.0 | |
| 10945669 | 418 | J1P [Daucus carota] gi|10945671|gb|AAG24 | 0.982 | 0.944 | 0.904 | 0.0 |
| >gi|4210948|gb|AAD12055.1| DnaJ protein [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
Score = 717 bits (1850), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 361/395 (91%), Positives = 375/395 (94%), Gaps = 1/395 (0%)
Query: 8 KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 67
KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG
Sbjct: 22 KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 81
Query: 68 MGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSL 127
MG GGGAHDPFDIFQSFFGG+PFGGG S R++ GEDVIHPLKVSLEDLYNGTSKKLSL
Sbjct: 82 MGSGGGAHDPFDIFQSFFGGNPFGGGGSSRGRRKEGEDVIHPLKVSLEDLYNGTSKKLSL 141
Query: 128 SRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETIN 187
SRNVIC+KCKGKGSKSGASMKCSGCQGSGMKVSIR LGPSMIQQMQHPCNECKGTGETIN
Sbjct: 142 SRNVICSKCKGKGSKSGASMKCSGCQGSGMKVSIRQLGPSMIQQMQHPCNECKGTGETIN 201
Query: 188 DKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEH 247
DKDRCPQCKGEKV+QEKKVLEVIVEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH
Sbjct: 202 DKDRCPQCKGEKVVQEKKVLEVIVEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEH 261
Query: 248 PKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGM 307
PKFKRKGDDL V+HTLSLTEALC QF++THLDG LLIKSQPGEVVKPDQFKAINDEGM
Sbjct: 262 PKFKRKGDDLIVDHTLSLTEALCASQFILTHLDG-DLLIKSQPGEVVKPDQFKAINDEGM 320
Query: 308 PMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDV 367
PMYQRPFMRGKLYIHF+VDFP+SL PDQCK LE VLP RTSVQL+DMELDECEETTLHDV
Sbjct: 321 PMYQRPFMRGKLYIHFSVDFPDSLPPDQCKALEAVLPSRTSVQLSDMELDECEETTLHDV 380
Query: 368 NIEEEMRRKQQAAQEAYDEDDDMQGGAQRVQCAQQ 402
N +EEMRRKQQ AQEAYDEDDDM GG QRVQCAQQ
Sbjct: 381 NFDEEMRRKQQQAQEAYDEDDDMHGGGQRVQCAQQ 415
|
Source: Hevea brasiliensis Species: Hevea brasiliensis Genus: Hevea Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|4008159|dbj|BAA35121.1| DnaJ homolog [Salix gilgiana] | Back alignment and taxonomy information |
|---|
| >gi|255546721|ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|111143344|gb|ABH06547.1| molecular chaperone [Ricinus communis] gi|223546415|gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|350536331|ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum] gi|6782421|gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|225463715|ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera] gi|296084435|emb|CBI24994.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|161137763|gb|ABX57881.1| DnaJ [Viola baoshanensis] | Back alignment and taxonomy information |
|---|
| >gi|224097588|ref|XP_002310999.1| predicted protein [Populus trichocarpa] gi|222850819|gb|EEE88366.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224113389|ref|XP_002316479.1| predicted protein [Populus trichocarpa] gi|118486965|gb|ABK95315.1| unknown [Populus trichocarpa] gi|222865519|gb|EEF02650.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449525882|ref|XP_004169945.1| PREDICTED: dnaJ protein homolog [Cucumis sativus] gi|461944|sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: Precursor gi|18260|emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|10945669|gb|AAG24642.1|AF308737_1 J1P [Daucus carota] gi|10945671|gb|AAG24643.1|AF308738_1 J2P [Daucus carota] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 402 | ||||||
| TAIR|locus:2081378 | 420 | J3 [Arabidopsis thaliana (taxi | 0.982 | 0.940 | 0.718 | 5.4e-150 | |
| TAIR|locus:505006628 | 419 | J2 "DNAJ homologue 2" [Arabido | 0.982 | 0.942 | 0.690 | 7.3e-146 | |
| ZFIN|ZDB-GENE-030131-2884 | 413 | dnaja2l "DnaJ (Hsp40) homolog, | 0.895 | 0.871 | 0.459 | 2.4e-85 | |
| UNIPROTKB|O60884 | 412 | DNAJA2 "DnaJ homolog subfamily | 0.972 | 0.949 | 0.439 | 6.2e-85 | |
| UNIPROTKB|Q2HJ94 | 412 | DNAJA2 "DnaJ homolog subfamily | 0.875 | 0.854 | 0.470 | 1e-84 | |
| UNIPROTKB|F1RP05 | 412 | LOC100521133 "Uncharacterized | 0.875 | 0.854 | 0.470 | 1.3e-84 | |
| MGI|MGI:1931882 | 412 | Dnaja2 "DnaJ (Hsp40) homolog, | 0.972 | 0.949 | 0.436 | 2.1e-84 | |
| UNIPROTKB|Q5M9H7 | 412 | Dnaja2 "DnaJ homolog subfamily | 0.972 | 0.949 | 0.436 | 2.1e-84 | |
| ZFIN|ZDB-GENE-040426-2884 | 412 | dnaja2 "DnaJ (Hsp40) homolog, | 0.875 | 0.854 | 0.455 | 5.6e-84 | |
| RGD|71001 | 412 | Dnaja2 "DnaJ (Hsp40) homolog, | 0.972 | 0.949 | 0.434 | 7.2e-84 |
| TAIR|locus:2081378 J3 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1464 (520.4 bits), Expect = 5.4e-150, P = 5.4e-150
Identities = 286/398 (71%), Positives = 309/398 (77%)
Query: 8 KNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEX 67
K+AS +DLKKAY+KAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKE
Sbjct: 23 KSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEG 82
Query: 68 XXXXXXAHDPFDIXXXXXXXXXXXXXXXXXXXXXXXEDVIHPLKVSLEDLYNGTSKKLSL 127
HDPFDI EDV+HPLKVSLED+Y GT KKLSL
Sbjct: 83 MGGGGGGHDPFDIFSSFFGGGPFGGNTSRQRRQRRGEDVVHPLKVSLEDVYLGTMKKLSL 142
Query: 128 SRNVIXXXXXXXXXXXXXXXXXXXXQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETIN 187
SRN + QGSGMKVSIR LGP MIQQMQH CNECKGTGETIN
Sbjct: 143 SRNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQLGPGMIQQMQHACNECKGTGETIN 202
Query: 188 DKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEH 247
D+DRCPQCKG+KVI EKKVLEV VEKGMQ+ QKITF G+ADEAPDTVTGDIVFVLQQKEH
Sbjct: 203 DRDRCPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEH 262
Query: 248 PKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGM 307
PKFKRKG+DLFVEHTLSLTEALCGFQFV+THLDGR LLIKS PGEVVKPD +KAI+DEGM
Sbjct: 263 PKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGM 322
Query: 308 PMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDV 367
P+YQRPFM+GKLYIHFTV+FP+SLSPDQ K LE VLP ++ QL+DME+DECEETTLHDV
Sbjct: 323 PIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDV 382
Query: 368 NIEEEMRRKXXXXXXXXXXXXXXX---GGAQRVQCAQQ 402
NIE+EMRRK GGAQRVQCAQQ
Sbjct: 383 NIEDEMRRKAQAQREAYDDDDEDDDHPGGAQRVQCAQQ 420
|
|
| TAIR|locus:505006628 J2 "DNAJ homologue 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2884 dnaja2l "DnaJ (Hsp40) homolog, subfamily A, member 2, like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60884 DNAJA2 "DnaJ homolog subfamily A member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2HJ94 DNAJA2 "DnaJ homolog subfamily A member 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RP05 LOC100521133 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1931882 Dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5M9H7 Dnaja2 "DnaJ homolog subfamily A member 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2884 dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|71001 Dnaja2 "DnaJ (Hsp40) homolog, subfamily A, member 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 402 | |||
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 1e-147 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-109 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 2e-95 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 2e-76 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 5e-64 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 1e-62 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 5e-60 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 7e-59 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-58 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 9e-58 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-57 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 9e-57 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 8e-55 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 1e-53 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 2e-53 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 3e-53 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 3e-53 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 4e-53 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 8e-53 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 9e-53 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 5e-50 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-48 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-48 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 6e-46 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-45 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 2e-44 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 2e-43 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-43 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 8e-43 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 7e-39 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 2e-25 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 1e-23 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 3e-22 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 3e-19 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 7e-18 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 3e-17 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 8e-17 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 8e-15 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 9e-15 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 3e-14 | |
| PHA03102 | 153 | PHA03102, PHA03102, Small T antigen; Reviewed | 1e-08 | |
| PHA02624 | 647 | PHA02624, PHA02624, large T antigen; Provisional | 9e-08 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 1e-06 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 2e-06 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 3e-05 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 8e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.002 |
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
Score = 425 bits (1093), Expect = e-147
Identities = 187/400 (46%), Positives = 255/400 (63%), Gaps = 15/400 (3%)
Query: 5 ESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDAL 64
K+ + ++KKAYRK AIK+HPDKGGDPEKFKE+++AYEVLSDPEKR+IYD+YGE
Sbjct: 35 NLSKDCTTSEIKKAYRKLAIKHHPDKGGDPEKFKEISRAYEVLSDPEKRKIYDEYGE--- 91
Query: 65 KEGMGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKK 124
EG+ GG D D+F FGG GG ++RGED++ LKV+LE +YNG +K
Sbjct: 92 -EGLEGGEQPADASDLFDLIFGGGRKPGG------KKRGEDIVSHLKVTLEQIYNGAMRK 144
Query: 125 LSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGE 184
L+++++VIC C+G G A + C C G G++V IR +G MI Q Q CN C G G+
Sbjct: 145 LAINKDVICANCEGHGGPKDAFVDCKLCNGQGIRVQIRQMGS-MIHQTQSTCNSCNGQGK 203
Query: 185 TINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQ 244
I + +C C G+ V + +K+LEV ++KG+ N KITF GEADE P+ + G++VF+L +
Sbjct: 204 IIPESKKCKNCSGKGVKKTRKILEVNIDKGVPNQHKITFHGEADEKPNEIPGNVVFILNE 263
Query: 245 KEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAIND 304
K H FKR+G DLF+ +SL EAL GF F ITHLDGR+LL+ + PGEVVKP K IN+
Sbjct: 264 KPHDTFKREGGDLFITKKISLYEALTGFVFYITHLDGRKLLVNTPPGEVVKPGDIKVINN 323
Query: 305 EGMPMYQRPFMRGKLYIHFTVDFPESLSPD-QCKMLETVLPPRTSVQLTDMELDECEETT 363
EGMP Y+ PF +G LY+ F V FP + K + L P+ + D+E E E T
Sbjct: 324 EGMPTYKSPFKKGNLYVTFEVIFPVDRKFTNEEKEILKSLFPQNPEEKKDLEDTEIEVVT 383
Query: 364 LHDVNIEE-EMRRKQQAAQEAYDEDDDMQGGAQRVQCAQQ 402
+V+ EE + R ++Q QE D++ +RV C QQ
Sbjct: 384 AQNVDPEEVKDRDQKQQYQEDEDDEHHQ--EGERVACRQQ 421
|
Length = 421 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 402 | |||
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 100.0 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.93 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.86 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.81 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.8 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.78 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.77 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.73 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.72 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.71 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.69 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.67 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.65 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.64 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.58 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.57 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.57 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 99.55 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.55 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.53 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.46 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.46 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.43 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.41 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.41 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.4 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.4 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.4 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.36 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.35 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.35 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.34 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.32 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.3 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.29 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.29 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.28 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.28 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.28 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.27 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.27 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.24 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.24 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.23 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.22 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.2 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.19 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.18 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.17 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.17 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.15 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.13 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.11 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 99.02 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 98.92 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 98.9 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.68 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 98.67 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.5 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.42 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.41 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.41 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 98.4 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 98.37 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 98.36 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.27 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.1 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 98.06 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.87 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 97.66 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 97.48 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 97.24 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.06 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 96.56 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 95.85 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 95.85 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 94.56 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 93.42 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 91.35 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 90.56 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 90.44 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 89.26 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 88.25 | |
| KOG2824 | 281 | consensus Glutaredoxin-related protein [Posttransl | 87.73 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 87.52 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 80.53 |
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.3e-101 Score=772.68 Aligned_cols=386 Identities=47% Similarity=0.895 Sum_probs=347.6
Q ss_pred cccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHhhCCccccccccccccccccccCCCCCCCCCCcccc
Q 015690 2 RFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIF 81 (402)
Q Consensus 2 ~iLgv~~~As~~eIkkAYrklA~k~HPDkn~~~~kFk~i~~AYevLsd~~kR~~YD~~G~~~~~~g~~~~~~~~d~~diF 81 (402)
+||||+++||.+|||||||+||++||||+|+++++|++|++||||||||+||++||+||++++.++. ++.++.|+|
T Consensus 32 ~vLGV~~~As~~eIKkAYrkla~k~HPDk~~~~e~F~~i~~AYevLsD~~kR~~YD~~G~~~~~~~~----~~~d~~d~f 107 (421)
T PTZ00037 32 EVLNLSKDCTTSEIKKAYRKLAIKHHPDKGGDPEKFKEISRAYEVLSDPEKRKIYDEYGEEGLEGGE----QPADASDLF 107 (421)
T ss_pred HHcCCCCCCCHHHHHHHHHHHHHHHCCCCCchHHHHHHHHHHHHHhccHHHHHHHhhhcchhcccCC----CCcchhhhH
Confidence 6899999999999999999999999999999899999999999999999999999999998876421 124577899
Q ss_pred cccccCCCCCCCCCCCccccCCcceeeccccccccccccccceecceeeeecCCccCCCcccCceeeCCCCcCCceEEEE
Q 015690 82 QSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSI 161 (402)
Q Consensus 82 ~~~Fgg~~~gg~~~~~~~~~~g~d~~~~l~vslee~~~G~~~~~~~~r~~~C~~C~G~G~~~~~~~~C~~C~G~G~~~~~ 161 (402)
+.|||++ + +..+++++.|+.+.|.|||+|+|+|+++++.+.+.+.|+.|+|+|.......+|+.|+|+|+++..
T Consensus 108 ~~~Fggg----~--~~~~~~rg~di~~~l~vtLee~~~G~~~~i~~~r~~~C~~C~G~G~~~~~~~~C~~C~G~G~~~~~ 181 (421)
T PTZ00037 108 DLIFGGG----R--KPGGKKRGEDIVSHLKVTLEQIYNGAMRKLAINKDVICANCEGHGGPKDAFVDCKLCNGQGIRVQI 181 (421)
T ss_pred HHhhccc----c--ccccccCCCCEEEEeeeeHHHHhCCCceEEEeeccccccccCCCCCCCCCCccCCCCCCCCeEEEE
Confidence 9999742 1 112346799999999999999999999999999999999999999877767899999999999999
Q ss_pred EecCCceeeEeeeeCCCCCCcceEEcCCCCCCccCCccEEEEcEEEEEEecCCCcCCCEEecCCCcCCCCCCCCccEEEE
Q 015690 162 RHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFV 241 (402)
Q Consensus 162 ~~~gpg~~~~~~~~C~~C~G~G~~~~~~~~C~~C~G~g~~~~~~~l~V~Ip~G~~~G~~i~~~geG~~~~g~~~GDliv~ 241 (402)
+++|| |+++++.+|+.|+|+|+++..+++|+.|+|++++.+.++|+|+||+|+.+|++|+|+|+|++.++..+|||||+
T Consensus 182 ~~~g~-~~~q~~~~C~~C~G~G~~i~~~~~C~~C~G~g~v~~~~~l~V~Ip~G~~dG~~I~~~G~Gd~~~~~~pGDLiv~ 260 (421)
T PTZ00037 182 RQMGS-MIHQTQSTCNSCNGQGKIIPESKKCKNCSGKGVKKTRKILEVNIDKGVPNQHKITFHGEADEKPNEIPGNVVFI 260 (421)
T ss_pred Eeecc-eeeEEEEeCCCCCCcceeccccccCCcCCCcceeeeeeEEEEeeCCCCCCCcEEEEecccCCCCCCCCCcEEEE
Confidence 99999 88999999999999999998889999999999999999999999999999999999999999888999999999
Q ss_pred EEEecCCCccccCCceeeeeccCHHHHhcCCEEEEeccCCcEEEEEeCCCccccCCceEEecCCCCCCCCCCCCCCcEEE
Q 015690 242 LQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYI 321 (402)
Q Consensus 242 i~v~~h~~f~R~g~dL~~~~~I~l~eAl~G~~~~i~tldG~~l~v~i~~g~vi~~g~~~~i~g~Gmp~~~~~~~~GdL~i 321 (402)
|.++||+.|+|+|+||++++.|||+|||+|+++.|+||||+.|.|+||||+|++||++++|+|+|||..++++.+|||||
T Consensus 261 I~~~ph~~F~R~G~DL~~~~~Isl~eAllG~~i~I~tLdG~~l~I~ip~g~vt~pg~~~~I~geGmP~~~~~~~rGDL~V 340 (421)
T PTZ00037 261 LNEKPHDTFKREGGDLFITKKISLYEALTGFVFYITHLDGRKLLVNTPPGEVVKPGDIKVINNEGMPTYKSPFKKGNLYV 340 (421)
T ss_pred EEecCCCCcEEeCCeEEEEEeCCHHHHhcCCEEEeeCCCCCeEEEEeCCCcccCCCcEEEeCCCCcccCCCCCCCCCEEE
Confidence 99999999999999999999999999999999999999999899999999999999999999999998766567999999
Q ss_pred EEEEeCC--CCCCHHHHHHHHhhCCCCCCCCCccCcccccceeeeccCChhHHHHHHhhhhccccccCCCC--CCCCCCC
Q 015690 322 HFTVDFP--ESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDM--QGGAQRV 397 (402)
Q Consensus 322 ~~~V~~P--~~l~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~ 397 (402)
+|+|.|| +.||++|+++|++|||.++.... +++..++|++++++||+++...+ .++++|+||+|+ ++++++|
T Consensus 341 ~~~V~~P~~~~Ls~~qk~ll~~l~~~~~~~~~-~~~~~~~e~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~v 416 (421)
T PTZ00037 341 TFEVIFPVDRKFTNEEKEILKSLFPQNPEEKK-DLEDTEIEVVTAQNVDPEEVKDR---DQKQQYQEDEDDEHHQEGERV 416 (421)
T ss_pred EEEEEcCCCCCCCHHHHHHHHHhccCCCCCCC-CCCcccceeEecccCCHHHhhhh---HHHHhhccccccccCCCCCcc
Confidence 9999999 88999999999999997654443 55678899999999999876444 234555544433 3577999
Q ss_pred CCcCC
Q 015690 398 QCAQQ 402 (402)
Q Consensus 398 ~C~~q 402 (402)
|||||
T Consensus 417 ~c~~q 421 (421)
T PTZ00037 417 ACRQQ 421 (421)
T ss_pred ccCCC
Confidence 99998
|
|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 402 | ||||
| 1nlt_A | 248 | The Crystal Structure Of Hsp40 Ydj1 Length = 248 | 2e-45 | ||
| 3agz_A | 190 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 9e-25 | ||
| 2qld_A | 183 | Human Hsp40 Hdj1 Length = 183 | 1e-24 | ||
| 3agx_A | 181 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 2e-24 | ||
| 2q2g_A | 180 | Crystal Structure Of Dimerization Domain Of Hsp40 F | 5e-23 | ||
| 1c3g_A | 170 | S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 1 | 4e-19 | ||
| 2b26_A | 173 | The Crystal Structure Of The Protein Complex Of Yea | 4e-19 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 2e-14 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 6e-14 | ||
| 1xao_A | 121 | Hsp40-Ydj1 Dimerization Domain Length = 121 | 9e-13 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 1e-12 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 1e-12 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 1e-11 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 4e-11 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 5e-11 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 1e-09 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-09 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-09 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-09 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-09 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 2e-09 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-08 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 2e-08 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 4e-06 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 7e-06 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 2e-05 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 3e-05 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 8e-04 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 9e-04 |
| >pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 | Back alignment and structure |
|
| >pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 | Back alignment and structure |
| >pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 | Back alignment and structure |
| >pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 | Back alignment and structure |
| >pdb|2Q2G|A Chain A, Crystal Structure Of Dimerization Domain Of Hsp40 From Cryptosporidium Parvum, Cgd2_1800 Length = 180 | Back alignment and structure |
| >pdb|1C3G|A Chain A, S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 170 | Back alignment and structure |
| >pdb|2B26|A Chain A, The Crystal Structure Of The Protein Complex Of Yeast Hsp40 Sis1 And Hsp70 Ssa1 Length = 173 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|1XAO|A Chain A, Hsp40-Ydj1 Dimerization Domain Length = 121 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 402 | |||
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 1e-129 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 1e-86 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 3e-06 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 1e-78 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 2e-72 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 3e-58 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 2e-50 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-34 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 5e-34 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 1e-32 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 5e-32 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-31 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 9e-31 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-29 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 3e-29 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 5e-29 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 6e-29 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 2e-28 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 8e-28 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 3e-27 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 4e-27 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 7e-27 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-26 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 1e-26 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 5e-25 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 2e-23 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 2e-23 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-20 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 5e-20 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 1e-19 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 1e-18 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-18 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-17 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 2e-13 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 2e-13 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 4e-13 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 1e-11 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-09 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 3e-09 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 1e-07 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 6e-07 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 3e-06 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 |
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
Score = 370 bits (952), Expect = e-129
Identities = 110/250 (44%), Positives = 158/250 (63%), Gaps = 4/250 (1%)
Query: 93 GSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGC 152
G+ R R +RG+D+ H + SLE+LY G + KL+L++ ++C +C+G+G K GA KC+ C
Sbjct: 1 GAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSC 60
Query: 153 QGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVE 212
G G+K R +GP MIQ+ Q C+ C GTG+ I+ KDRC C G+KV E+K+LEV VE
Sbjct: 61 NGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVE 119
Query: 213 KGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGF 272
GM++GQ+I F GEAD+APD + GD+VF++ ++ H FKR GDDL E + L A+ G
Sbjct: 120 PGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGG 179
Query: 273 QFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLS 332
+F + H+ G L + PGEV+ P K I +GMP+ + G L I FT+ PE+
Sbjct: 180 EFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYG-GYGNLIIKFTIKDPENHF 238
Query: 333 --PDQCKMLE 340
+ K LE
Sbjct: 239 TSEENLKKLE 248
|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 402 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 100.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 100.0 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 100.0 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 100.0 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.96 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.93 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.88 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.84 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.84 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.84 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.83 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.83 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.83 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.82 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.82 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.82 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.81 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.81 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.8 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.8 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.8 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.79 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.78 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.76 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.76 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.76 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.75 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.72 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.71 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.7 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.69 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.65 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.62 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.61 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.61 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.59 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.59 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.57 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 99.5 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.34 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 99.07 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 98.81 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 98.62 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 98.62 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 98.53 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 98.51 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 98.44 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 98.43 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 98.04 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 98.03 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.75 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 97.47 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 97.0 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.0 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 96.65 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 95.68 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-66 Score=510.27 Aligned_cols=273 Identities=26% Similarity=0.397 Sum_probs=158.1
Q ss_pred cccCCCCCCCHHHHHHHHHHHHHHhCCCCCCC---HHHHHHHHHHHHhhCCccccccccccccccccccCC-------CC
Q 015690 2 RFSESRKNASQDDLKKAYRKAAIKNHPDKGGD---PEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMG-------GG 71 (402)
Q Consensus 2 ~iLgv~~~As~~eIkkAYrklA~k~HPDkn~~---~~kFk~i~~AYevLsd~~kR~~YD~~G~~~~~~g~~-------~~ 71 (402)
+||||+++||.+|||+|||+||++||||+|++ +++|++|++||+||+||++|+.||+|+..+..++++ ++
T Consensus 32 ~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~~~~~~~ 111 (329)
T 3lz8_A 32 AILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQRQTHEQS 111 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCcccccccccCC
Confidence 79999999999999999999999999999975 489999999999999999999999995443221111 11
Q ss_pred CCCCCCcccccccccCCCCCCCCCCCccccCCcceeeccccccccccccccceecceeeeecCCccCCCcccCceeeCCC
Q 015690 72 GGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSG 151 (402)
Q Consensus 72 ~~~~d~~diF~~~Fgg~~~gg~~~~~~~~~~g~d~~~~l~vslee~~~G~~~~~~~~r~~~C~~C~G~G~~~~~~~~C~~ 151 (402)
.++.++.|||++|||+++++ ++.++++++.|+.+.|.|||+|+|+|+++++.+++.+.|
T Consensus 112 f~~~~f~diF~~~Fg~~g~~---~~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~------------------ 170 (329)
T 3lz8_A 112 YSQQDFDDIFSSMFGQQAHQ---RRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN------------------ 170 (329)
T ss_dssp ----------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC------------------
T ss_pred cCCCchhhhhHhhhcCcCCC---CCCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec------------------
Confidence 11235679999999853211 112335689999999999999999999999998876532
Q ss_pred CcCCceEEEEEecCCceeeEeeeeCCCCCCcceEEcCCCCCCccCCccEEEEcEEEEEEecCCCcCCCEEecCCCcCCC-
Q 015690 152 CQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEA- 230 (402)
Q Consensus 152 C~G~G~~~~~~~~gpg~~~~~~~~C~~C~G~G~~~~~~~~C~~C~G~g~~~~~~~l~V~Ip~G~~~G~~i~~~geG~~~- 230 (402)
|.| .+ ++...++++|+||||+++|++|+|+|+|++.
T Consensus 171 --g~G---------------------------~v--------------~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~ 207 (329)
T 3lz8_A 171 --VFG---------------------------MI--------------ESETPKTLNVKIPAGVVDGQRIRLKGQGTPGE 207 (329)
T ss_dssp --SCC----------------------------C--------------CEEEEEEEEEEECTTCCTTCEEEESSCSCCC-
T ss_pred --CCe---------------------------EE--------------EEecceEEEEeCCCCCCCCCEEEEcccccCCC
Confidence 112 11 1233568999999999999999999999985
Q ss_pred CCCCCccEEEEEEEecCCCccccCCceeeeeccCHHHHhcCCEEEEeccCCcEEEEEeCCCccccCCceEEecCCCCCCC
Q 015690 231 PDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMY 310 (402)
Q Consensus 231 ~g~~~GDliv~i~v~~h~~f~R~g~dL~~~~~I~l~eAl~G~~~~i~tldG~~l~v~i~~g~vi~~g~~~~i~g~Gmp~~ 310 (402)
+++.+|||||+|+++||+.|+|+|+||+++++|+|+|||+|+++.|+||||+ +.|+||+| ++||++++|+|+|||..
T Consensus 208 ~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~VptLdG~-v~l~ip~g--t~~g~~~rl~G~GmP~~ 284 (329)
T 3lz8_A 208 NGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPG--SQAGQRLRIKGKGLVSK 284 (329)
T ss_dssp --CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEEEECTT--CCTTCEEEETTCSCBCS
T ss_pred CCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEEEECCCCC-EEEEECCC--CCCCCEEEEcCCCCCCC
Confidence 4678999999999999999999999999999999999999999999999998 68999999 69999999999999975
Q ss_pred CCCCCCCcEEEEEEEeCCCCCCHHHHHHHHhhCC
Q 015690 311 QRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLP 344 (402)
Q Consensus 311 ~~~~~~GdL~i~~~V~~P~~l~~~~~~~l~~~l~ 344 (402)
..+|||||+|+|.||++|+++|+++|+++..
T Consensus 285 ---~~rGDL~v~~~V~~P~~l~~~q~~~l~~~~~ 315 (329)
T 3lz8_A 285 ---THTGDLFAVIKIVMPTKPDEKARELWQQLAA 315 (329)
T ss_dssp ---SCBCCEEEEEEECCCSSCCHHHHHHHHHHHH
T ss_pred ---CCCCCEEEEEEEECCCCCCHHHHHHHHHHHh
Confidence 3699999999999999999999999999875
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 402 | ||||
| d1c3ga2 | 90 | b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba | 3e-24 | |
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 2e-23 | |
| d1nlta2 | 80 | b.4.1.1 (A:258-337) Mitochondrial protein import p | 3e-21 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 3e-15 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 1e-13 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 3e-13 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 4e-13 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 5e-13 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 2e-11 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 5e-11 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 0.002 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 6e-11 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 2e-10 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 8e-10 | |
| d1nlta1 | 74 | b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei | 5e-09 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 2e-06 |
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
class: All beta proteins fold: HSP40/DnaJ peptide-binding domain superfamily: HSP40/DnaJ peptide-binding domain family: HSP40/DnaJ peptide-binding domain domain: Heat shock protein 40 Sis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 93.5 bits (232), Expect = 3e-24
Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 2/91 (2%)
Query: 250 FKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPM 309
FKR GDDL LS E+L GF I +DGR L + V+P Q +GMP
Sbjct: 2 FKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQ--PVQPSQTSTYPGQGMPT 59
Query: 310 YQRPFMRGKLYIHFTVDFPESLSPDQCKMLE 340
+ P RG L + + VD+P SL+ Q + ++
Sbjct: 60 PKNPSQRGNLIVKYKVDYPISLNDAQKRAID 90
|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 402 | |||
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.93 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.88 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.88 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.85 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.78 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.77 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.71 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.66 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.64 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.64 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.63 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.63 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 99.56 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.28 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.72 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.63 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 98.42 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 98.23 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.66 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 96.73 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 90.48 |
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: HSP40/DnaJ peptide-binding domain superfamily: HSP40/DnaJ peptide-binding domain family: HSP40/DnaJ peptide-binding domain domain: Heat shock protein 40 Sis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.93 E-value=8.2e-27 Score=184.45 Aligned_cols=90 Identities=38% Similarity=0.647 Sum_probs=85.7
Q ss_pred CccccCCceeeeeccCHHHHhcCCEEEEeccCCcEEEEEeCCCccccCCceEEecCCCCCCCCCCCCCCcEEEEEEEeCC
Q 015690 249 KFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFP 328 (402)
Q Consensus 249 ~f~R~g~dL~~~~~I~l~eAl~G~~~~i~tldG~~l~v~i~~g~vi~~g~~~~i~g~Gmp~~~~~~~~GdL~i~~~V~~P 328 (402)
.|+|+|+||+++++|||+|||+|+++.|+|+||+.+.|++|++ +++|+.++|+|+|||.+++++.+|||||+|+|.||
T Consensus 1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i~ip~~--~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~P 78 (90)
T d1c3ga2 1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQP--VQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 78 (90)
T ss_dssp SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEEEESSC--CCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBCC
T ss_pred CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceecccccc--cccccccccCCCCCCcCCCCCCcCCEEEEEEEEcC
Confidence 5999999999999999999999999999999999999999988 79999999999999998777789999999999999
Q ss_pred CCCCHHHHHHHH
Q 015690 329 ESLSPDQCKMLE 340 (402)
Q Consensus 329 ~~l~~~~~~~l~ 340 (402)
++||++|+++|+
T Consensus 79 ~~ls~~qk~~lE 90 (90)
T d1c3ga2 79 ISLNDAQKRAID 90 (90)
T ss_dssp SSCCTTHHHHTC
T ss_pred CCCCHHHHHhhC
Confidence 999999998874
|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|