Citrus Sinensis ID: 015772

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400
MELSIGPTSSVREDGDDDNRKPTQEDEDHHHHEDRQTETAAAAAARLVDSAEIRRCSTPTATAETANIIQQLDLLPNTPVVVPLPRNPTPSSILASFPAANWTSAGSSEAAGSGQMARDANKLPMAIPAPLDLLVPHHNDDEDPSSPEAEDGDGSHGAGALSSSSLNTTSSAQMDFCIHSSNHHHNDTSTTGTGGTNNIRKSCGDIFRASNDNNNEVVDGCSELEDENGCSTRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCPSCERVATTNINPPPLPTTTTTPPKATSNSTGSSPLSSRPMFVPFSHHKPTTTDGQI
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccc
melsigptssvredgdddnrkptqededhhhhedrQTETAAAAAARLVDSaeirrcstptataeTANIIQqldllpntpvvvplprnptpssilasfpaanwtsagsseaagsgqmardanklpmaipapldllvphhnddedpsspeaedgdgshgagalsssslnttssaqmdfcihssnhhhndtsttgtggtnnirksCGDIfrasndnnnevvdgcseledengcstrKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKstagnnpfymqlpattltmcpscervattninppplptttttppkatsnstgssplssrpmfvpfshhkptttdgqi
melsigptssvredgdddnrKPTQededhhhhedrqtETAAAAAARLVDSAEIRRCSTPTATAETANIIQQLDLLPNTPVVVPLPRNPTPSSILASFPAANWTSAGSSEAAGSGQMARDANKLPMAIPAPLDLLVPHHNDDEDPSSPEAEDGDGSHGAGALSSSSLNTTSSAQMDFCIHSSNHHHndtsttgtggtnnIRKSCGDIFRASNDNNNEVVDGCSELEDENGCSTRKKLRLSKQQSAFLEESfkehttltpkQKLALakqlnlrprqvevwfqnrrartklkqtevdceYLKRCCETLTEENRRLQKELQELRALkstagnnpfYMQLPATTLTMCPSCERVAttninppplptttttppkatsnstgssplssrpmfvpfshhkptttdgqi
MELSIGPTSSVREDGDDDNRKPTQededhhhhedRQTETaaaaaaRLVDSAEIRRCSTPTATAETANIIQQLDllpntpvvvplprnptpSSILASFPAANWTsagsseaagsgQMARDANKLPMAIPAPLDLLVPHHNddedpsspeaedgdgshgagalsssslnttssAQMDFCIhssnhhhndtsttgtggtnnIRKSCGDIFRASNDNNNEVVDGCSELEDENGCSTRKKLRLSKQQSAFLEESFKEHTTLTPkqklalakqlNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCPSCERVAttninppplptttttppkatsnstgssplssRPMFVPFSHHKPTTTDGQI
************************************************************ATAETANIIQQLDLLPNTPVVVPL*********************************************************************************************************************************************************************************LALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTE******************AGNNPFYMQLPATTLTMCPSCERVA**************************************************
**************************************************************************L********************************************************************************************************************************************************************KQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRA*************LKRCCETL***********************************************************************************************
********************************************ARLVDSAEIRRCSTPTATAETANIIQQLDLLPNTPVVVPLPRNPTPSSILASFPAAN****************RDANKLPMAIPAPLDLLVPHHN******************************SSAQMDFCIHSSNHHHNDTSTTGTGGTNNIRKSCGDIFRASNDNNNEVVDGCS***************LSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCPSCERVATTNINPPPLPT*******************SRPMFVPFSHH*********
****************************************************************TANIIQQLDLLPNTPVVVPLPRNPTPSSILASFPAANW********************LPMAIPAPLD******************************************************************************************************KLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCPSCER****************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELSIGPTSSVREDGDDDNRKPTQEDEDHHHHEDRQTETAAAAAARLVDSAEIRRCSTPTATAETANIIQQLDLLPNTPVVVPLPRNPTPSSILASFPAANWTSAGSSEAAGSGQMARDANKLPMAIPAPLDLLVPHHNDDEDPSSPEAEDGDGSHGAGALSSSSLNTTSSAQMDFCIHSSNHHHNDTSTTGTGGTNNIRKSCGDIFRASNDNNNEVVDGCSELEDENGCSTRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFYMQLPATTLTMCPSCERVATTNINPPPLPTTTTTPPKATSNSTGSSPLSSRPMFVPFSHHKPTTTDGQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query400 2.2.26 [Sep-21-2011]
P46665336 Homeobox-leucine zipper p yes no 0.425 0.505 0.657 1e-61
A2YW03354 Homeobox-leucine zipper p N/A no 0.562 0.635 0.542 2e-59
Q6YPD0354 Homeobox-leucine zipper p yes no 0.562 0.635 0.539 8e-59
Q67UE2362 Homeobox-leucine zipper p yes no 0.315 0.348 0.853 1e-58
A2Z1U1276 Homeobox-leucine zipper p N/A no 0.315 0.456 0.853 4e-58
Q8GRL4292 Homeobox-leucine zipper p no no 0.38 0.520 0.630 5e-53
A2XE76292 Homeobox-leucine zipper p N/A no 0.38 0.520 0.630 5e-53
P46604278 Homeobox-leucine zipper p no no 0.305 0.438 0.776 2e-52
P46603274 Homeobox-leucine zipper p no no 0.407 0.594 0.621 3e-52
Q05466284 Homeobox-leucine zipper p no no 0.335 0.471 0.704 2e-49
>sp|P46665|HAT14_ARATH Homeobox-leucine zipper protein HAT14 OS=Arabidopsis thaliana GN=HAT14 PE=2 SV=3 Back     alignment and function desciption
 Score =  237 bits (605), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 125/190 (65%), Positives = 144/190 (75%), Gaps = 20/190 (10%)

Query: 167 NTTSSAQMDFCIHSSNHHHNDTSTTGTGGTNNIRKSCGDIFRASNDNNNEVVDGCSELED 226
           + TSS Q+DF I S  +      +      + + +S     RASN++N+          D
Sbjct: 140 SVTSSFQLDFGIKSYGYERR---SNKRDIDDEVERSAS---RASNEDND----------D 183

Query: 227 ENGCSTRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRART 286
           ENG STRKKLRLSK QSAFLE+SFKEH+TL PKQK+ALAKQLNLRPRQVEVWFQNRRART
Sbjct: 184 ENG-STRKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRART 242

Query: 287 KLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCPSC 346
           KLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK++    PFYMQLPATTLTMCPSC
Sbjct: 243 KLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTST---PFYMQLPATTLTMCPSC 299

Query: 347 ERVATTNINP 356
           ERVAT+   P
Sbjct: 300 ERVATSAAQP 309
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|A2YW03|HOX27_ORYSI Homeobox-leucine zipper protein HOX27 OS=Oryza sativa subsp. indica GN=HOX27 PE=2 SV=2 Back     alignment and function description
>sp|Q6YPD0|HOX27_ORYSJ Homeobox-leucine zipper protein HOX27 OS=Oryza sativa subsp. japonica GN=HOX27 PE=2 SV=1 Back     alignment and function description
>sp|Q67UE2|HOX11_ORYSJ Homeobox-leucine zipper protein HOX11 OS=Oryza sativa subsp. japonica GN=HOX11 PE=2 SV=1 Back     alignment and function description
>sp|A2Z1U1|HOX11_ORYSI Homeobox-leucine zipper protein HOX11 OS=Oryza sativa subsp. indica GN=HOX11 PE=2 SV=1 Back     alignment and function description
>sp|Q8GRL4|HOX19_ORYSJ Homeobox-leucine zipper protein HOX19 OS=Oryza sativa subsp. japonica GN=HOX19 PE=2 SV=1 Back     alignment and function description
>sp|A2XE76|HOX19_ORYSI Homeobox-leucine zipper protein HOX19 OS=Oryza sativa subsp. indica GN=HOX19 PE=2 SV=1 Back     alignment and function description
>sp|P46604|HAT22_ARATH Homeobox-leucine zipper protein HAT22 OS=Arabidopsis thaliana GN=HAT22 PE=1 SV=1 Back     alignment and function description
>sp|P46603|HAT9_ARATH Homeobox-leucine zipper protein HAT9 OS=Arabidopsis thaliana GN=HAT9 PE=2 SV=2 Back     alignment and function description
>sp|Q05466|HAT4_ARATH Homeobox-leucine zipper protein HAT4 OS=Arabidopsis thaliana GN=HAT4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query400
255542221378 homeobox protein, putative [Ricinus comm 0.63 0.666 0.521 8e-68
118487078374 unknown [Populus trichocarpa] 0.762 0.815 0.468 1e-67
356530687327 PREDICTED: homeobox-leucine zipper prote 0.55 0.672 0.564 9e-66
225450315358 PREDICTED: homeobox-leucine zipper prote 0.647 0.723 0.548 1e-65
356498410329 PREDICTED: homeobox-leucine zipper prote 0.545 0.662 0.560 2e-64
297741218357 unnamed protein product [Vitis vinifera] 0.545 0.610 0.578 2e-64
224106608208 predicted protein [Populus trichocarpa] 0.48 0.923 0.645 1e-62
255588212368 Homeobox-leucine zipper protein HAT14, p 0.557 0.605 0.546 2e-62
356570520292 PREDICTED: homeobox-leucine zipper prote 0.495 0.678 0.562 2e-62
225441481331 PREDICTED: homeobox-leucine zipper prote 0.565 0.682 0.564 4e-62
>gi|255542221|ref|XP_002512174.1| homeobox protein, putative [Ricinus communis] gi|223548718|gb|EEF50208.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  263 bits (673), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 202/345 (58%), Gaps = 93/345 (26%)

Query: 69  IQQLDLLPNTPVVVPLPRNPTPSSILASFPAANWTSA--GSSEAAGSGQMARDANKLPMA 126
           I QLDLLPNTPVVVP   +           A  W S+  GS +A G      D N+LP  
Sbjct: 110 IIQLDLLPNTPVVVPRHHHH----------ALLWPSSDNGSYDAKG-----LDVNRLPAV 154

Query: 127 IPAPLDLLVPHHNDDEDPSSPEAEDGDGSHGAGALSSSSLNTT-SSAQMDFCIHS--SNH 183
                                EAEDG       ALSSS+ N+  SS QMDFCI+    NH
Sbjct: 155 --------------------EEAEDG------AALSSSTPNSAASSFQMDFCIYGKGGNH 188

Query: 184 HHNDTSTTGTGGTNNIRKSCGDIFRASNDNNNEVVDGCSELEDENGCSTRKKLRLSKQQS 243
           H  + +++                RAS+             EDENG S RKKLRLSK+QS
Sbjct: 189 HEGERASS----------------RASD-------------EDENG-SARKKLRLSKEQS 218

Query: 244 AFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCE 303
           AFLEESFKEH TL PKQKLALAKQL+LRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCE
Sbjct: 219 AFLEESFKEHNTLNPKQKLALAKQLSLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCE 278

Query: 304 TLTEENRRLQKELQELRALKSTAGNNPFYMQLPATTLTMCPSCERV-------ATTNINP 356
           TLTEENRRL KELQELRAL S+   NPFYMQ+PATTLTMCPSCERV       ATT    
Sbjct: 279 TLTEENRRLHKELQELRALTSS---NPFYMQVPATTLTMCPSCERVATTSTATATTTTTT 335

Query: 357 PPLPTTTTTPPKATSNSTGSSPLSSRPMFVPFSH-----HKPTTT 396
                  +T P A+S  TG S LS++    PF H     H+PT +
Sbjct: 336 TTTKNNISTEP-ASSKGTGLS-LSTKTRLYPFVHTQTHSHQPTAS 378

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118487078|gb|ABK95369.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356530687|ref|XP_003533912.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Glycine max] Back     alignment and taxonomy information
>gi|225450315|ref|XP_002268178.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356498410|ref|XP_003518045.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Glycine max] Back     alignment and taxonomy information
>gi|297741218|emb|CBI32169.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106608|ref|XP_002314223.1| predicted protein [Populus trichocarpa] gi|222850631|gb|EEE88178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255588212|ref|XP_002534537.1| Homeobox-leucine zipper protein HAT14, putative [Ricinus communis] gi|223525092|gb|EEF27847.1| Homeobox-leucine zipper protein HAT14, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356570520|ref|XP_003553433.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Glycine max] Back     alignment and taxonomy information
>gi|225441481|ref|XP_002275747.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query400
TAIR|locus:2170194336 HAT14 "homeobox from Arabidops 0.322 0.383 0.734 8.5e-49
TAIR|locus:2137599278 HAT22 [Arabidopsis thaliana (t 0.357 0.514 0.631 9.1e-45
TAIR|locus:2059143274 HAT9 [Arabidopsis thaliana (ta 0.305 0.445 0.712 3.9e-44
TAIR|locus:2129136284 HB-2 "homeobox protein 2" [Ara 0.367 0.517 0.594 7.5e-41
TAIR|locus:2055028318 HB4 "homeobox-leucine zipper p 0.32 0.402 0.676 1.6e-40
TAIR|locus:2103396315 HAT3 "homeobox-leucine zipper 0.32 0.406 0.674 1.6e-40
TAIR|locus:2171489283 HAT2 [Arabidopsis thaliana (ta 0.342 0.484 0.625 2.6e-40
TAIR|locus:2129061282 HAT1 [Arabidopsis thaliana (ta 0.357 0.507 0.606 2.6e-38
TAIR|locus:2049614275 HB17 "homeobox-leucine zipper 0.315 0.458 0.533 7.9e-30
TAIR|locus:2013980206 HB18 "homeobox-leucine zipper 0.287 0.558 0.547 1.7e-27
TAIR|locus:2170194 HAT14 "homeobox from Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 509 (184.2 bits), Expect = 8.5e-49, P = 8.5e-49
 Identities = 105/143 (73%), Positives = 115/143 (80%)

Query:   208 RASNDNNNEVVDGCSELEDENGCSTRKKLRLSKQQSAFLEESFKEHTTLTPXXXXXXXXX 267
             RASN++N          +DENG STRKKLRLSK QSAFLE+SFKEH+TL P         
Sbjct:   175 RASNEDN----------DDENG-STRKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQ 223

Query:   268 XNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAG 327
              NLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCE+LTEENRRLQKE++ELR LK++  
Sbjct:   224 LNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTST- 282

Query:   328 NNPFYMQLPATTLTMCPSCERVA 350
               PFYMQLPATTLTMCPSCERVA
Sbjct:   283 --PFYMQLPATTLTMCPSCERVA 303
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
TAIR|locus:2137599 HAT22 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059143 HAT9 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129136 HB-2 "homeobox protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055028 HB4 "homeobox-leucine zipper protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103396 HAT3 "homeobox-leucine zipper protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171489 HAT2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129061 HAT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049614 HB17 "homeobox-leucine zipper protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013980 HB18 "homeobox-leucine zipper protein 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
smart0034044 smart00340, HALZ, homeobox associated leucin zippe 4e-22
smart0038957 smart00389, HOX, Homeodomain 1e-16
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-16
pfam0218345 pfam02183, HALZ, Homeobox associated leucine zippe 5e-16
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-10
smart0033865 smart00338, BRLZ, basic region leucin zipper 0.003
>gnl|CDD|128634 smart00340, HALZ, homeobox associated leucin zipper Back     alignment and domain information 
 Score = 87.9 bits (218), Expect = 4e-22
 Identities = 36/47 (76%), Positives = 39/47 (82%), Gaps = 3/47 (6%)

Query: 289 KQTEVDCEYLKRCCETLTEENRRLQKELQELRALKSTAGNNPFYMQL 335
           KQTEVDCE LKRCCE+LTEENRRLQKE+QELRALK +    P YMQ 
Sbjct: 1   KQTEVDCELLKRCCESLTEENRRLQKEVQELRALKLSP---PLYMQH 44

Length = 44
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|202143 pfam02183, HALZ, Homeobox associated leucine zipper Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 400
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.88
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.73
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.72
KOG0489261 consensus Transcription factor zerknullt and relat 99.7
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.68
KOG0488309 consensus Transcription factor BarH and related HO 99.67
KOG0493342 consensus Transcription factor Engrailed, contains 99.66
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.65
KOG0494332 consensus Transcription factor CHX10 and related H 99.64
KOG0843197 consensus Transcription factor EMX1 and related HO 99.63
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.62
KOG0850245 consensus Transcription factor DLX and related pro 99.59
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.57
KOG0848317 consensus Transcription factor Caudal, contains HO 99.56
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.53
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.44
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.43
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.43
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.41
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.39
COG5576156 Homeodomain-containing transcription factor [Trans 99.37
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.35
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.34
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.33
KOG0847288 consensus Transcription factor, contains HOX domai 99.24
KOG0490235 consensus Transcription factor, contains HOX domai 99.2
PF04618111 HD-ZIP_N: HD-ZIP protein N terminus; InterPro: IPR 99.1
KOG0849354 consensus Transcription factor PRD and related pro 98.95
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.86
KOG0775304 consensus Transcription factor SIX and related HOX 98.68
KOG0774334 consensus Transcription factor PBX and related HOX 98.61
smart0034044 HALZ homeobox associated leucin zipper. 98.56
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.03
KOG0490235 consensus Transcription factor, contains HOX domai 97.93
KOG2252558 consensus CCAAT displacement protein and related h 97.89
KOG1146 1406 consensus Homeobox protein [General function predi 97.36
KOG0773342 consensus Transcription factor MEIS1 and related H 96.4
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.56
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 92.6
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 92.24
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 91.82
PRK09413121 IS2 repressor TnpA; Reviewed 82.02
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information 
Probab=99.88  E-value=3.8e-23  Score=193.13  Aligned_cols=119  Identities=53%  Similarity=0.689  Sum_probs=109.1

Q ss_pred             CCCCCCccCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCccceeecccchhhhhhhhhhhhhHHHHHHhhhhhHHHH
Q 015772          230 CSTRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEEN  309 (400)
Q Consensus       230 ~~rRkRtrfT~~Ql~~LE~~F~~~~yPs~~~R~eLA~~LgLserQVqvWFQNRRaK~Krkq~~~~~e~l~~~~e~L~~En  309 (400)
                      ...+++.||+.+|+..||+.|+.+.|+.+.+|..||++|||.++||+|||||||||||.++++.++++|+++++.|..++
T Consensus        49 ~~~~kk~Rlt~eQ~~~LE~~F~~~~~L~p~~K~~LAk~LgL~pRQVavWFQNRRARwK~kqlE~d~~~Lk~~~~~l~~~~  128 (198)
T KOG0483|consen   49 KGKGKKRRLTSEQVKFLEKSFESEKKLEPERKKKLAKELGLQPRQVAVWFQNRRARWKTKQLEKDYESLKRQLESLRSEN  128 (198)
T ss_pred             ccccccccccHHHHHHhHHhhccccccChHHHHHHHHhhCCChhHHHHHHhhccccccchhhhhhHHHHHHHHHHHhhhh
Confidence            34566778999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhcCCCCCccCC-CCCCCcCCCCCCCCCC
Q 015772          310 RRLQKELQELRALKSTAGNNPFYMQL-PATTLTMCPSCERVAT  351 (400)
Q Consensus       310 ~~l~~e~~~l~al~~a~~~~p~~~~l-p~~~~~~c~sc~~~~~  351 (400)
                      ++|++++.+|++++.   ....+++. +..++.+|+.|+....
T Consensus       129 ~~Lq~e~~eL~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~  168 (198)
T KOG0483|consen  129 DRLQSEVQELVAELS---SLKREMQKSPENTLTMCPNSESSSS  168 (198)
T ss_pred             hHHHHHHHHHHHHHh---hhhhhhccCcccccccCccccccCC
Confidence            999999999998877   55667777 7788899999995543

>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>PF04618 HD-ZIP_N: HD-ZIP protein N terminus; InterPro: IPR006712 Homeodomain leucine zipper (HDZip) genes encode putative transcription factors that are unique to plants Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-28
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-14
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 9e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-12
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-12
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-12
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 7e-12
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 8e-12
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-11
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-11
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-11
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 5e-11
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-11
3a01_A93 Homeodomain-containing protein; homeodomain, prote 8e-11
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-10
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-10
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-10
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-10
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-10
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-09
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-09
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-09
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-09
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 3e-09
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 3e-09
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 4e-09
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 4e-09
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-09
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 7e-09
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 8e-09
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-08
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-08
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-08
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-08
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 6e-08
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 7e-08
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-07
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 2e-07
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 6e-07
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 8e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-06
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-06
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 4e-05
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 6e-05
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 8e-05
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 9e-05
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-04
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 1e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 2e-04
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-04
3a02_A60 Homeobox protein aristaless; homeodomain, developm 3e-04
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 3e-04
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-04
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 7e-04
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
 Score =  105 bits (264), Expect = 1e-28
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 231 STRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTK 287
           S + K  +S Q  AFLEE F+   +L  K+K  +AK+  + P QV VWF N+R R+K
Sbjct: 5   SPKGKSSISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 61
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query400
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.77
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.76
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.76
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.75
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.75
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.75
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.74
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.74
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.74
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.74
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.73
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.73
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.73
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.73
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.73
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.73
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.72
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.72
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.72
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.72
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.72
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.72
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.72
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.72
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.71
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.71
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.71
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.71
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.71
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.71
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.71
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.71
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.7
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.7
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.7
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.7
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.7
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.69
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.69
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.69
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.69
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.69
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.68
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.68
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.68
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.68
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.67
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.67
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.66
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.66
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.65
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.65
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.64
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.64
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.63
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.63
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.63
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.63
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.62
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.62
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.62
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.61
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.61
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.6
2e19_A64 Transcription factor 8; homeobox domain, structura 99.6
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.6
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.59
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.58
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.57
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.55
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.54
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.41
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.32
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.27
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.27
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.22
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.72
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 92.33
3oka_C21 N-terminal His-affinity TAG; GT-B fold, alpha-mann 81.32
1ydx_A406 Type I restriction enzyme specificity protein Mg4; 80.6
1jr2_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 80.06
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=2.5e-19  Score=144.06  Aligned_cols=63  Identities=30%  Similarity=0.430  Sum_probs=59.4

Q ss_pred             CCCCCCCCccCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCccceeecccchhhhhhhhh
Q 015772          228 NGCSTRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQ  290 (400)
Q Consensus       228 ~~~~rRkRtrfT~~Ql~~LE~~F~~~~yPs~~~R~eLA~~LgLserQVqvWFQNRRaK~Krkq  290 (400)
                      ..+.+|.|+.|+..|+.+||..|..++||+..+|.+||.+|||++.||+|||||||+|+|+++
T Consensus        19 ~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~vWFqNRR~k~kk~~   81 (84)
T 2kt0_A           19 PVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQ   81 (84)
T ss_dssp             CSCSCCCSSCCCHHHHHHHHHHHHHSSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHTTTSCC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHh
Confidence            346788899999999999999999999999999999999999999999999999999999764
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3oka_C N-terminal His-affinity TAG; GT-B fold, alpha-mannosyltransferase, GDP-MAN binding, trans; HET: GDD; 2.20A {Escherichia coli} Back     alignment and structure
>1ydx_A Type I restriction enzyme specificity protein Mg4; type-I HSDS, DNA binding protein; 2.30A {Mycoplasma genitalium} SCOP: d.287.1.2 d.287.1.2 Back     alignment and structure
>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 400
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-16
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-16
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 9e-16
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-15
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-15
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-15
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 5e-15
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 6e-15
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 8e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-14
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 4e-14
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 8e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-13
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-13
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-13
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-13
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-13
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 9e-13
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-11
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-11
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-11
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 9e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-08
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-08
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Insulin gene enhancer protein isl-1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 71.4 bits (175), Expect = 1e-16
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 231 STRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQ 290
           +TR +  L+++Q   L   +  +       K  L +   L PR + VWFQN+R + K + 
Sbjct: 3   TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS 62
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query400
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.79
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.77
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.77
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.77
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.77
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.76
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.76
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.76
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.75
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.74
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.74
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.74
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.74
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.73
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.73
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.7
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.7
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.7
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.69
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.69
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.68
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.66
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.66
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.62
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.62
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.6
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.56
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.54
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.54
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.52
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.47
d1hlva166 DNA-binding domain of centromere binding protein B 83.76
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.4e-20  Score=141.18  Aligned_cols=58  Identities=29%  Similarity=0.521  Sum_probs=55.7

Q ss_pred             CCCCCccCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCccceeecccchhhhhhh
Q 015772          231 STRKKLRLSKQQSAFLEESFKEHTTLTPKQKLALAKQLNLRPRQVEVWFQNRRARTKL  288 (400)
Q Consensus       231 ~rRkRtrfT~~Ql~~LE~~F~~~~yPs~~~R~eLA~~LgLserQVqvWFQNRRaK~Kr  288 (400)
                      +||+|++||.+|+.+||..|..++||+..+|++||..|||++.||+|||||||+|+||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            3678999999999999999999999999999999999999999999999999999985
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure