Citrus Sinensis ID: 015763


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-
MAESTEVEDRVDLEEDNYMEEMDDDVEEQVEEDPEEEGGDGNFEENDDDEEYDHSKAGASEKDQSAEANRNDDDTPHVEEEEKPTASVGEDEKDKHAQLLALPPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVAHDIW
ccccccccccccHHHHHccccccccHHHHHcccccccccccccccccHHHHHccccccccccccHHHHHcccccccccHHcccccccccccHHHHHHHHccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEEccccccEEEccccccccHHHHHHHHHcccccccEEEEEEcccccccccEEEEEEEccHHHHHHHHHHHHccccccccccEEEEcccccccccHHHHcccccEEEEccccccccHHHHHHHHcccccEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccEEccEEEEEEEcccccHHcccccccccccccccccccccccccccccccccccccc
cccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEccccHHHHHHHHHHccccccccccEEEcccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEEcccccccEEEEEEcccHHHHHHHHHHHccccccccEEEEEEccccccEEEEcccccccHHHHHHHHHHccccEEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHcccEEEEcccEEEEEEccccHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHccccEEEEEEEcccccccccEEEEcccHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
maestevedrvdleednymeemDDDVEEqveedpeeeggdgnfeendddeeydhskagasekdqsaeanrndddtphveeeekptasvgedekdkhaqllalppngsevfigglpkdaseedlRDLCEPIGDVFEVRLmkdkesgeskgfaFVSFRSKEFAKKAIDELHSKElkgktircslsetknrlfignvpknwtedEFRKVIEdvgpgvetielikdpqnpsrnrgFSFVLYYNNACADYSRQKMLNanfkldgntptiswadpkstpdhsaAASQVKALYvknipdntstEKIKELFQRHgevtkvvmppgksgkrdfgfIHYAERSSALkavkdtekyeiDGQVLEVVLAkpqtdkktegtfpyspglvpthlphagyggfagtpygsvahdiw
maestevedrvdleednymeemDDDVEEQVEedpeeeggdgnfeenddDEEYDHSKagasekdqsaeanrndddtphvEEEEkptasvgedekDKHAQLLALPPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDelhskelkgktircslsetknrlfignvpknwtedefRKVIEDVGPGVETielikdpqnpsrnRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHgevtkvvmppgksgkrdFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVAHDIW
MAESTEVEDRVdleednymeemdddveeqveedpeeeggdgnfeendddeeydHSKAGASEKDQSAEANRNDDDTPHVEEEEKPTASVGEDEKDKHAQLLALPPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVAHDIW
*************************************************************************************************************FIG***********RDLCEPIGDVFEVRLM*********GFAFVSFRSKEFAKKAIDELH**ELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIK*******NRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTI*******************ALYVKNI***********LFQRHGEVTKVV********RDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAK*********TFPYSPGLVPTHLPHAGYGGFAGTPYGSV*****
******V***VDLEEDNYMEE***************************************************************************************VFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTIS*******************LYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVV************************************PY********
**********VDLEEDNYMEE********************NFEEN**********************************************KDKHAQLLALPPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWAD***********SQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVAHDIW
************LEEDNYMEEMDDDVEEQVEEDPEEEGGDGNFEENDDDEEYDHSKAGASEKDQSAEANRNDDDTPHVEEEEKPTASVGED************PNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVAHDIW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESTEVEDRVDLEEDNYMEEMDDDVEEQVEEDPEEEGGDGNFEENDDDEEYDHSKAGASEKDQSAEANRNDDDTPHVEEEEKPTASVGEDEKDKHAQLLALPPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVAHDIW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query401 2.2.26 [Sep-21-2011]
O60506 623 Heterogeneous nuclear rib yes no 0.640 0.412 0.332 2e-42
Q7TMK9 623 Heterogeneous nuclear rib yes no 0.640 0.412 0.332 3e-42
Q7TP47 533 Heterogeneous nuclear rib yes no 0.640 0.482 0.332 4e-42
O43390 633 Heterogeneous nuclear rib no no 0.640 0.406 0.343 4e-39
Q9NQ94 594 APOBEC1 complementation f no no 0.625 0.422 0.361 6e-38
Q5R9H4 587 APOBEC1 complementation f no no 0.625 0.427 0.361 6e-38
Q5YD48 595 APOBEC1 complementation f no no 0.620 0.418 0.357 4e-36
Q923K9 594 APOBEC1 complementation f no no 0.620 0.419 0.353 6e-36
Q91WT8 590 RNA-binding protein 47 OS no no 0.613 0.416 0.342 3e-35
Q66H68 590 RNA-binding protein 47 OS no no 0.613 0.416 0.342 3e-35
>sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 163/265 (61%), Gaps = 8/265 (3%)

Query: 103 PPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAK 162
           P  G+E+F+G +P+D  E++L  L E  G ++++RLM D  +G ++G+AFV+F +KE A+
Sbjct: 158 PSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQ 217

Query: 163 KAIDELHSKELK-GKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIK 221
           +A+   ++ E++ GK I   +S   NRLF+G++PK+ T+++  +    V  G+  + L  
Sbjct: 218 EAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYH 277

Query: 222 DPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQ 281
            P +  +NRGF F+ Y ++  A  +R+++++   K+ GN  T+ WADP   PD    A +
Sbjct: 278 QPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMA-K 336

Query: 282 VKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKD 341
           VK L+V+N+ +  + E +++ F + G++ +V         +D+ FIH+ ER  A+KA+++
Sbjct: 337 VKVLFVRNLANTVTEEILEKAFSQFGKLERV------KKLKDYAFIHFDERDGAVKAMEE 390

Query: 342 TEKYEIDGQVLEVVLAKPQTDKKTE 366
               +++G+ +E+V AKP   K+ E
Sbjct: 391 MNGKDLEGENIEIVFAKPPDQKRKE 415




Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Isoform 1, isoform 2 and isoform 3 are associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins.
Homo sapiens (taxid: 9606)
>sp|Q7TMK9|HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus GN=Syncrip PE=1 SV=2 Back     alignment and function description
>sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 Back     alignment and function description
>sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 Back     alignment and function description
>sp|Q9NQ94|A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens GN=A1CF PE=1 SV=1 Back     alignment and function description
>sp|Q5R9H4|A1CF_PONAB APOBEC1 complementation factor OS=Pongo abelii GN=A1CF PE=2 SV=1 Back     alignment and function description
>sp|Q5YD48|A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus GN=A1cf PE=2 SV=2 Back     alignment and function description
>sp|Q923K9|A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus GN=A1cf PE=1 SV=1 Back     alignment and function description
>sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=2 SV=1 Back     alignment and function description
>sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query401
224130652480 predicted protein [Populus trichocarpa] 0.987 0.825 0.756 1e-169
225453602476 PREDICTED: heterogeneous nuclear ribonuc 0.970 0.817 0.749 1e-168
356573261483 PREDICTED: heterogeneous nuclear ribonuc 0.975 0.809 0.706 1e-165
356506096483 PREDICTED: heterogeneous nuclear ribonuc 0.985 0.817 0.706 1e-162
255648067439 unknown [Glycine max] 0.985 0.899 0.706 1e-162
357512617479 RNA-binding protein [Medicago truncatula 0.977 0.818 0.671 1e-155
255578218 557 nucleolar phosphoprotein, putative [Rici 0.917 0.660 0.684 1e-150
449431998481 PREDICTED: heterogeneous nuclear ribonuc 0.945 0.787 0.679 1e-147
297814257494 RNA recognition motif-containing protein 0.985 0.799 0.651 1e-143
18411454495 RNA recognition motif-containing protein 0.985 0.797 0.635 1e-143
>gi|224130652|ref|XP_002320894.1| predicted protein [Populus trichocarpa] gi|222861667|gb|EEE99209.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 301/398 (75%), Positives = 353/398 (88%), Gaps = 2/398 (0%)

Query: 1   MAESTEVEDRVDLEEDNYMEEMDDDVEEQVEEDPEEEGGDGNFEENDDDEEYDHSKAGAS 60
           MAE TE+E+RVDLEEDNYMEE+DDDVE+Q++ED E++ GD + EEN ++E  D SK   S
Sbjct: 1   MAEGTEIEERVDLEEDNYMEEIDDDVEDQLDEDGEDDAGDPHAEENVEEEYED-SKTEGS 59

Query: 61  EKDQSAEANRNDDDTPHVEEEEKPTASVGEDEKDKHAQLLALPPNGSEVFIGGLPKDASE 120
           +KDQS EA+R   DT   E+E+KPTASV E+EK+KHAQLLALPP+GSEVFIGGLP+D  E
Sbjct: 60  QKDQSPEADRIVADTEPAEDEQKPTASVNEEEKEKHAQLLALPPHGSEVFIGGLPRDVIE 119

Query: 121 EDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRC 180
           ++LRDLCEPIG++FE+RLMKDK+SGESKGFAFV+F+SKE A+KAI+ELHSK+ KGKT+RC
Sbjct: 120 DELRDLCEPIGEIFEIRLMKDKDSGESKGFAFVAFKSKEVARKAIEELHSKDYKGKTLRC 179

Query: 181 SLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNN 240
           S+SETKNRLFIGNVPKN TEDEFRK+IE+VGPGVE IELIKDPQ P+RNRGF+F+LYYNN
Sbjct: 180 SISETKNRLFIGNVPKNLTEDEFRKIIEEVGPGVEVIELIKDPQTPTRNRGFAFILYYNN 239

Query: 241 ACADYSRQKMLNANFKLDGNTPTISWADPKST-PDHSAAASQVKALYVKNIPDNTSTEKI 299
           ACADYSRQKMLNANFKLDG+TPT+SWADPK T PDHSAA+SQVKALYVKNIP+NTSTE++
Sbjct: 240 ACADYSRQKMLNANFKLDGHTPTVSWADPKGTPPDHSAASSQVKALYVKNIPENTSTEQL 299

Query: 300 KELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVLEVVLAKP 359
           K LFQRHG+VTKVVMPPGK+GKRDFGFIHYAERSSALKAV+D EKYEIDGQVLEVVLAKP
Sbjct: 300 KGLFQRHGDVTKVVMPPGKAGKRDFGFIHYAERSSALKAVRDAEKYEIDGQVLEVVLAKP 359

Query: 360 QTDKKTEGTFPYSPGLVPTHLPHAGYGGFAGTPYGSVA 397
           Q DKK +  +PY+ G+ P  +P   Y GFAG PYGS+ 
Sbjct: 360 QADKKPDAAYPYNAGVHPNPVPLPAYSGFAGNPYGSLG 397




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225453602|ref|XP_002264834.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q [Vitis vinifera] gi|296088998|emb|CBI38701.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356573261|ref|XP_003554781.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Glycine max] Back     alignment and taxonomy information
>gi|356506096|ref|XP_003521823.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Glycine max] Back     alignment and taxonomy information
>gi|255648067|gb|ACU24489.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357512617|ref|XP_003626597.1| RNA-binding protein [Medicago truncatula] gi|355501612|gb|AES82815.1| RNA-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255578218|ref|XP_002529977.1| nucleolar phosphoprotein, putative [Ricinus communis] gi|223530539|gb|EEF32420.1| nucleolar phosphoprotein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449431998|ref|XP_004133787.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Cucumis sativus] gi|449477982|ref|XP_004155183.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297814257|ref|XP_002875012.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297320849|gb|EFH51271.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18411454|ref|NP_567192.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|79324963|ref|NP_001031566.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|13605916|gb|AAK32943.1|AF367357_1 AT4g00830/A_TM018A10_14 [Arabidopsis thaliana] gi|21360555|gb|AAM47474.1| AT4g00830/A_TM018A10_14 [Arabidopsis thaliana] gi|110743368|dbj|BAE99571.1| hypothetical protein [Arabidopsis thaliana] gi|332656540|gb|AEE81940.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|332656541|gb|AEE81941.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query401
TAIR|locus:2134638495 LIF2 "LHP1-Interacting Factor 0.850 0.688 0.696 2.5e-136
TAIR|locus:2083248471 AT3G52660 [Arabidopsis thalian 0.835 0.711 0.5 6.9e-96
UNIPROTKB|A3KMV6 633 HNRNPR "Uncharacterized protei 0.640 0.406 0.350 6e-46
UNIPROTKB|E2RE36 633 HNRNPR "Uncharacterized protei 0.640 0.406 0.350 3.5e-43
UNIPROTKB|O43390 633 HNRNPR "Heterogeneous nuclear 0.640 0.406 0.350 3.5e-43
UNIPROTKB|I3LKZ4 599 HNRNPR "Uncharacterized protei 0.640 0.429 0.350 3.5e-43
RGD|631348 632 Hnrnpr "heterogeneous nuclear 0.640 0.406 0.350 3.5e-43
UNIPROTKB|Q566E4 632 Hnrnpr "Heterogeneous nuclear 0.640 0.406 0.350 3.5e-43
FB|FBgn0038826 711 Syp "Syncrip" [Drosophila mela 0.638 0.360 0.363 4.5e-43
ZFIN|ZDB-GENE-030131-3104 560 syncripl "synaptotagmin bindin 0.640 0.458 0.350 4.5e-43
TAIR|locus:2134638 LIF2 "LHP1-Interacting Factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1315 (468.0 bits), Expect = 2.5e-136, Sum P(2) = 2.5e-136
 Identities = 241/346 (69%), Positives = 300/346 (86%)

Query:    55 SKAGASE--KDQSAEANRNDDDTPHVEEEEKPTASVGEDEKDKHAQLLALPPNGSEVFIG 112
             +K G  E  +++ AE + N  D    +++EKP + + +++++K++ LL+LPP+GSEVFIG
Sbjct:    62 TKGGDMEDVQEEIAEDDDNHIDIETADDDEKPPSPIDDEDREKYSHLLSLPPHGSEVFIG 121

Query:   113 GLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKE 172
             GLP+D  EEDLRDLCE IG++FEVRLMKD++SG+SKG+AFV+F++K+ A+KAI+ELHSKE
Sbjct:   122 GLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKE 181

Query:   173 LKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGF 232
              KGKTIRCSLSETKNRLFIGN+PKNWTEDEFRKVIEDVGPGVE IELIKDP N +RNRGF
Sbjct:   182 FKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPGVENIELIKDPTNTTRNRGF 241

Query:   233 SFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQVKALYVKNIPD 292
             +FVLYYNNACADYSRQKM+++NFKL+GN PT++WADPKS+P+HSAAA+QVKALYVKNIP+
Sbjct:   242 AFVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSSPEHSAAAAQVKALYVKNIPE 301

Query:   293 NTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKDTEKYEIDGQVL 352
             NTSTE++KELFQRHGEVTK+V PPGK GKRDFGF+HYAERSSALKAVKDTE+YE++GQ L
Sbjct:   302 NTSTEQLKELFQRHGEVTKIVTPPGKGGKRDFGFVHYAERSSALKAVKDTERYEVNGQPL 361

Query:   353 EVVLAKPQTDKKTEGTFPYSPGLVPTHLP--HAGYGGFAGTPYGSV 396
             EVVLAKPQ ++K + +  YS G  PT  P  H  +GGFA  PYG++
Sbjct:   362 EVVLAKPQAERKHDPS-SYSYGAAPTPAPFVHPTFGGFAAAPYGAM 406


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2083248 AT3G52660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV6 HNRNPR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE36 HNRNPR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43390 HNRNPR "Heterogeneous nuclear ribonucleoprotein R" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKZ4 HNRNPR "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|631348 Hnrnpr "heterogeneous nuclear ribonucleoprotein R" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q566E4 Hnrnpr "Heterogeneous nuclear ribonucleoprotein R" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0038826 Syp "Syncrip" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3104 syncripl "synaptotagmin binding, cytoplasmic RNA interacting protein, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query401
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-49
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-29
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-26
smart0036073 smart00360, RRM, RNA recognition motif 5e-25
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-22
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-21
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-21
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 9e-21
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-20
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 8e-20
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-18
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 2e-18
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 4e-17
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 5e-17
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 5e-17
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-16
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 7e-16
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 9e-16
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-15
smart0036073 smart00360, RRM, RNA recognition motif 2e-15
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 2e-15
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 3e-15
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 4e-15
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 5e-15
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 7e-15
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-14
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-14
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-14
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-14
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-14
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-14
cd1225082 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 9e-14
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-13
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 2e-13
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 3e-13
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 4e-13
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 4e-13
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 6e-13
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 9e-13
cd1248885 cd12488, RRM2_hnRNPR, RNA recognition motif 2 in v 9e-13
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-12
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-12
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 1e-12
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-12
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 2e-12
cd1248985 cd12489, RRM2_hnRNPQ, RNA recognition motif 2 in v 2e-12
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 2e-12
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 3e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-12
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 4e-12
cd1248778 cd12487, RRM1_DND1, RNA recognition motif 1 found 6e-12
cd1249285 cd12492, RRM2_RBM46, RNA recognition motif 2 found 7e-12
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 7e-12
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 7e-12
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 7e-12
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 8e-12
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 8e-12
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 9e-12
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 9e-12
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 9e-12
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-11
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-11
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-11
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-11
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-11
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 2e-11
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 2e-11
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 3e-11
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-11
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-11
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-11
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 4e-11
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 4e-11
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 5e-11
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 5e-11
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 5e-11
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 7e-11
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-10
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-10
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-10
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-10
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-10
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-10
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 3e-10
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-10
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 3e-10
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 3e-10
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 4e-10
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 4e-10
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 4e-10
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 5e-10
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 5e-10
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 6e-10
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 7e-10
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 8e-10
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 8e-10
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 8e-10
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 8e-10
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-09
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-09
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 2e-09
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-09
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 3e-09
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 3e-09
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 3e-09
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 3e-09
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 4e-09
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 4e-09
cd1249085 cd12490, RRM2_ACF, RNA recognition motif 2 in vert 4e-09
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 5e-09
cd1249189 cd12491, RRM2_RBM47, RNA recognition motif 2 in ve 5e-09
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 6e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 8e-09
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 8e-09
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 9e-09
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 9e-09
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 9e-09
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 9e-09
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-08
smart0036073 smart00360, RRM, RNA recognition motif 1e-08
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 1e-08
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-08
cd1256872 cd12568, RRM3_MRD1, RNA recognition motif 3 in yea 2e-08
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 2e-08
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 2e-08
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-08
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-08
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-08
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 2e-08
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 2e-08
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-08
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-08
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 2e-08
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-08
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 3e-08
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 3e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 4e-08
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-08
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 4e-08
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 4e-08
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 4e-08
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 4e-08
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 4e-08
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-08
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 5e-08
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 6e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 6e-08
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 6e-08
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 6e-08
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 8e-08
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 8e-08
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 8e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 8e-08
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 8e-08
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 9e-08
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 9e-08
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-07
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 1e-07
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 1e-07
cd1230386 cd12303, RRM_spSet1p_like, RNA recognition motif i 1e-07
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 1e-07
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 1e-07
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 1e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 1e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-07
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-07
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-07
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 2e-07
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 2e-07
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 2e-07
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 2e-07
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 2e-07
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 2e-07
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 2e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-07
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 2e-07
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 2e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 2e-07
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 2e-07
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 3e-07
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-07
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 3e-07
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 3e-07
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 3e-07
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 4e-07
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 4e-07
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 4e-07
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 4e-07
cd1265876 cd12658, RRM1_MYEF2, RNA recognition motif 1 in ve 4e-07
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 4e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 4e-07
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 4e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 5e-07
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 5e-07
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 6e-07
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 6e-07
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 7e-07
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 7e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 9e-07
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 1e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-06
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 1e-06
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 1e-06
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 1e-06
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 1e-06
cd1275385 cd12753, RRM1_RBM10, RNA recognition motif 1 in ve 1e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 1e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 1e-06
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 1e-06
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 1e-06
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 1e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 1e-06
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 1e-06
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 1e-06
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-06
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-06
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-06
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-06
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 2e-06
cd1264377 cd12643, RRM_CFIm68, RNA recognition motif of pre- 2e-06
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 2e-06
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-06
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 2e-06
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-06
cd1265776 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in v 3e-06
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 3e-06
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 3e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 3e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 4e-06
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 4e-06
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 4e-06
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 4e-06
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 4e-06
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 4e-06
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 5e-06
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 5e-06
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 5e-06
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 5e-06
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 5e-06
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 5e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 6e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 6e-06
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 6e-06
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 6e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 6e-06
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 7e-06
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 7e-06
cd1222884 cd12228, RRM_ENOX, RNA recognition motif (RRM) in 7e-06
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 8e-06
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 8e-06
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 8e-06
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 8e-06
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 9e-06
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-05
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-05
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 1e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 1e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 1e-05
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 1e-05
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-05
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 1e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-05
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 1e-05
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-05
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-05
cd1254993 cd12549, RRM_Set1B, RNA recognition motif in verte 1e-05
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-05
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 1e-05
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 1e-05
cd1253586 cd12535, RRM_FUS_TAF15, RNA recognition motif in v 1e-05
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-05
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 1e-05
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-05
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 2e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-05
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-05
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 2e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-05
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-05
cd1256972 cd12569, RRM4_RBM19, RNA recognition motif 4 in RN 2e-05
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 2e-05
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-05
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 2e-05
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 2e-05
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 2e-05
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-05
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 2e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-05
cd1243676 cd12436, RRM1_2_MATR3_like, RNA recognition motif 2e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 3e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 3e-05
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 3e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 3e-05
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 3e-05
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 3e-05
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 3e-05
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 3e-05
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 3e-05
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 3e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-05
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 4e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 4e-05
cd1243979 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA 4e-05
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 4e-05
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 4e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 5e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 5e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 5e-05
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 5e-05
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 5e-05
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 5e-05
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 5e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 6e-05
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 6e-05
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 6e-05
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 6e-05
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 7e-05
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 7e-05
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 7e-05
cd1253384 cd12533, RRM_EWS, RNA recognition motif in vertebr 8e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 9e-05
cd1227471 cd12274, RRM2_NEFsp, RNA recognition motif 2 in ve 9e-05
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 9e-05
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 9e-05
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 9e-05
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 9e-05
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-04
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-04
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 1e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 1e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 1e-04
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 1e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-04
cd1225082 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 2e-04
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 2e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 2e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 2e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-04
cd1264490 cd12644, RRM_CFIm59, RNA recognition motif of pre- 2e-04
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 2e-04
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 2e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-04
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-04
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-04
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 3e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 3e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 3e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 3e-04
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 3e-04
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 3e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 3e-04
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 3e-04
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 3e-04
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 3e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 4e-04
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 5e-04
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 5e-04
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 5e-04
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 5e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 5e-04
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 5e-04
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 5e-04
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 6e-04
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 6e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 6e-04
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 6e-04
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 6e-04
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 6e-04
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 6e-04
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 6e-04
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 6e-04
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 7e-04
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 7e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 7e-04
cd1275287 cd12752, RRM1_RBM5, RNA recognition motif 1 in ver 7e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 8e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 8e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 8e-04
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 8e-04
cd1239685 cd12396, RRM1_Nop13p_fungi, RNA recognition motif 9e-04
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 9e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 0.001
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 0.001
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 0.001
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.001
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.001
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.001
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 0.001
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 0.001
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.001
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 0.001
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 0.001
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 0.001
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 0.001
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.001
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 0.001
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 0.001
cd1254176 cd12541, RRM2_La, RNA recognition motif 2 in La au 0.001
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 0.001
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 0.001
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.001
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.002
cd1225082 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 0.002
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.002
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.002
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 0.002
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.002
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.002
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 0.002
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 0.002
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 0.002
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 0.002
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 0.002
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 0.002
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 0.002
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.003
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.003
cd1243979 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA 0.003
cd1254895 cd12548, RRM_Set1A, RNA recognition motif in verte 0.003
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.003
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 0.003
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 0.003
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 0.004
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 0.004
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.004
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.004
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.004
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 0.004
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 0.004
cd1266371 cd12663, RRM1_RAVER1, RNA recognition motif 1 in v 0.004
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 0.004
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 0.004
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
 Score =  175 bits (445), Expect = 2e-49
 Identities = 94/266 (35%), Positives = 155/266 (58%), Gaps = 12/266 (4%)

Query: 103 PPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAK 162
           P  G EVF+G +P+D  E++L  L E  G ++E+RLM D  SG+++G+AFV+F  KE AK
Sbjct: 55  PGRGCEVFVGKIPRDLYEDELVPLFEKAGPIYELRLMMDF-SGQNRGYAFVTFCGKEEAK 113

Query: 163 KAIDELHSKELK-GKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIK 221
           +A+  L++ E++ G+ +   +S    RLF+G +PKN   +E  +    V  GV  + +  
Sbjct: 114 EAVKLLNNYEIRPGRLLGVCISVDNCRLFVGGIPKNKKREEILEEFSKVTEGVVDVIVYH 173

Query: 222 DPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWADPKSTPDHSAAASQ 281
              +  +NRGF+FV Y ++  A  +R+K++    +L G+   + WA+P+   D    A  
Sbjct: 174 SAADKKKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHVIAVDWAEPEEEVDEDVMAK- 232

Query: 282 VKALYVKNIPDNTSTEKIKELFQ--RHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAV 339
           VK LYV+N+   T+ E I++ F   + G+V +V         RD+ F+H+ +R  A+KA+
Sbjct: 233 VKILYVRNLMTTTTEEIIEKSFSEFKPGKVERV------KKIRDYAFVHFEDREDAVKAM 286

Query: 340 KDTEKYEIDGQVLEVVLAKPQTDKKT 365
            +    E++G  +EV LAKP  DKK+
Sbjct: 287 DELNGKELEGSEIEVTLAKP-VDKKS 311


Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain. Length = 578

>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240932 cd12488, RRM2_hnRNPR, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240933 cd12489, RRM2_hnRNPQ, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240931 cd12487, RRM1_DND1, RNA recognition motif 1 found in vertebrate dead end protein homolog 1 (DND1) Back     alignment and domain information
>gnl|CDD|240936 cd12492, RRM2_RBM46, RNA recognition motif 2 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240934 cd12490, RRM2_ACF, RNA recognition motif 2 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240935 cd12491, RRM2_RBM47, RNA recognition motif 2 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast Schizosaccharomyces pombe SET domain-containing protein 1 (spSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241197 cd12753, RRM1_RBM10, RNA recognition motif 1 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241087 cd12643, RRM_CFIm68, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241101 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240993 cd12549, RRM_Set1B, RNA recognition motif in vertebrate histone-lysine N-methyltransferase Setd1B (Set1B) Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused in Ewing's sarcoma protein (FUS), TATA-binding protein-associated factor 15 (TAF15) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241013 cd12569, RRM4_RBM19, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the matrin 3 family of nuclear proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240885 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA (uracil-5-)-methyltransferase homolog A (TRMT2A) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|240977 cd12533, RRM_EWS, RNA recognition motif in vertebrate Ewing Sarcoma Protein (EWS) Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240720 cd12274, RRM2_NEFsp, RNA recognition motif 2 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241088 cd12644, RRM_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241196 cd12752, RRM1_RBM5, RNA recognition motif 1 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|240842 cd12396, RRM1_Nop13p_fungi, RNA recognition motif 1 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240985 cd12541, RRM2_La, RNA recognition motif 2 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240696 cd12250, RRM2_hnRNPR_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240885 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA (uracil-5-)-methyltransferase homolog A (TRMT2A) and similar proteins Back     alignment and domain information
>gnl|CDD|240992 cd12548, RRM_Set1A, RNA recognition motif in vertebrate histone-lysine N-methyltransferase Setd1A (Set1A) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241107 cd12663, RRM1_RAVER1, RNA recognition motif 1 in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 401
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.97
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.96
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.96
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.95
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.95
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.95
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.94
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.93
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.92
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.92
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.92
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.92
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.92
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.9
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.9
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.9
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.89
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.89
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.89
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.88
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.87
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.87
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.85
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.85
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.83
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.81
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.79
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.78
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.78
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.76
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.73
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.72
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.71
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.68
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.67
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.67
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 99.66
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.62
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.62
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.6
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.6
KOG0122270 consensus Translation initiation factor 3, subunit 99.58
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 99.57
KOG4207 256 consensus Predicted splicing factor, SR protein su 99.57
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.57
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.56
KOG0122270 consensus Translation initiation factor 3, subunit 99.56
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.55
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.54
PLN03120 260 nucleic acid binding protein; Provisional 99.54
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.54
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 99.53
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.53
PLN03120260 nucleic acid binding protein; Provisional 99.51
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.51
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.5
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.49
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.49
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.49
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.48
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.48
PLN03121243 nucleic acid binding protein; Provisional 99.46
PLN03213 759 repressor of silencing 3; Provisional 99.46
PLN03213 759 repressor of silencing 3; Provisional 99.45
smart0036272 RRM_2 RNA recognition motif. 99.44
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.43
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.43
smart0036272 RRM_2 RNA recognition motif. 99.43
PLN03121 243 nucleic acid binding protein; Provisional 99.42
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 99.42
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 99.41
KOG4207256 consensus Predicted splicing factor, SR protein su 99.4
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.4
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.39
smart0036071 RRM RNA recognition motif. 99.39
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.38
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.37
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.37
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.35
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.34
smart0036071 RRM RNA recognition motif. 99.34
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.33
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.31
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.28
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.28
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 99.28
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.27
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.25
smart0036170 RRM_1 RNA recognition motif. 99.22
smart0036170 RRM_1 RNA recognition motif. 99.22
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.21
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.2
KOG4210285 consensus Nuclear localization sequence binding pr 99.17
KOG4660 549 consensus Protein Mei2, essential for commitment t 99.16
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 99.12
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.1
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.09
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.09
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.07
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 99.01
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 99.01
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 99.01
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 98.99
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.99
KOG1457 284 consensus RNA binding protein (contains RRM repeat 98.98
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.98
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.95
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.94
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.92
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.9
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.88
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.87
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.86
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.85
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.84
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.84
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.84
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.81
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.81
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.73
KOG0226290 consensus RNA-binding proteins [General function p 98.73
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.65
KOG1548 382 consensus Transcription elongation factor TAT-SF1 98.63
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.63
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.61
KOG0106 216 consensus Alternative splicing factor SRp55/B52/SR 98.61
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.61
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.6
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.59
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.59
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 98.55
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.47
KOG0226290 consensus RNA-binding proteins [General function p 98.43
KOG3152278 consensus TBP-binding protein, activator of basal 98.41
KOG1995 351 consensus Conserved Zn-finger protein [General fun 98.36
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.26
KOG0151 877 consensus Predicted splicing regulator, contains R 98.23
KOG0151 877 consensus Predicted splicing regulator, contains R 98.17
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.07
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.97
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.89
KOG3152278 consensus TBP-binding protein, activator of basal 97.84
KOG2314 698 consensus Translation initiation factor 3, subunit 97.84
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.82
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.77
KOG4210285 consensus Nuclear localization sequence binding pr 97.7
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.69
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.68
KOG1855 484 consensus Predicted RNA-binding protein [General f 97.61
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.54
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 97.53
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.52
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 97.49
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.48
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 97.42
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.35
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.3
KOG2314 698 consensus Translation initiation factor 3, subunit 97.26
KOG1855484 consensus Predicted RNA-binding protein [General f 97.17
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 97.1
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.07
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 97.05
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 97.04
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.91
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.56
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.48
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.43
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.21
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 96.2
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.14
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.02
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 95.99
KOG2318 650 consensus Uncharacterized conserved protein [Funct 95.88
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.72
KOG2135526 consensus Proteins containing the RNA recognition 95.71
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 95.62
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.56
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.48
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.41
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.35
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 95.31
KOG1996378 consensus mRNA splicing factor [RNA processing and 95.3
KOG2135526 consensus Proteins containing the RNA recognition 95.29
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.28
KOG2591 684 consensus c-Mpl binding protein, contains La domai 95.17
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.75
KOG2068 327 consensus MOT2 transcription factor [Transcription 94.54
KOG2068327 consensus MOT2 transcription factor [Transcription 94.29
KOG2591 684 consensus c-Mpl binding protein, contains La domai 94.1
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 93.64
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 93.64
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.6
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 93.35
KOG1999 1024 consensus RNA polymerase II transcription elongati 93.31
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 93.21
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.07
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 93.03
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 92.89
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.66
PF04147 840 Nop14: Nop14-like family ; InterPro: IPR007276 Emg 92.54
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 92.27
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 91.83
KOG2318 650 consensus Uncharacterized conserved protein [Funct 89.51
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 88.8
KOG2891 445 consensus Surface glycoprotein [General function p 88.69
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 87.96
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 87.83
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 87.75
PF04147840 Nop14: Nop14-like family ; InterPro: IPR007276 Emg 87.2
KOG4483528 consensus Uncharacterized conserved protein [Funct 86.09
PF14111153 DUF4283: Domain of unknown function (DUF4283) 85.95
PF05285324 SDA1: SDA1; InterPro: IPR007949 This domain consis 85.24
KOG4019193 consensus Calcineurin-mediated signaling pathway i 83.99
KOG2038988 consensus CAATT-binding transcription factor/60S r 83.15
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 82.48
PF10567 309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 80.94
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=4.5e-47  Score=338.29  Aligned_cols=257  Identities=42%  Similarity=0.757  Sum_probs=246.4

Q ss_pred             CCCCCeEEEcCCCCCCCHHHHHHhhcccCCeeEEEEeeCCCCCCceeEEEEEecCHHHHHHHHHHhcCCcc-CCeEEEEE
Q 015763          103 PPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKEL-KGKTIRCS  181 (401)
Q Consensus       103 ~~~~~~v~v~nlp~~~t~~~l~~~f~~~g~i~~~~~~~~~~~g~~~g~a~V~f~~~~~a~~a~~~l~~~~~-~g~~l~v~  181 (401)
                      ++.++-|||+.||.++.+++|.-+|.+.|+|-.+++++++.+|.+||||||.|.+++.|+.||+.||+..| .|+.|.|.
T Consensus        80 p~~G~EVfvGkIPrD~~EdeLvplfEkiG~I~elRLMmD~~sG~nRGYAFVtf~~Ke~Aq~Aik~lnn~Eir~GK~igvc  159 (506)
T KOG0117|consen   80 PPRGCEVFVGKIPRDVFEDELVPLFEKIGKIYELRLMMDPFSGDNRGYAFVTFCTKEEAQEAIKELNNYEIRPGKLLGVC  159 (506)
T ss_pred             CCCCceEEecCCCccccchhhHHHHHhccceeeEEEeecccCCCCcceEEEEeecHHHHHHHHHHhhCccccCCCEeEEE
Confidence            46899999999999999999999999999999999999999999999999999999999999999999987 69999999


Q ss_pred             ecccccccccCCCCCCCCHHHHHHHHHhhCCceeEEEEeeCCCCCCCCccEEEEEeCCHHHHHHHHHHHhcCCcccCCCC
Q 015763          182 LSETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNT  261 (401)
Q Consensus       182 ~~~~~~~l~v~~l~~~~~~~~l~~~f~~~g~~v~~~~~~~~~~~~~~~~g~~~v~f~~~~~a~~a~~~l~~~~~~~~~~~  261 (401)
                      .+..+++|||+|+|+++++++|.+.++++++.|..+.+...|....++||||||.|.+..+|..|.++|....+.+.+..
T Consensus       160 ~Svan~RLFiG~IPK~k~keeIlee~~kVteGVvdVivy~~p~dk~KNRGFaFveYe~H~~Aa~aRrKl~~g~~klwgn~  239 (506)
T KOG0117|consen  160 VSVANCRLFIGNIPKTKKKEEILEEMKKVTEGVVDVIVYPSPDDKTKNRGFAFVEYESHRAAAMARRKLMPGKIKLWGNA  239 (506)
T ss_pred             EeeecceeEeccCCccccHHHHHHHHHhhCCCeeEEEEecCccccccccceEEEEeecchhHHHHHhhccCCceeecCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeeecCCCCCCCCcccccccceEEEccCCCCCCHHHHHHHHhhcCCeeEEEecCCCCCCCCeEEEEeCCHHHHHHHHHh
Q 015763          262 PTISWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGKRDFGFIHYAERSSALKAVKD  341 (401)
Q Consensus       262 ~~v~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~t~e~l~~~f~~~G~i~~v~i~~~~~~~kg~afV~f~~~~~A~~A~~~  341 (401)
                      ++|.|+.|...+... .....+.|||+||+.++|++.|+.+|++||.|.+|+.+++      ||||.|.+.++|.+|++.
T Consensus       240 ~tVdWAep~~e~ded-~ms~VKvLYVRNL~~~tTeE~lk~~F~~~G~veRVkk~rD------YaFVHf~eR~davkAm~~  312 (506)
T KOG0117|consen  240 ITVDWAEPEEEPDED-TMSKVKVLYVRNLMESTTEETLKKLFNEFGKVERVKKPRD------YAFVHFAEREDAVKAMKE  312 (506)
T ss_pred             ceeeccCcccCCChh-hhhheeeeeeeccchhhhHHHHHHHHHhccceEEeecccc------eeEEeecchHHHHHHHHH
Confidence            999999999888776 3367899999999999999999999999999999999865      899999999999999999


Q ss_pred             hcCCeeCCeEEEEEeccCCCcCCCC
Q 015763          342 TEKYEIDGQVLEVVLAKPQTDKKTE  366 (401)
Q Consensus       342 l~g~~i~g~~l~v~~a~~~~~~~~~  366 (401)
                      +||..|+|..|.|.+|++...++..
T Consensus       313 ~ngkeldG~~iEvtLAKP~~k~k~~  337 (506)
T KOG0117|consen  313 TNGKELDGSPIEVTLAKPVDKKKKE  337 (506)
T ss_pred             hcCceecCceEEEEecCChhhhccc
Confidence            9999999999999999998877665



>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04147 Nop14: Nop14-like family ; InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF04147 Nop14: Nop14-like family ; InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [] Back     alignment and domain information
>KOG4483 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>PF05285 SDA1: SDA1; InterPro: IPR007949 This domain consists of several SDA1 protein homologues Back     alignment and domain information
>KOG4019 consensus Calcineurin-mediated signaling pathway inhibitor DSCR1 [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query401
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 3e-13
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 7e-09
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-13
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 8e-09
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-11
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 5e-08
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-11
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-09
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 3e-11
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 3e-11
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 3e-11
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 4e-11
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 2e-08
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 4e-11
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-08
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 5e-11
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 6e-11
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 3e-10
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 6e-10
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 8e-10
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 8e-10
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 1e-09
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 3e-07
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 2e-09
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 4e-09
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 6e-09
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 5e-07
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 6e-09
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 7e-09
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 7e-09
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 8e-09
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 8e-09
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 8e-09
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 8e-09
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 9e-09
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-09
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-08
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-08
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 1e-08
2dis_A109 Solution Structure Of The Rrm Domain Of Unnamed Pro 2e-08
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 2e-08
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 2e-08
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 2e-08
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 2e-08
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 3e-08
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 3e-08
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 3e-08
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 6e-06
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 3e-08
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-08
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 3e-08
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 5e-08
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 4e-08
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 5e-08
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 3e-04
3nnh_A88 Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug 2e-07
3nnh_A88 Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug 2e-05
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 2e-07
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 4e-07
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 4e-07
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-07
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 2e-05
2cpd_A99 Solution Structure Of The Rna Recognition Motif Of 4e-07
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 4e-07
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 5e-07
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 2e-04
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 5e-07
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 6e-07
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 6e-07
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 7e-07
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 9e-07
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-06
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 1e-06
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 1e-06
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 1e-06
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 2e-06
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 2e-04
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 2e-06
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 2e-04
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 2e-06
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 3e-06
2cpj_A99 Solution Structure Of The N-Terminal Rna Recognitio 3e-06
3p5t_L90 Cfim25-Cfim68 Complex Length = 90 4e-06
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 4e-06
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 4e-06
3q2s_C229 Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Lengt 4e-06
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 5e-06
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 5e-06
3bs9_A87 X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 6e-06
2lxi_A91 Nmr Structure Of The N-Terminal Rna Binding Domain 8e-06
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 8e-06
2khc_A118 Bruno Rrm3+ Length = 118 9e-06
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 1e-05
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 1e-05
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 2e-05
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 2e-05
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 2e-05
2cph_A107 Solution Structure Of The C-Terminal Rna Recognitio 2e-05
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-05
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 3e-05
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 3e-05
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 3e-05
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 3e-05
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 3e-05
2dnh_A105 Solution Structure Of Rna Binding Domain In Bruno-L 4e-05
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 5e-05
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 7e-05
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 1e-04
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 1e-04
2jvo_A108 Segmental Isotope Labeling Of Npl3 Length = 108 1e-04
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 1e-04
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 2e-04
2osq_A74 Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length 2e-04
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 2e-04
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 2e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-04
2hyi_B91 Structure Of The Human Exon Junction Complex With A 2e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 2e-04
1wtb_A79 Complex Structure Of The C-Terminal Rna-Binding Dom 2e-04
2u2f_A85 Solution Structure Of The Second Rna-Binding Domain 2e-04
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 3e-04
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 3e-04
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 3e-04
2f3j_A177 The Solution Structure Of The Ref2-I Mrna Export Fa 4e-04
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-04
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 4e-04
1x5o_A114 Solution Structure Of Rrm Domain In Rna Binding Mot 4e-04
1iqt_A75 Solution Structure Of The C-Terminal Rna-Binding Do 4e-04
2la6_A99 Solution Nmr Structure Of Rrm Domain Of Rna-Binding 5e-04
2ghp_A292 Crystal Structure Of The N-Terminal 3 Rna Binding D 5e-04
2dk2_A97 Solution Structure Of Rrm Domain In Heterogeneous N 6e-04
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 7e-04
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-04
2lcw_A116 Solution Structure Of FusTLS RRM DOMAIN Length = 11 8e-04
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 8e-04
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 8e-04
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 51/169 (30%), Positives = 91/169 (53%), Gaps = 15/169 (8%) Query: 108 EVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESG--ESKGFAFVSFRSKEFAKKAI 165 ++F+G +P+ SE+DLR+L E G V+E+ +++D+ +SKG FV+F +++ A +A Sbjct: 17 KMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQ 76 Query: 166 DELHS-KELKGK----TIRCSLSETKN-----RLFIGNVPKNWTEDEFRKVIEDVGPGVE 215 + LH+ K L G ++ + SE N +LFIG + K TE++ R + G +E Sbjct: 77 NALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQ-IE 135 Query: 216 TIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTI 264 +++ P S RG +FV + A A + + M A ++P + Sbjct: 136 ECRILRGPDGLS--RGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMV 182
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2DIS|A Chain A, Solution Structure Of The Rrm Domain Of Unnamed Protein Product Length = 109 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 Back     alignment and structure
>pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2CPD|A Chain A, Solution Structure Of The Rna Recognition Motif Of Human Apobec-1 Complementation Factor, Acf Length = 99 Back     alignment and structure
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 Back     alignment and structure
>pdb|3P5T|L Chain L, Cfim25-Cfim68 Complex Length = 90 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|3Q2S|C Chain C, Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Length = 229 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|3BS9|A Chain A, X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 Back     alignment and structure
>pdb|2LXI|A Chain A, Nmr Structure Of The N-Terminal Rna Binding Domain 1 (Rrm1) Of The Protein Rbm10 From Homo Sapiens Length = 91 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2DNH|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 5 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2JVO|A Chain A, Segmental Isotope Labeling Of Npl3 Length = 108 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2OSQ|A Chain A, Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length = 74 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|1WTB|A Chain A, Complex Structure Of The C-Terminal Rna-Binding Domain Of Hnrnp D (Auf1) With Telomere Dna Length = 79 Back     alignment and structure
>pdb|2U2F|A Chain A, Solution Structure Of The Second Rna-Binding Domain Of Hu2af65 Length = 85 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2F3J|A Chain A, The Solution Structure Of The Ref2-I Mrna Export Factor (Residues 1-155) Length = 177 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|1X5O|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 1 Length = 114 Back     alignment and structure
>pdb|1IQT|A Chain A, Solution Structure Of The C-Terminal Rna-Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein D0 (Auf1) Length = 75 Back     alignment and structure
>pdb|2LA6|A Chain A, Solution Nmr Structure Of Rrm Domain Of Rna-Binding Protein Fus From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6430a Length = 99 Back     alignment and structure
>pdb|2GHP|A Chain A, Crystal Structure Of The N-Terminal 3 Rna Binding Domains Of The Yeast Splicing Factor Prp24 Length = 292 Back     alignment and structure
>pdb|2DK2|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleoprotein R (Hnrnp R) Length = 97 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2LCW|A Chain A, Solution Structure Of FusTLS RRM DOMAIN Length = 116 Back     alignment and structure
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query401
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-77
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-37
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-72
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-32
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-28
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-41
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-27
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-19
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-11
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-35
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-27
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-21
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-12
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-35
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-27
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-21
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-34
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-27
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-25
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-34
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-21
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-15
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-10
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-32
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-22
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-21
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-31
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-17
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-30
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-22
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-18
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-30
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-24
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 6e-10
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-30
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 5e-10
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-08
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-29
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-12
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 9e-29
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 6e-26
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-20
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-28
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-11
1x4e_A85 RNA binding motif, single-stranded interacting pro 4e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-28
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-08
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-28
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-11
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-26
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 6e-18
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 7e-06
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-26
3q2s_C229 Cleavage and polyadenylation specificity factor S; 6e-09
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-06
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-26
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-25
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 9e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-09
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-26
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-24
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-23
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-08
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-25
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 8e-11
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 7e-07
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-25
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-09
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-25
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-10
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-08
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-25
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-12
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-25
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-16
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-08
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-25
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 8e-05
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 7e-25
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-10
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-09
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-24
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-10
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-07
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-24
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-10
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 7e-08
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-24
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-11
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-24
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-09
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-05
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 4e-24
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-07
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-24
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-23
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-21
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-24
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-15
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-24
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-10
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-24
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 6e-24
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-10
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-05
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 6e-24
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-10
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-07
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 9e-24
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-12
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 5e-08
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-23
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 7e-13
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-07
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-23
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-08
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-23
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-13
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 6e-06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-23
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 4e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-23
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-08
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-23
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-10
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-06
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-23
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-06
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-23
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-11
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 5e-07
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-23
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-12
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 5e-23
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-06
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-23
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-12
2cph_A107 RNA binding motif protein 19; RNA recognition moti 6e-12
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-23
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-12
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-06
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-22
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-16
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-06
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-22
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-15
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-07
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-22
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-14
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-04
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-22
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-10
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-06
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-22
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-09
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-06
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-22
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-11
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-05
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-22
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-07
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-22
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-16
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-08
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-22
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-17
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-06
2kt5_A124 RNA and export factor-binding protein 2; chaperone 4e-22
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-15
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-05
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 7e-22
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-10
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 7e-08
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 8e-22
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-10
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 9e-05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 8e-22
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-15
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-22
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-14
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-21
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 7e-11
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 8e-07
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-21
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 4e-14
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 8e-07
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-21
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-12
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-21
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-14
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-07
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-21
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 9e-12
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-21
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-21
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-21
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-09
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 8e-21
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-13
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 4e-10
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-21
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-07
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-20
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 8e-14
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-20
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-14
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-20
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-09
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 4e-20
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 4e-20
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 7e-05
1x5p_A97 Negative elongation factor E; structure genomics, 4e-20
1x5p_A97 Negative elongation factor E; structure genomics, 1e-12
1x5p_A97 Negative elongation factor E; structure genomics, 3e-04
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-20
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-14
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-07
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 6e-20
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-07
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 6e-05
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 7e-20
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-08
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 8e-20
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 9e-20
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-05
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-19
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-12
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 7e-05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-19
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-10
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-19
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 4e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 6e-05
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-19
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-06
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-19
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 4e-06
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-19
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-14
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 5e-19
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-17
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-19
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-12
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-05
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-18
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-09
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-05
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-18
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 5e-06
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-18
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 6e-11
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-07
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-18
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-05
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-18
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-13
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-07
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-18
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-18
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-05
2div_A99 TRNA selenocysteine associated protein; structural 4e-18
2div_A99 TRNA selenocysteine associated protein; structural 2e-09
2div_A99 TRNA selenocysteine associated protein; structural 7e-04
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-18
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-14
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-18
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 8e-11
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 2e-05
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-18
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-09
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-18
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 5e-18
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 6e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 8e-18
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-05
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 9e-18
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-11
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 9e-18
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-16
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-17
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 9e-11
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-17
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-11
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-06
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 4e-17
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-08
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 8e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-17
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-06
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-17
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 5e-17
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-12
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-05
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 8e-17
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 5e-04
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-16
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-11
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-16
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-16
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 4e-08
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 5e-04
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-16
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 8e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 6e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-16
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-12
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-16
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-09
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-16
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-09
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-04
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-16
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 8e-16
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-11
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 9e-16
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-12
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-15
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 6e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-15
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-13
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-15
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-08
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-15
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-15
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 3e-15
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 7e-15
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-13
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 7e-15
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 9e-15
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 9e-15
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 9e-15
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-15
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-12
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-14
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-12
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-04
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-14
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-09
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-14
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-14
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-04
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-14
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-12
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-14
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-13
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 5e-14
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 7e-14
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 3e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-14
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-11
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-13
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-13
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-11
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-13
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-12
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-12
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-05
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-11
2krb_A81 Eukaryotic translation initiation factor 3 subunit 6e-07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 5e-11
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-07
2dnl_A114 Cytoplasmic polyadenylation element binding protei 9e-11
2dnl_A114 Cytoplasmic polyadenylation element binding protei 5e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-10
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 5e-10
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 1e-09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-09
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 4e-06
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 8e-09
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 5e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-07
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-07
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 3e-04
2dit_A112 HIV TAT specific factor 1 variant; structural geno 1e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 1e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 7e-05
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 2e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-04
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
 Score =  240 bits (614), Expect = 2e-77
 Identities = 55/287 (19%), Positives = 108/287 (37%), Gaps = 16/287 (5%)

Query: 89  GEDEKDKHAQLLALPPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESK 148
            E+ + +         N  ++ I GLP D + +++ DL            +K     + K
Sbjct: 5   PEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYE-------LKYCFVDKYK 57

Query: 149 GFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSETKNRLFIGNVPKNWTEDEFRKVIE 208
           G AFV+  + E A+ AI+  H   L+ + +   L  T   L + N+P + T+ +F +++ 
Sbjct: 58  GTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPTDALLCVANLPPSLTQQQFEELVR 117

Query: 209 DVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTISWAD 268
             G  +E   L+   +   +++G+ F  Y     A  ++  +L     L   T  + W D
Sbjct: 118 PFGS-LERCFLVYSERT-GQSKGYGFAEYMKKDSAARAKSDLL--GKPLGPRTLYVHWTD 173

Query: 269 PKSTPDHSAAASQVKALYVKNIPDN-TSTEKIKELFQRHGEVTKVVMPPGKSGK-RDFGF 326
                    A    + L V  +P      + +          T   +  G+ G+ + F  
Sbjct: 174 AGQLTP---ALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAV 230

Query: 327 IHYAERSSALKAVKDTEKYEIDGQVLEVVLAKPQTDKKTEGTFPYSP 373
           + Y     A +A +  +   + G  L V    P    ++      + 
Sbjct: 231 LEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAA 277


>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query401
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.94
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.93
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.89
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.86
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.86
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.85
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.83
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.83
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.81
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.81
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.81
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.8
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.8
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.8
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.8
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.8
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.8
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.79
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.79
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.79
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.79
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.79
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.79
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.79
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.79
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.78
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.78
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.78
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.78
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.78
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.78
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.78
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.78
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.78
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.78
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.78
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.77
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.77
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.77
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.77
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.77
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.77
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.77
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.77
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.77
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.77
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.77
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.77
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.77
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.77
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.77
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.77
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.77
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.77
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.77
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.77
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.77
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.77
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.77
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.77
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.77
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.77
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.76
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.76
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.76
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.76
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.76
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.76
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.76
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.76
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.76
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.76
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.76
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.76
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.76
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.76
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.76
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.76
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.76
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.76
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.76
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.76
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.76
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.75
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.75
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.75
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.75
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.75
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.75
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.75
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.75
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.75
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.75
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.75
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.75
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.75
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.75
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.75
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.75
2div_A99 TRNA selenocysteine associated protein; structural 99.75
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.75
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.75
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.74
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.74
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.74
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.74
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.74
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.74
2div_A99 TRNA selenocysteine associated protein; structural 99.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.74
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.74
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.74
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.74
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.74
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.74
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.74
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.74
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.74
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.74
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.74
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.74
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.73
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.73
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.73
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.73
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.73
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.73
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.73
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.73
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.73
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.73
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.73
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.73
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.73
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.73
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.73
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.73
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.73
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.73
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.73
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.73
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.73
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.73
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.72
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.72
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.72
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.72
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.72
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.72
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.72
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.72
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.72
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.72
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.72
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.72
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.72
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.72
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.72
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.72
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.72
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.72
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.72
2dis_A109 Unnamed protein product; structural genomics, RRM 99.72
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.72
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.72
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.72
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.71
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.71
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.71
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.71
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.71
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.71
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.71
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.71
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.71
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.71
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.71
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.71
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.71
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.71
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.71
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.71
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.71
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.71
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.71
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.7
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.7
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.7
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.7
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.7
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.7
2dis_A109 Unnamed protein product; structural genomics, RRM 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.7
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.7
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.7
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.7
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.7
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.7
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.7
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.7
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.7
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.7
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.7
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.7
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.7
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.69
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.69
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.69
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.69
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.69
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.69
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.69
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.69
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.69
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.69
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.69
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.69
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.69
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.69
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.52
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.69
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.69
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.69
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.68
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.68
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.68
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.68
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.68
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.68
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.68
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.68
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.68
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.67
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.67
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.67
1x5p_A97 Negative elongation factor E; structure genomics, 99.67
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.67
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.67
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.67
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.67
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.67
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.67
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.67
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.66
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.66
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.66
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.66
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.66
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.65
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.65
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.65
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.65
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.65
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.46
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.65
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.65
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.65
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.65
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.64
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.64
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.64
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.64
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.64
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.63
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.63
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.63
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.63
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.63
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.63
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.63
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.63
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.62
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.62
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.62
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.62
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.62
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.62
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.61
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.61
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.61
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.61
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.61
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.6
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.6
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.6
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.6
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.6
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.59
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.59
1x5p_A97 Negative elongation factor E; structure genomics, 99.59
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.59
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.58
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.58
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.58
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.58
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.58
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.58
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.57
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.57
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.57
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.56
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.56
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.54
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.54
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.53
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.53
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.53
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.53
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.52
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.52
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.52
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.5
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.49
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.49
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.49
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.48
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.47
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.46
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.45
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.44
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.4
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.4
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.32
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.3
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.29
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.23
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.19
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.18
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.08
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.07
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.04
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.94
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.89
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.84
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.74
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.55
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.14
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.13
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.03
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.82
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.69
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.68
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.63
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.29
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.08
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.04
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.0
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.95
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.92
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.81
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.76
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.99
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.63
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.39
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 85.59
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 84.91
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=2.2e-44  Score=329.06  Aligned_cols=245  Identities=22%  Similarity=0.405  Sum_probs=225.3

Q ss_pred             CCCCeEEEcCCCCCCCHHHHHHhhcccCCeeEEEEeeCCCCCCceeEEEEEecCHHHHHHHHHHhcCCccCCeEEEEEec
Q 015763          104 PNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLS  183 (401)
Q Consensus       104 ~~~~~v~v~nlp~~~t~~~l~~~f~~~g~i~~~~~~~~~~~g~~~g~a~V~f~~~~~a~~a~~~l~~~~~~g~~l~v~~~  183 (401)
                      ...++|||+|||+++|+++|+++|++|| |..+.+      ++++|||||+|.+.++|.+|+..|++..+.|+.|.|.++
T Consensus        20 ~~~~~l~V~nLp~~~te~~l~~~F~~~G-i~~~~~------~~~~g~afV~f~~~~~A~~A~~~l~~~~~~g~~i~v~~~   92 (284)
T 3smz_A           20 RNRRKILIRGLPGDVTNQEVHDLLSDYE-LKYCFV------DKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQ   92 (284)
T ss_dssp             HCCCEEEEECCCTTCCHHHHHHHTTTSC-EEEEEE------ETTTTEEEEEESSHHHHHHHHHHHTTCEETTEECEEEEC
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHHcC-CEEEEE------ecCCCEEEEEeCCHHHHHHHHHHcCCCeeCCeEEEEEec
Confidence            4678999999999999999999999999 998888      566899999999999999999999999999999999999


Q ss_pred             ccccccccCCCCCCCCHHHHHHHHHhhCCceeEEEEeeCCCCCCCCccEEEEEeCCHHHHHHHHHHHhcCCcccCCCCCe
Q 015763          184 ETKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPT  263 (401)
Q Consensus       184 ~~~~~l~v~~l~~~~~~~~l~~~f~~~g~~v~~~~~~~~~~~~~~~~g~~~v~f~~~~~a~~a~~~l~~~~~~~~~~~~~  263 (401)
                      .+.++|||+|||..+++++|+++|..||. |..+.++.+ ..++.++|||||.|.+.+.|..|+..+++.  .+.++.+.
T Consensus        93 ~~~~~l~v~nlp~~~t~~~l~~~f~~~G~-i~~~~i~~~-~~~g~~~g~afV~f~~~~~a~~A~~~l~~~--~~~g~~i~  168 (284)
T 3smz_A           93 PTDALLCVANLPPSLTQQQFEELVRPFGS-LERCFLVYS-ERTGQSKGYGFAEYMKKDSAARAKSDLLGK--PLGPRTLY  168 (284)
T ss_dssp             CCSCEEEEESCCTTCCHHHHHHHHGGGSC-EEEEEEEEC-TTTCCEEEEEEEEESSHHHHHHHHHHHTTC--EETTEECE
T ss_pred             CCCCEEEEcCCCCcCCHHHHHHHHHhcCC-eeEEEEEee-CCCCccceEEEEEECCHHHHHHHHHHhCCC--EeCCcEEE
Confidence            99999999999999999999999999998 999999887 456889999999999999999999999764  66899999


Q ss_pred             eeecCCCCCCCCcccccccceEEEccCCCCC-CHHHHHHHHhhcCCeeEEEecCCCCCC-CCeEEEEeCCHHHHHHHHHh
Q 015763          264 ISWADPKSTPDHSAAASQVKALYVKNIPDNT-STEKIKELFQRHGEVTKVVMPPGKSGK-RDFGFIHYAERSSALKAVKD  341 (401)
Q Consensus       264 v~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~-t~e~l~~~f~~~G~i~~v~i~~~~~~~-kg~afV~f~~~~~A~~A~~~  341 (401)
                      +.++.+.....   .....++|||+|||..+ ++++|+++|++||.|..|.|..+..+. +|||||+|.+.++|.+|+..
T Consensus       169 v~~a~~~~~~~---~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~~v~i~~~~~g~~~g~afV~f~~~~~A~~A~~~  245 (284)
T 3smz_A          169 VHWTDAGQLTP---ALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQQQ  245 (284)
T ss_dssp             EEECCGGGCCT---TTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCSEEEEEECSSCCEEEEEEEECSSHHHHHHHHHH
T ss_pred             EEECCCCCCCc---ccCCccEEEEecCCcccCCHHHHHHHhhCCCCeEEEEEEECCCCCcccEEEEEeCCHHHHHHHHHH
Confidence            99998765432   22567899999999995 999999999999999999999988776 99999999999999999999


Q ss_pred             hcCCeeCCeEEEEEeccCCCc
Q 015763          342 TEKYEIDGQVLEVVLAKPQTD  362 (401)
Q Consensus       342 l~g~~i~g~~l~v~~a~~~~~  362 (401)
                      |||..|+|++|+|.|+.++..
T Consensus       246 l~g~~~~g~~l~v~~a~~~~~  266 (284)
T 3smz_A          246 ADGLSLGGSHLRVSFCAPGPP  266 (284)
T ss_dssp             HTTCEETTEECEEEECCSSSC
T ss_pred             hCCCccCCeEEEEEEecCCCc
Confidence            999999999999999988754



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 401
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-19
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-08
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-05
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 6e-19
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 9e-12
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-07
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-18
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-18
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-08
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-17
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-14
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-17
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-14
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-16
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 6e-08
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-16
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-16
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-16
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 9e-06
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-16
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-08
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-15
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 6e-08
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-15
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 8e-11
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-07
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-15
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-15
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-06
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-15
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-07
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-15
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-08
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-08
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-15
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-07
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-15
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-08
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 4e-15
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 1e-07
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 7e-15
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-07
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 8e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-14
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 8e-10
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-04
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-14
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-14
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-04
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-14
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-14
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 8e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-14
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-14
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-07
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-14
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-09
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 3e-06
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-14
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 5e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 0.001
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 5e-14
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 7e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 9e-14
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-13
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 0.001
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-13
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-13
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-05
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-13
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-13
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 8e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-13
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-12
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-06
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-13
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-04
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-13
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 5e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-13
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-13
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-13
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-13
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-13
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-13
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-04
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 6e-13
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 7e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 7e-13
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 9e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-12
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-06
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 0.004
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 7e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-12
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 4e-04
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 5e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-04
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-12
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-06
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 6e-12
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-11
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 3e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-11
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 7e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 9e-05
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-11
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 2e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-11
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 1e-04
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-11
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-10
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-10
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 9e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-10
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-08
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-04
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 5e-10
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 6e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 6e-04
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 9e-10
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-09
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 6e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-09
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-07
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.001
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-09
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-09
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-06
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 0.002
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-09
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-06
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-09
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-09
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-08
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-08
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 5e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1e-08
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 2e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 1e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-08
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.002
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 7e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 3e-07
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 2e-07
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-07
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 9e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 4e-07
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 6e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 6e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.002
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-06
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.002
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 6e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.001
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 1e-05
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein 12
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 80.1 bits (197), Expect = 2e-19
 Identities = 16/80 (20%), Positives = 36/80 (45%)

Query: 103 PPNGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAK 162
            P  + + +  +P   S +++ D       +     +K  E G   G A V+F S++ A 
Sbjct: 6   KPGPTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEAT 65

Query: 163 KAIDELHSKELKGKTIRCSL 182
            A+ +L+ + +  + ++  L
Sbjct: 66  AAVIDLNDRPIGSRKVKLVL 85


>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query401
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.84
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.84
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.84
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.84
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.84
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.83
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.83
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.83
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.83
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.83
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.83
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.82
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.82
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.82
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.82
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.82
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.82
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.82
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.81
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.81
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.81
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.81
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.81
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.8
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.8
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.8
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.8
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.8
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.79
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.79
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.79
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.79
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.78
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.78
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.78
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.78
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.78
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.78
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.78
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.77
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.77
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.77
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.76
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.76
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.76
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.76
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.76
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.76
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.75
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.75
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.75
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.75
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.75
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.75
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.75
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.75
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.75
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.74
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.74
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.74
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.74
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.74
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.74
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.74
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.74
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.74
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.73
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.73
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.73
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.73
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.73
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.72
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.72
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.72
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.72
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.72
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.72
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.71
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.71
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.71
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.71
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.71
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.71
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.71
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.71
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.7
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.7
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.7
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.7
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.69
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.69
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.69
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.69
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.69
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.67
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.67
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.66
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.66
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.65
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.65
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.65
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.64
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.62
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.61
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.57
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.57
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.56
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.52
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.51
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.5
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.5
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.47
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.45
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.42
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.41
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.41
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.4
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.4
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.27
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.41
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.01
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.86
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.73
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.64
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.4
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.29
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.22
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=5.7e-31  Score=222.07  Aligned_cols=173  Identities=22%  Similarity=0.430  Sum_probs=146.0

Q ss_pred             CCCeEEEcCCCCCCCHHHHHHhhcccCCeeEEEEeeCCCCCCceeEEEEEecCHHHHHHHHHHhcCCccCCeEEEEEecc
Q 015763          105 NGSEVFIGGLPKDASEEDLRDLCEPIGDVFEVRLMKDKESGESKGFAFVSFRSKEFAKKAIDELHSKELKGKTIRCSLSE  184 (401)
Q Consensus       105 ~~~~v~v~nlp~~~t~~~l~~~f~~~g~i~~~~~~~~~~~g~~~g~a~V~f~~~~~a~~a~~~l~~~~~~g~~l~v~~~~  184 (401)
                      ..|+|||+|||+.+|+++|+++|++||.|..+.++++..++.++|||||+|.+.++|.+|+. +++..+.++.+.+....
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~   83 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAV   83 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECC
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhh
Confidence            34789999999999999999999999999999999999999999999999999999999995 46666777777665543


Q ss_pred             cccccccCCCCCCCCHHHHHHHHHhhCCceeEEEEeeCCCCCCCCccEEEEEeCCHHHHHHHHHHHhcCCcccCCCCCee
Q 015763          185 TKNRLFIGNVPKNWTEDEFRKVIEDVGPGVETIELIKDPQNPSRNRGFSFVLYYNNACADYSRQKMLNANFKLDGNTPTI  264 (401)
Q Consensus       185 ~~~~l~v~~l~~~~~~~~l~~~f~~~g~~v~~~~~~~~~~~~~~~~g~~~v~f~~~~~a~~a~~~l~~~~~~~~~~~~~v  264 (401)
                      +.....                                                                          
T Consensus        84 ~~~~~~--------------------------------------------------------------------------   89 (183)
T d1u1qa_          84 SREDSQ--------------------------------------------------------------------------   89 (183)
T ss_dssp             CTTGGG--------------------------------------------------------------------------
T ss_pred             hccccc--------------------------------------------------------------------------
Confidence            221100                                                                          


Q ss_pred             eecCCCCCCCCcccccccceEEEccCCCCCCHHHHHHHHhhcCCeeEEEecCCCCCC--CCeEEEEeCCHHHHHHHHHhh
Q 015763          265 SWADPKSTPDHSAAASQVKALYVKNIPDNTSTEKIKELFQRHGEVTKVVMPPGKSGK--RDFGFIHYAERSSALKAVKDT  342 (401)
Q Consensus       265 ~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~t~e~l~~~f~~~G~i~~v~i~~~~~~~--kg~afV~f~~~~~A~~A~~~l  342 (401)
                                ........++|||+|||..+++++|+.+|+.||.|..|.|+.+..++  +|||||+|.+.++|.+|+. +
T Consensus        90 ----------~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~  158 (183)
T d1u1qa_          90 ----------RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-Q  158 (183)
T ss_dssp             ----------STTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-S
T ss_pred             ----------ccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-h
Confidence                      00001344789999999999999999999999999999999877644  8999999999999999997 7


Q ss_pred             cCCeeCCeEEEEEeccCCCcC
Q 015763          343 EKYEIDGQVLEVVLAKPQTDK  363 (401)
Q Consensus       343 ~g~~i~g~~l~v~~a~~~~~~  363 (401)
                      ++..|.|++|+|.+|.++..+
T Consensus       159 ~~~~~~G~~i~V~~A~~k~e~  179 (183)
T d1u1qa_         159 KYHTVNGHNCEVRKALSKQEM  179 (183)
T ss_dssp             SCEEETTEEEEEEECCCHHHH
T ss_pred             CCCeECCEEEEEEecCCcccc
Confidence            999999999999999876543



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure