Citrus Sinensis ID: 015897


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MAVVAQLSPSSYTETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIMNLSRM
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEEEEccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHHccccccccEEEEcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccEEccEEcccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccEEEEEEEEEEccEEEEEEEEccccccc
ccEEEEcccccccccccccccHHccccccccHcccccccccccccccEEEEEEcccccccccccccccccccccEEEEEEEEEcccccccccccccEEEEEEccccHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHccccccHHHEEEccHHHHHHHHHHHHHHHcccHHHEEccEEEEccccccEEEccccEEccEEHHHcccHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccEEEEEEEEEccEEEEcccEccccccc
mavvaqlspssytettrlsssqlslssTHLSSLRrrafrpiigprnptiscsvnqvqapvaveqddpksktndcygvfcltYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLaagevlgpdqpIALKLLGSERSLQALEGVAMELEDSLFPLLREvkiginpyelfeDAEWALLIgakprgpgmeraglldinGQIFAEQGKALNAVASRNVKVIVVgnpcntnaliclknapsipaknfhaltrLDENRAKCQLALKAgvfydkvsnmtiwgnhsttqvPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIkkwgrssaaSTAVSIVDAMKslvtptpegdwfssgvytngnpygiaedivfsmpcrskkvtSVCREMVIMNLSRM
mavvaqlspssytettrlsssqlslssthlsSLRRRAFRPiigprnptiscsvNQVQAPVaveqddpksktndcYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVtptpegdwfssGVYTNGNPYGIAEDIVFSMPCRskkvtsvcREMVIMNLSRM
MAVVAQLSPSSYtettrlsssqlslssthlsslrrrAFRPIIGPRNPTISCSVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIMNLSRM
****************************************II******ISCSV******************NDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIM*****
************************************************************************DCYGVFCLTY***************NIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIMNLSRM
*******************************SLRRRAFRPIIGPRNPTISCSVNQVQAP**********KTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKW********AVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIMNLSRM
********************************************RNPTISCSVNQVQ**************NDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAA***VSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIMN****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVVAQLSPSSYTETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMVIMNLSRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query398 2.2.26 [Sep-21-2011]
O48902437 Malate dehydrogenase [NAD N/A no 0.922 0.839 0.832 1e-180
P21528441 Malate dehydrogenase [NAD N/A no 0.907 0.818 0.842 1e-180
Q05145441 Malate dehydrogenase [NAD N/A no 0.939 0.848 0.794 1e-174
P17606429 Malate dehydrogenase [NAD N/A no 0.834 0.773 0.839 1e-168
P46489453 Malate dehydrogenase [NAD N/A no 0.824 0.724 0.824 1e-167
P37229432 Malate dehydrogenase [NAD N/A no 0.849 0.782 0.815 1e-166
P15719432 Malate dehydrogenase [NAD N/A no 0.846 0.780 0.805 1e-165
P52426435 Malate dehydrogenase [NAD N/A no 0.924 0.845 0.739 1e-163
Q6MAA3330 Malate dehydrogenase OS=P yes no 0.718 0.866 0.569 1e-90
B2UKY5329 Malate dehydrogenase OS=A yes no 0.723 0.875 0.546 1e-84
>sp|O48902|MDHP_MEDSA Malate dehydrogenase [NADP], chloroplastic OS=Medicago sativa GN=MDH1 PE=2 SV=1 Back     alignment and function desciption
 Score =  632 bits (1629), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 309/371 (83%), Positives = 333/371 (89%), Gaps = 4/371 (1%)

Query: 13  TETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSV--NQVQAPVAVEQDDPKSK 70
           ++T   SSSQLS  S  L         P+   ++  ISCSV  NQVQAP AV+  DPKSK
Sbjct: 11  SKTQLHSSSQLSFLSRTLPRHHHCTLAPLHRTQHARISCSVAPNQVQAP-AVQTQDPKSK 69

Query: 71  TNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIAL 130
             DCYGVFCLTYDLKAEEETKSWKK++ IAVSGAAGMI+NHLLFKLA+GEV GP+QPIAL
Sbjct: 70  P-DCYGVFCLTYDLKAEEETKSWKKLITIAVSGAAGMISNHLLFKLASGEVFGPNQPIAL 128

Query: 131 KLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMER 190
           KLLGSERSLQALEGVAMELEDSLFPLLREV I I+PYE+F+DAEWALLIGAKPRGPGMER
Sbjct: 129 KLLGSERSLQALEGVAMELEDSLFPLLREVVISIDPYEVFQDAEWALLIGAKPRGPGMER 188

Query: 191 AGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHALTRL 250
           A LLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAP+IPAKNFHALTRL
Sbjct: 189 AALLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPNIPAKNFHALTRL 248

Query: 251 DENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEG 310
           DENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARI+GLPVKE+IKDHKWLEE 
Sbjct: 249 DENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARIDGLPVKEVIKDHKWLEEE 308

Query: 311 FTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAE 370
           FTE +QKRGG LI+KWGRSSAAST+VSIVDA++SL+ PTPEGDWFS+GVYT GNPYGIAE
Sbjct: 309 FTEKVQKRGGALIQKWGRSSAASTSVSIVDAIRSLIIPTPEGDWFSTGVYTTGNPYGIAE 368

Query: 371 DIVFSMPCRSK 381
           DIVFSMPCRSK
Sbjct: 369 DIVFSMPCRSK 379




The chloroplastic, NADP-dependent form is essential for the photosynthesis C4 cycle, which allows plants to circumvent the problem of photorespiration. In C4 plants, NADP-MDH activity acts to convert oxaloacetate to malate in chloroplasts of mesophyll cells for transport to the bundle sheath cells.
Medicago sativa (taxid: 3879)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8EC: 2
>sp|P21528|MDHP_PEA Malate dehydrogenase [NADP], chloroplastic OS=Pisum sativum PE=1 SV=2 Back     alignment and function description
>sp|Q05145|MDHP_MESCR Malate dehydrogenase [NADP], chloroplastic OS=Mesembryanthemum crystallinum GN=MDH1 PE=2 SV=1 Back     alignment and function description
>sp|P17606|MDHP1_SORBI Malate dehydrogenase [NADP] 1, chloroplastic OS=Sorghum bicolor PE=1 SV=1 Back     alignment and function description
>sp|P46489|MDHP_FLABI Malate dehydrogenase [NADP], chloroplastic OS=Flaveria bidentis PE=1 SV=1 Back     alignment and function description
>sp|P37229|MDHP2_SORBI Malate dehydrogenase [NADP] 2, chloroplastic OS=Sorghum bicolor PE=1 SV=1 Back     alignment and function description
>sp|P15719|MDHP_MAIZE Malate dehydrogenase [NADP], chloroplastic OS=Zea mays PE=1 SV=1 Back     alignment and function description
>sp|P52426|MDHP_SPIOL Malate dehydrogenase [NADP], chloroplastic OS=Spinacia oleracea GN=MDH PE=1 SV=1 Back     alignment and function description
>sp|Q6MAA3|MDH_PARUW Malate dehydrogenase OS=Protochlamydia amoebophila (strain UWE25) GN=mdh PE=3 SV=1 Back     alignment and function description
>sp|B2UKY5|MDH_AKKM8 Malate dehydrogenase OS=Akkermansia muciniphila (strain ATCC BAA-835) GN=mdh PE=3 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query398
TAIR|locus:2161188443 AT5G58330 [Arabidopsis thalian 0.844 0.758 0.857 2.4e-156
TIGR_CMR|CBU_1241328 CBU_1241 "malate dehydrogenase 0.741 0.899 0.521 1.5e-74
UNIPROTKB|P0A5J6329 mdh "Malate dehydrogenase" [My 0.713 0.863 0.519 8.4e-74
ZFIN|ZDB-GENE-040204-1333 mdh1a "malate dehydrogenase 1a 0.753 0.900 0.472 1.1e-66
ZFIN|ZDB-GENE-030131-7655333 mdh1b "malate dehydrogenase 1b 0.713 0.852 0.482 3.2e-65
DICTYBASE|DDB_G0280255333 mdhC "malate dehydrogenase" [D 0.731 0.873 0.469 5.2e-65
UNIPROTKB|Q5ZME2334 MDH1 "Malate dehydrogenase, cy 0.721 0.859 0.488 1.1e-64
UNIPROTKB|E2QV08348 MDH1 "Malate dehydrogenase" [C 0.751 0.859 0.461 3.7e-64
UNIPROTKB|Q3T145334 MDH1 "Malate dehydrogenase, cy 0.753 0.898 0.469 7.6e-64
UNIPROTKB|P11708334 MDH1 "Malate dehydrogenase, cy 0.751 0.895 0.461 7.6e-64
TAIR|locus:2161188 AT5G58330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1524 (541.5 bits), Expect = 2.4e-156, P = 2.4e-156
 Identities = 289/337 (85%), Positives = 314/337 (93%)

Query:    46 NPTISCSVNQ-VQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGA 104
             N  ISCSV+Q  QAPVAV+++       +CYGVFCLTYDLKAEEET+SWKK++NIAVSGA
Sbjct:    48 NSKISCSVSQNSQAPVAVQENGLVKTKKECYGVFCLTYDLKAEEETRSWKKLINIAVSGA 107

Query:   105 AGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGI 164
             AGMI+NHLLFKLA+GEV GPDQPIALKLLGSERS+QALEGVAMELEDSLFPLLREV IG 
Sbjct:   108 AGMISNHLLFKLASGEVFGPDQPIALKLLGSERSIQALEGVAMELEDSLFPLLREVDIGT 167

Query:   165 NPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNP 224
             +P E+F+D EWA+LIGAKPRGPGMERA LLDINGQIFAEQGKALN  AS NVKV+VVGNP
Sbjct:   168 DPNEVFQDVEWAILIGAKPRGPGMERADLLDINGQIFAEQGKALNKAASPNVKVLVVGNP 227

Query:   225 CNTNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQV 284
             CNTNALICLKNAP+IPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQV
Sbjct:   228 CNTNALICLKNAPNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQV 287

Query:   285 PDFLNARINGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKS 344
             PDFLNARINGLPVKE+I DHKWLEEGFTE++QKRGGLLI+KWGRSSAASTAVSIVDA+KS
Sbjct:   288 PDFLNARINGLPVKEVITDHKWLEEGFTESVQKRGGLLIQKWGRSSAASTAVSIVDAIKS 347

Query:   345 LVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSK 381
             LVTPTPEGDWFS+GVYT+GNPYGI E +VFSMPCRSK
Sbjct:   348 LVTPTPEGDWFSTGVYTDGNPYGIEEGLVFSMPCRSK 384




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006108 "malate metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016615 "malate dehydrogenase activity" evidence=IEA;ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0044262 "cellular carbohydrate metabolic process" evidence=IEA
GO:0046554 "malate dehydrogenase (NADP+) activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TIGR_CMR|CBU_1241 CBU_1241 "malate dehydrogenase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P0A5J6 mdh "Malate dehydrogenase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040204-1 mdh1a "malate dehydrogenase 1a, NAD (soluble)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7655 mdh1b "malate dehydrogenase 1b, NAD (soluble)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280255 mdhC "malate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZME2 MDH1 "Malate dehydrogenase, cytoplasmic" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV08 MDH1 "Malate dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T145 MDH1 "Malate dehydrogenase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P11708 MDH1 "Malate dehydrogenase, cytoplasmic" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A9BVK0MDH_DELAS1, ., 1, ., 1, ., 3, 70.52060.71850.8719yesno
O48902MDHP_MEDSA1, ., 1, ., 1, ., 8, 20.83280.92210.8398N/Ano
B6IZN7MDH_COXB21, ., 1, ., 1, ., 3, 70.52180.74120.8993yesno
P52426MDHP_SPIOL1, ., 1, ., 1, ., 8, 20.73950.92460.8459N/Ano
Q9RXI8MDH_DEIRA1, ., 1, ., 1, ., 3, 70.50340.72360.8727yesno
Q21K60MDH_SACD21, ., 1, ., 1, ., 3, 70.50860.71600.8715yesno
B0SF41MDH_LEPBA1, ., 1, ., 1, ., 3, 70.52040.73110.8899yesno
B9MBP0MDH_ACIET1, ., 1, ., 1, ., 3, 70.51370.71850.8719yesno
Q5SKV7MDH_THET81, ., 1, ., 1, ., 3, 70.51380.71850.8746yesno
P46489MDHP_FLABI1, ., 1, ., 1, ., 8, 20.82490.82410.7240N/Ano
A1W9K7MDH_ACISJ1, ., 1, ., 1, ., 3, 70.51370.71850.8719yesno
A2SHT9MDH_METPP1, ., 1, ., 1, ., 3, 70.51560.71100.8628yesno
P61977MDH_THET21, ., 1, ., 1, ., 3, 70.51380.71850.8746yesno
A1KI28MDH_MYCBP1, ., 1, ., 1, ., 3, 70.51920.71350.8632yesno
B2UKY5MDH_AKKM81, ., 1, ., 1, ., 3, 70.54670.72360.8753yesno
A9KFT9MDH_COXBN1, ., 1, ., 1, ., 3, 70.51510.74120.8993yesno
A1TP96MDH_ACIAC1, ., 1, ., 1, ., 3, 70.51910.71100.8628yesno
B2HRH5MDH_MYCMM1, ., 1, ., 1, ., 3, 70.50990.75370.9118yesno
P0A5J7MDH_MYCBO1, ., 1, ., 1, ., 3, 70.51920.71350.8632yesno
P21528MDHP_PEA1, ., 1, ., 1, ., 8, 20.84280.90700.8185N/Ano
A5WGM2MDH_PSYWF1, ., 1, ., 1, ., 3, 70.50870.71100.8654yesno
P37229MDHP2_SORBI1, ., 1, ., 1, ., 8, 20.81570.84920.7824N/Ano
Q05145MDHP_MESCR1, ., 1, ., 1, ., 8, 20.79420.93960.8480N/Ano
Q83C87MDH_COXBU1, ., 1, ., 1, ., 3, 70.52180.74120.8993yesno
Q4FQU7MDH_PSYA21, ., 1, ., 1, ., 3, 70.50520.71600.8662yesno
P10584MDH_THETH1, ., 1, ., 1, ., 3, 70.51380.71850.8746yesno
P0A5J6MDH_MYCTU1, ., 1, ., 1, ., 3, 70.51920.71350.8632yesno
Q6MAA3MDH_PARUW1, ., 1, ., 1, ., 3, 70.56990.71850.8666yesno
B0SN74MDH_LEPBP1, ., 1, ., 1, ., 3, 70.52040.73110.8899yesno
P15719MDHP_MAIZE1, ., 1, ., 1, ., 8, 20.80510.84670.7800N/Ano
B6J7Q0MDH_COXB11, ., 1, ., 1, ., 3, 70.52180.74120.8993yesno
A9NDV1MDH_COXBR1, ., 1, ., 1, ., 3, 70.52180.74120.8993yesno
P17606MDHP1_SORBI1, ., 1, ., 1, ., 8, 20.83970.83410.7738N/Ano
A5U1T8MDH_MYCTA1, ., 1, ., 1, ., 3, 70.51920.71350.8632yesno
A0PVV1MDH_MYCUA1, ., 1, ., 1, ., 3, 70.50990.75370.9118yesno
C1AMN4MDH_MYCBT1, ., 1, ., 1, ., 3, 70.51920.71350.8632yesno
A0QCI6MDH_MYCA11, ., 1, ., 1, ., 3, 70.51920.71350.8632yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.983
4th Layer1.1.1.820.979
3rd Layer1.1.1.37LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_VIII0243
malate dehydrogenase (EC-1.1.1.37 1.1.1.82) (442 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.4745.2.1
annotation not avaliable (67 aa)
       0.505
gw1.I.5517.1
hypothetical protein (68 aa)
       0.502
eugene3.88080001
hypothetical protein (69 aa)
       0.426
eugene3.112590001
annotation not avaliable (69 aa)
       0.426
eugene3.00150397
hypothetical protein (58 aa)
       0.407

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
PLN00112444 PLN00112, PLN00112, malate dehydrogenase (NADP); P 0.0
TIGR01757387 TIGR01757, Malate-DH_plant, malate dehydrogenase, 0.0
cd01338322 cd01338, MDH_choloroplast_like, Chloroplast-like m 0.0
TIGR01759323 TIGR01759, MalateDH-SF1, malate dehydrogenase 1e-172
PRK05442326 PRK05442, PRK05442, malate dehydrogenase; Provisio 1e-161
cd00704323 cd00704, MDH, Malate dehydrogenase 1e-160
cd01336325 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic an 1e-131
TIGR01758324 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD- 1e-103
PLN00135309 PLN00135, PLN00135, malate dehydrogenase 5e-83
cd00650263 cd00650, LDH_MDH_like, NAD-dependent, lactate dehy 1e-66
COG0039313 COG0039, Mdh, Malate/lactate dehydrogenases [Energ 3e-63
TIGR01756313 TIGR01756, LDH_protist, lactate dehydrogenase 2e-61
cd05295452 cd05295, MDH_like, Malate dehydrogenase-like 8e-57
pfam00056142 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, 2e-43
pfam02866173 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, 4e-43
PTZ00117319 PTZ00117, PTZ00117, malate dehydrogenase; Provisio 1e-12
cd05294309 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenas 5e-12
PRK06223307 PRK06223, PRK06223, malate dehydrogenase; Reviewed 8e-11
cd01339300 cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik 1e-10
TIGR01763305 TIGR01763, MalateDH_bact, malate dehydrogenase, NA 2e-07
cd00300300 cd00300, LDH_like, L-lactate dehydrogenase-like en 9e-07
cd05290307 cd05290, LDH_3, A subgroup of L-lactate dehydrogen 2e-06
TIGR01772312 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, 9e-06
PTZ00325321 PTZ00325, PTZ00325, malate dehydrogenase; Provisio 1e-05
PRK05086312 PRK05086, PRK05086, malate dehydrogenase; Provisio 3e-04
cd05291306 cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd 3e-04
TIGR01771299 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase 0.002
cd01337310 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma 0.002
>gnl|CDD|215060 PLN00112, PLN00112, malate dehydrogenase (NADP); Provisional Back     alignment and domain information
 Score =  739 bits (1910), Expect = 0.0
 Identities = 314/386 (81%), Positives = 340/386 (88%), Gaps = 7/386 (1%)

Query: 2   AVVAQLSPSSYTET-----TRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQV 56
             VA+LS    T       +RL SSQL LS THLS+  RRA  P     N  ISCSVNQ 
Sbjct: 1   MAVAELSTPKVTSPFLNTSSRLRSSQLGLSRTHLSNHFRRALLPRRRATNARISCSVNQA 60

Query: 57  -QAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFK 115
            QAP AV++   K+K  +CYGVFCLTYDLKAEEETKSWKK++N+AVSGAAGMI+NHLLFK
Sbjct: 61  SQAPAAVQEKGVKTK-KECYGVFCLTYDLKAEEETKSWKKLINVAVSGAAGMISNHLLFK 119

Query: 116 LAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEW 175
           LA+GEV GPDQPIALKLLGSERS QALEGVAMELEDSL+PLLREV IGI+PYE+F+DAEW
Sbjct: 120 LASGEVFGPDQPIALKLLGSERSKQALEGVAMELEDSLYPLLREVSIGIDPYEVFQDAEW 179

Query: 176 ALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKN 235
           ALLIGAKPRGPGMERA LLDINGQIFAEQGKALN VASRNVKVIVVGNPCNTNALICLKN
Sbjct: 180 ALLIGAKPRGPGMERADLLDINGQIFAEQGKALNEVASRNVKVIVVGNPCNTNALICLKN 239

Query: 236 APSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGL 295
           AP+IPAKNFHALTRLDENRAKCQLALKAGVFYDKVSN+TIWGNHSTTQVPDFLNA+INGL
Sbjct: 240 APNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKINGL 299

Query: 296 PVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWF 355
           PVKE+I DHKWLEE FT  +QKRGG+LIKKWGRSSAASTAVSI DA+KSLVTPTPEGDWF
Sbjct: 300 PVKEVITDHKWLEEEFTPKVQKRGGVLIKKWGRSSAASTAVSIADAIKSLVTPTPEGDWF 359

Query: 356 SSGVYTNGNPYGIAEDIVFSMPCRSK 381
           S+GVYT+GNPYGIAE +VFSMPCRSK
Sbjct: 360 STGVYTDGNPYGIAEGLVFSMPCRSK 385


Length = 444

>gnl|CDD|130818 TIGR01757, Malate-DH_plant, malate dehydrogenase, NADP-dependent Back     alignment and domain information
>gnl|CDD|133423 cd01338, MDH_choloroplast_like, Chloroplast-like malate dehydrogenases Back     alignment and domain information
>gnl|CDD|130820 TIGR01759, MalateDH-SF1, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|235468 PRK05442, PRK05442, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133420 cd00704, MDH, Malate dehydrogenase Back     alignment and domain information
>gnl|CDD|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>gnl|CDD|130819 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|177744 PLN00135, PLN00135, malate dehydrogenase Back     alignment and domain information
>gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130817 TIGR01756, LDH_protist, lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133431 cd05295, MDH_like, Malate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain Back     alignment and domain information
>gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133430 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>gnl|CDD|133426 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent Back     alignment and domain information
>gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase Back     alignment and domain information
>gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 398
PLN00112444 malate dehydrogenase (NADP); Provisional 100.0
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 100.0
PRK05442326 malate dehydrogenase; Provisional 100.0
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 100.0
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 100.0
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 100.0
KOG1496332 consensus Malate dehydrogenase [Energy production 100.0
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 100.0
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 100.0
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 100.0
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 100.0
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 100.0
PLN02602350 lactate dehydrogenase 100.0
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 100.0
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 100.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 100.0
TIGR01756313 LDH_protist lactate dehydrogenase. This model repr 100.0
PLN00135309 malate dehydrogenase 100.0
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 100.0
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 100.0
KOG1495332 consensus Lactate dehydrogenase [Energy production 100.0
PTZ00117319 malate dehydrogenase; Provisional 100.0
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 100.0
PTZ00082321 L-lactate dehydrogenase; Provisional 100.0
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 100.0
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 100.0
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 100.0
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 100.0
PRK06223307 malate dehydrogenase; Reviewed 100.0
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 100.0
PTZ00325321 malate dehydrogenase; Provisional 100.0
PLN00106323 malate dehydrogenase 100.0
PRK05086312 malate dehydrogenase; Provisional 100.0
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 100.0
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 100.0
PRK15076431 alpha-galactosidase; Provisional 100.0
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 100.0
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 100.0
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 100.0
PF02866174 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta 99.97
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.97
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 99.97
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 99.95
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 99.79
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 98.54
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.52
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.41
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.37
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.29
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 98.25
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.23
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.17
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.17
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.16
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.15
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 98.15
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.14
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 98.13
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.12
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.12
COG2085211 Predicted dinucleotide-binding enzymes [General fu 98.09
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.08
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.08
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 98.03
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.01
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 97.97
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 97.87
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.85
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.79
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.76
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.72
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.7
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.64
PLN03209 576 translocon at the inner envelope of chloroplast su 97.6
PF11975232 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-term 97.6
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.59
PRK07680273 late competence protein ComER; Validated 97.53
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.41
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 97.4
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.37
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.34
PRK08655 437 prephenate dehydrogenase; Provisional 97.34
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.34
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 97.33
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.32
PLN02688266 pyrroline-5-carboxylate reductase 97.32
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 97.3
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.26
PLN02166436 dTDP-glucose 4,6-dehydratase 97.26
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.26
PRK12921305 2-dehydropantoate 2-reductase; Provisional 97.24
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.22
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 97.22
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.21
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 97.21
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.18
PRK07417279 arogenate dehydrogenase; Reviewed 97.16
COG0300265 DltE Short-chain dehydrogenases of various substra 97.15
PLN02695370 GDP-D-mannose-3',5'-epimerase 97.11
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.11
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.1
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.09
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.09
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.04
CHL00194317 ycf39 Ycf39; Provisional 97.03
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.01
PLN02206442 UDP-glucuronate decarboxylase 97.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 97.0
PLN02778298 3,5-epimerase/4-reductase 96.92
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.9
PLN02427386 UDP-apiose/xylose synthase 96.9
PLN02650351 dihydroflavonol-4-reductase 96.88
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 96.88
PLN00198338 anthocyanidin reductase; Provisional 96.87
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.82
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.77
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 96.75
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 96.71
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 96.7
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.7
PRK11908347 NAD-dependent epimerase/dehydratase family protein 96.7
PRK07102243 short chain dehydrogenase; Provisional 96.68
PRK10675338 UDP-galactose-4-epimerase; Provisional 96.64
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.64
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.62
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 96.61
PRK14982340 acyl-ACP reductase; Provisional 96.61
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 96.6
PRK08267260 short chain dehydrogenase; Provisional 96.6
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 96.54
PLN02214342 cinnamoyl-CoA reductase 96.52
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.51
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 96.51
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 96.49
PTZ00431260 pyrroline carboxylate reductase; Provisional 96.46
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.45
PLN02896353 cinnamyl-alcohol dehydrogenase 96.45
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 96.44
PLN02240352 UDP-glucose 4-epimerase 96.43
PRK06194287 hypothetical protein; Provisional 96.4
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.4
PRK06545359 prephenate dehydrogenase; Validated 96.39
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 96.38
PRK12939250 short chain dehydrogenase; Provisional 96.38
PRK05708305 2-dehydropantoate 2-reductase; Provisional 96.37
COG2910211 Putative NADH-flavin reductase [General function p 96.37
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 96.36
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.36
PLN02583297 cinnamoyl-CoA reductase 96.35
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.33
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 96.33
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.33
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 96.33
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 96.31
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.3
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.3
PRK12746254 short chain dehydrogenase; Provisional 96.28
PRK10538248 malonic semialdehyde reductase; Provisional 96.28
PRK06196315 oxidoreductase; Provisional 96.27
PRK07326237 short chain dehydrogenase; Provisional 96.25
PRK08507275 prephenate dehydrogenase; Validated 96.24
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.21
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 96.21
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 96.18
PLN02572442 UDP-sulfoquinovose synthase 96.17
PRK07806248 short chain dehydrogenase; Provisional 96.17
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.16
PRK07890258 short chain dehydrogenase; Provisional 96.15
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 96.15
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 96.14
PRK07424406 bifunctional sterol desaturase/short chain dehydro 96.11
PLN02256304 arogenate dehydrogenase 96.08
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 96.05
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.04
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.04
PRK07825273 short chain dehydrogenase; Provisional 96.04
PRK08339263 short chain dehydrogenase; Provisional 96.03
PRK06180277 short chain dehydrogenase; Provisional 96.02
PRK07478254 short chain dehydrogenase; Provisional 96.02
PRK07774250 short chain dehydrogenase; Provisional 95.99
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.96
PRK07454241 short chain dehydrogenase; Provisional 95.95
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 95.95
PRK07814263 short chain dehydrogenase; Provisional 95.95
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 95.95
PRK08643256 acetoin reductase; Validated 95.93
PRK05650270 short chain dehydrogenase; Provisional 95.92
PRK08265261 short chain dehydrogenase; Provisional 95.92
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.92
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 95.91
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 95.91
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.9
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 95.88
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 95.88
PRK05866293 short chain dehydrogenase; Provisional 95.87
PRK12937245 short chain dehydrogenase; Provisional 95.85
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.84
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 95.83
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 95.82
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.81
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 95.8
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 95.79
PLN02383344 aspartate semialdehyde dehydrogenase 95.79
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.79
PRK13304265 L-aspartate dehydrogenase; Reviewed 95.78
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.78
PRK06101240 short chain dehydrogenase; Provisional 95.78
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.77
PRK08085254 gluconate 5-dehydrogenase; Provisional 95.76
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.76
PRK06197306 short chain dehydrogenase; Provisional 95.75
PRK05717255 oxidoreductase; Validated 95.73
PRK07832272 short chain dehydrogenase; Provisional 95.72
PRK07067257 sorbitol dehydrogenase; Provisional 95.72
TIGR02415254 23BDH acetoin reductases. One member of this famil 95.65
PRK07453322 protochlorophyllide oxidoreductase; Validated 95.65
PRK09186256 flagellin modification protein A; Provisional 95.65
PRK07069251 short chain dehydrogenase; Validated 95.65
PRK07109334 short chain dehydrogenase; Provisional 95.64
PRK06181263 short chain dehydrogenase; Provisional 95.64
PRK09072263 short chain dehydrogenase; Provisional 95.62
PRK12480330 D-lactate dehydrogenase; Provisional 95.61
PRK06482276 short chain dehydrogenase; Provisional 95.61
PRK05867253 short chain dehydrogenase; Provisional 95.61
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.6
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 95.6
PRK07024257 short chain dehydrogenase; Provisional 95.6
PRK07035252 short chain dehydrogenase; Provisional 95.58
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.57
PRK06128300 oxidoreductase; Provisional 95.56
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 95.56
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 95.56
PRK07677252 short chain dehydrogenase; Provisional 95.55
PRK06172253 short chain dehydrogenase; Provisional 95.54
PRK12747252 short chain dehydrogenase; Provisional 95.53
PLN02780320 ketoreductase/ oxidoreductase 95.51
PRK06182273 short chain dehydrogenase; Validated 95.51
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 95.49
PRK08040336 putative semialdehyde dehydrogenase; Provisional 95.48
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.48
PRK05876275 short chain dehydrogenase; Provisional 95.48
PRK06138252 short chain dehydrogenase; Provisional 95.47
KOG0409327 consensus Predicted dehydrogenase [General functio 95.47
PRK12828239 short chain dehydrogenase; Provisional 95.45
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.44
PRK08340259 glucose-1-dehydrogenase; Provisional 95.44
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.44
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 95.43
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 95.42
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.42
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.4
PRK09291257 short chain dehydrogenase; Provisional 95.37
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 95.37
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.37
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.35
PRK05993277 short chain dehydrogenase; Provisional 95.35
PLN02712 667 arogenate dehydrogenase 95.34
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.34
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 95.33
PRK07904253 short chain dehydrogenase; Provisional 95.29
PRK09242257 tropinone reductase; Provisional 95.27
PRK08277278 D-mannonate oxidoreductase; Provisional 95.26
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 95.26
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 95.25
PLN02260668 probable rhamnose biosynthetic enzyme 95.24
PRK06949258 short chain dehydrogenase; Provisional 95.23
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 95.23
PRK12829264 short chain dehydrogenase; Provisional 95.23
PRK08219227 short chain dehydrogenase; Provisional 95.22
PRK06940275 short chain dehydrogenase; Provisional 95.2
PRK06198260 short chain dehydrogenase; Provisional 95.2
PRK08703239 short chain dehydrogenase; Provisional 95.2
PRK06139330 short chain dehydrogenase; Provisional 95.19
PRK07063260 short chain dehydrogenase; Provisional 95.19
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.18
PLN02253280 xanthoxin dehydrogenase 95.18
PRK05855582 short chain dehydrogenase; Validated 95.15
PRK07985294 oxidoreductase; Provisional 95.15
PLN02686367 cinnamoyl-CoA reductase 95.15
PRK09135249 pteridine reductase; Provisional 95.14
PRK06125259 short chain dehydrogenase; Provisional 95.14
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.13
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 95.13
PRK12827249 short chain dehydrogenase; Provisional 95.12
PRK05884223 short chain dehydrogenase; Provisional 95.11
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.1
PRK05875276 short chain dehydrogenase; Provisional 95.1
PRK12744257 short chain dehydrogenase; Provisional 95.08
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.08
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 95.07
PRK08291330 ectoine utilization protein EutC; Validated 95.06
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 95.05
PRK07097265 gluconate 5-dehydrogenase; Provisional 95.0
PRK06924251 short chain dehydrogenase; Provisional 94.96
PRK08324681 short chain dehydrogenase; Validated 94.95
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 94.95
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 94.93
PRK08618325 ornithine cyclodeaminase; Validated 94.92
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.92
PRK07062265 short chain dehydrogenase; Provisional 94.91
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.91
PRK12743256 oxidoreductase; Provisional 94.89
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 94.88
PRK06407301 ornithine cyclodeaminase; Provisional 94.87
PRK08251248 short chain dehydrogenase; Provisional 94.86
PRK07576264 short chain dehydrogenase; Provisional 94.85
PRK08263275 short chain dehydrogenase; Provisional 94.82
PRK06500249 short chain dehydrogenase; Provisional 94.81
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 94.81
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 94.8
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.79
PLN02653340 GDP-mannose 4,6-dehydratase 94.79
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 94.78
PRK06947248 glucose-1-dehydrogenase; Provisional 94.77
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 94.76
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 94.71
PRK06141314 ornithine cyclodeaminase; Validated 94.7
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 94.69
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 94.69
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.69
PLN02260 668 probable rhamnose biosynthetic enzyme 94.69
PRK08862227 short chain dehydrogenase; Provisional 94.68
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 94.67
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 94.66
PRK05479330 ketol-acid reductoisomerase; Provisional 94.65
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 94.64
PRK12935247 acetoacetyl-CoA reductase; Provisional 94.64
PRK07201 657 short chain dehydrogenase; Provisional 94.64
PRK09134258 short chain dehydrogenase; Provisional 94.6
PRK06057255 short chain dehydrogenase; Provisional 94.6
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 94.6
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.59
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.54
PRK05865 854 hypothetical protein; Provisional 94.5
PRK08589272 short chain dehydrogenase; Validated 94.49
PRK13302271 putative L-aspartate dehydrogenase; Provisional 94.46
PRK07074257 short chain dehydrogenase; Provisional 94.44
PRK06914280 short chain dehydrogenase; Provisional 94.41
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 94.39
PLN02712667 arogenate dehydrogenase 94.38
PRK06179270 short chain dehydrogenase; Provisional 94.38
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.37
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 94.34
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 94.34
PRK07340304 ornithine cyclodeaminase; Validated 94.32
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.32
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 94.31
PLN00203519 glutamyl-tRNA reductase 94.27
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 94.26
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.25
PRK07775274 short chain dehydrogenase; Provisional 94.24
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 94.21
PRK07060245 short chain dehydrogenase; Provisional 94.2
PRK06199379 ornithine cyclodeaminase; Validated 94.18
PRK06823315 ornithine cyclodeaminase; Validated 94.17
PRK06114254 short chain dehydrogenase; Provisional 94.14
PRK08278273 short chain dehydrogenase; Provisional 94.14
PRK05599246 hypothetical protein; Provisional 94.13
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.12
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.12
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.12
PRK08628258 short chain dehydrogenase; Provisional 94.09
PRK12742237 oxidoreductase; Provisional 94.09
PRK12320 699 hypothetical protein; Provisional 94.08
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.05
PRK07589346 ornithine cyclodeaminase; Validated 94.01
PRK06701290 short chain dehydrogenase; Provisional 93.99
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 93.99
PRK05872296 short chain dehydrogenase; Provisional 93.97
PRK06719157 precorrin-2 dehydrogenase; Validated 93.95
PRK07201657 short chain dehydrogenase; Provisional 93.92
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 93.92
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 93.92
PRK08226263 short chain dehydrogenase; Provisional 93.91
PRK13940414 glutamyl-tRNA reductase; Provisional 93.9
PRK12938246 acetyacetyl-CoA reductase; Provisional 93.87
PRK08818 370 prephenate dehydrogenase; Provisional 93.86
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 93.85
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 93.85
PRK08936261 glucose-1-dehydrogenase; Provisional 93.81
PRK00048257 dihydrodipicolinate reductase; Provisional 93.81
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 93.76
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 93.74
PRK07831262 short chain dehydrogenase; Provisional 93.66
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 93.65
PRK08300302 acetaldehyde dehydrogenase; Validated 93.64
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.63
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 93.62
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 93.58
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.55
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.52
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 93.52
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 93.5
PRK05693274 short chain dehydrogenase; Provisional 93.49
PRK13301267 putative L-aspartate dehydrogenase; Provisional 93.48
PRK13243333 glyoxylate reductase; Reviewed 93.44
PRK12367245 short chain dehydrogenase; Provisional 93.39
PRK07856252 short chain dehydrogenase; Provisional 93.3
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 93.26
PRK07574385 formate dehydrogenase; Provisional 93.25
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 93.24
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 93.24
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.22
PRK05854313 short chain dehydrogenase; Provisional 93.19
TIGR01746367 Thioester-redct thioester reductase domain. It has 93.17
PRK08264238 short chain dehydrogenase; Validated 93.14
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 93.11
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 93.09
PRK15059292 tartronate semialdehyde reductase; Provisional 93.02
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 93.02
PRK08177225 short chain dehydrogenase; Provisional 92.99
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 92.93
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 92.93
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 92.9
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 92.9
PRK12824245 acetoacetyl-CoA reductase; Provisional 92.85
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 92.81
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 92.78
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 92.74
PRK06153393 hypothetical protein; Provisional 92.74
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.7
PRK06046326 alanine dehydrogenase; Validated 92.67
PRK08306296 dipicolinate synthase subunit A; Reviewed 92.65
PRK06720169 hypothetical protein; Provisional 92.65
PRK09009235 C factor cell-cell signaling protein; Provisional 92.64
PLN02494477 adenosylhomocysteinase 92.61
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.54
PRK08223287 hypothetical protein; Validated 92.42
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 92.41
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.41
PLN03139386 formate dehydrogenase; Provisional 92.4
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 92.37
PRK06484520 short chain dehydrogenase; Validated 92.34
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 92.32
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 92.31
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 92.31
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.28
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 92.27
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 92.25
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.24
PRK13303265 L-aspartate dehydrogenase; Provisional 92.21
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.11
PRK06841255 short chain dehydrogenase; Provisional 92.1
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 92.09
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.07
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.06
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 92.05
PRK06484 520 short chain dehydrogenase; Validated 92.01
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.97
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 91.93
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 91.89
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 91.86
PLN02858 1378 fructose-bisphosphate aldolase 91.82
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 91.81
PRK09496 453 trkA potassium transporter peripheral membrane com 91.81
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 91.8
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.8
PLN02928347 oxidoreductase family protein 91.79
PRK08605332 D-lactate dehydrogenase; Validated 91.77
PRK06523260 short chain dehydrogenase; Provisional 91.73
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 91.58
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 91.54
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 91.52
PRK06953222 short chain dehydrogenase; Provisional 91.37
PRK14027283 quinate/shikimate dehydrogenase; Provisional 91.36
PRK08303305 short chain dehydrogenase; Provisional 91.35
PTZ00075476 Adenosylhomocysteinase; Provisional 91.33
PLN02996 491 fatty acyl-CoA reductase 91.33
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.24
PLN03129581 NADP-dependent malic enzyme; Provisional 91.22
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 91.13
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 91.07
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 91.05
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 90.94
PRK07791286 short chain dehydrogenase; Provisional 90.88
PRK05562223 precorrin-2 dehydrogenase; Provisional 90.77
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 90.75
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 90.66
PRK06123248 short chain dehydrogenase; Provisional 90.48
PLN00015308 protochlorophyllide reductase 90.39
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 90.38
PRK07578199 short chain dehydrogenase; Provisional 90.31
PRK06398258 aldose dehydrogenase; Validated 90.15
COG5322351 Predicted dehydrogenase [General function predicti 90.07
KOG1208314 consensus Dehydrogenases with different specificit 90.07
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 90.01
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 89.99
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 89.97
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.88
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 89.87
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 89.8
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 89.79
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 89.79
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 89.77
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 89.68
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 89.62
PRK06483236 dihydromonapterin reductase; Provisional 89.61
PRK07041230 short chain dehydrogenase; Provisional 89.57
PRK03562621 glutathione-regulated potassium-efflux system prot 89.54
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 89.53
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-95  Score=742.28  Aligned_cols=393  Identities=80%  Similarity=1.231  Sum_probs=368.8

Q ss_pred             eeeeeecCCC-----ccccceeccccccccccccCccccccCCCCCCCCCCeeEEEeccc-ccccccccCCCCCCCCCcc
Q 015897            2 AVVAQLSPSS-----YTETTRLSSSQLSLSSTHLSSLRRRAFRPIIGPRNPTISCSVNQV-QAPVAVEQDDPKSKTNDCY   75 (398)
Q Consensus         2 ~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~   75 (398)
                      ++||+++++.     .+++++++++|+++++++++.|+|+.|+|++|.++++|+|||+++ |+|+++++++++.| +|||
T Consensus         1 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~   79 (444)
T PLN00112          1 MAVAELSTPKVTSPFLNTSSRLRSSQLGLSRTHLSNHFRRALLPRRRATNARISCSVNQASQAPAAVQEKGVKTK-KECY   79 (444)
T ss_pred             CcchhccccccccccccchhhccccccccccccccccccccccccccccccceeeccccccCCCccccccccccC-CCce
Confidence            3577777664     568889999999999999999999999999999999999999999 88888888887666 9999


Q ss_pred             eeeEEeeccchhHhhhhccCCCEEEEEcCCCchHHHHHHHHHhcCcCCCCCceEEEecccccchhhHHHHHHHHhhhcCC
Q 015897           76 GVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFP  155 (398)
Q Consensus        76 ~~~~~~~~~~~~~~~~~~~~~~KI~IiGA~G~vG~~la~~L~~~~~~~~~~~i~L~L~d~D~~~~~l~g~a~DL~d~~~~  155 (398)
                      ||||++||+++|+..+.|+++.||+||||+|+||+++++.|+.+++++.+|++.++|+++|+++++++|++|||+|+.++
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~KV~IIGAaG~VG~~~A~~L~~~~v~g~~~~i~~eLvliD~~~~~a~G~amDL~daa~~  159 (444)
T PLN00112         80 GVFCLTYDLKAEEETKSWKKLINVAVSGAAGMISNHLLFKLASGEVFGPDQPIALKLLGSERSKQALEGVAMELEDSLYP  159 (444)
T ss_pred             EEEEEEEecccchhhhcCCCCeEEEEECCCcHHHHHHHHHHHhcccccCCCCcccEEEEEcCCcchhHHHHHHHHHhhhh
Confidence            99999999999999999999999999997799999999999999999988888888888999999999999999999877


Q ss_pred             CcceEEEecCcccccCCCcEEEEeCCCCCCCCCchhhhHHHHHHHHHHHHHHHHHhcCCCeEEEEECCCchhHHHHHHHH
Q 015897          156 LLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKN  235 (398)
Q Consensus       156 ~~~~v~i~~~~~eal~dADiViitag~~rk~g~~r~dll~~N~~i~~~i~~~i~~~a~p~a~vIvvtNP~d~~t~~~~k~  235 (398)
                      ++.++.+++++|++++|||+||+++|.||+|||+|.|++..|++|++++++.|+++++|+++||++|||||+||++++++
T Consensus       160 ~~~~v~i~~~~ye~~kdaDiVVitAG~prkpG~tR~dLl~~N~~I~k~i~~~I~~~a~p~~ivIVVsNPvDv~t~v~~k~  239 (444)
T PLN00112        160 LLREVSIGIDPYEVFQDAEWALLIGAKPRGPGMERADLLDINGQIFAEQGKALNEVASRNVKVIVVGNPCNTNALICLKN  239 (444)
T ss_pred             hcCceEEecCCHHHhCcCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEcCCcHHHHHHHHHHH
Confidence            76678888899999999999999999999999999999999999999999999995479999999999999999999999


Q ss_pred             CCCCCCceEEecCchhHHHHHHHHHHHcCcCcCceeeEEEEeccCCCccccccceEEcCccchhhcccccccHHHHHHHH
Q 015897          236 APSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKWLEEGFTETI  315 (398)
Q Consensus       236 ~~~~~~kvig~gt~lDs~Rl~~~lA~~lgv~~~~V~~v~V~G~Hg~s~vp~~S~a~I~G~p~~~~i~~~~~~~~el~~~v  315 (398)
                      ++.+++|+||+||.||++|++++||+++|+++++|+++|||||||++|||+||+++|+|+|+.+++++++|+.++|.+++
T Consensus       240 sg~~~~rViGtgT~LDsaR~r~~LA~~l~V~~~~V~~~~V~GeHGdsqvp~wS~a~V~G~pl~e~i~~~~~~~~ei~~~v  319 (444)
T PLN00112        240 APNIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKINGLPVKEVITDHKWLEEEFTPKV  319 (444)
T ss_pred             cCCCCcceEEeeccHHHHHHHHHHHHHhCcCHHHcccceEEecCCCceeeccceeEECCccHHHhhccccchHHHHHHHH
Confidence            97666699999999999999999999999999999777999999999999999999999999999887778889999999


Q ss_pred             HhhhHHHHHhcCCCcHHHHHHHHHHHHHHhhcCCCCCcEEEEEEEeCCccCCCCCceEEEEeEEEcCCCceeeEee-ccC
Q 015897          316 QKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSVCREMV-IMN  394 (398)
Q Consensus       316 ~~~~~~ii~~~G~t~~~s~A~~I~~aI~~~~~~~~~~~i~~~sv~~~G~~ygip~dv~~svP~~ig~~Gv~~~~i~-~l~  394 (398)
                      +++|++|+++||+++|+++|.+++++|++|+.|+|+++|+|+|++++|++||+++|++||+||++|++|+  ++++ +|+
T Consensus       320 ~~~g~~Ii~~kG~t~~~s~a~ai~~~I~ail~~~d~~~vlpvsv~l~G~~YGi~~dv~~SvPvvig~~Gv--~~Iv~el~  397 (444)
T PLN00112        320 QKRGGVLIKKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTDGNPYGIAEGLVFSMPCRSKGDGD--YEIVKDVE  397 (444)
T ss_pred             HHHHHHHHhccCchhHHHHHHHHHHHHHHHHcCCCCCeEEEEEEEeCCcccCCCCCeEEEeEEEEeCCee--EEECCCCC
Confidence            9999999999999999899999999999999888999999999999995599989999999999999999  8999 699


Q ss_pred             CCC
Q 015897          395 LSR  397 (398)
Q Consensus       395 L~~  397 (398)
                      |++
T Consensus       398 L~~  400 (444)
T PLN00112        398 IDD  400 (444)
T ss_pred             CCH
Confidence            985



>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>KOG1496 consensus Malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01756 LDH_protist lactate dehydrogenase Back     alignment and domain information
>PLN00135 malate dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF11975 Glyco_hydro_4C: Family 4 glycosyl hydrolase C-terminal domain; InterPro: IPR022616 This domain is found primarily in bacterial family 4 glycosyl hydrolases Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
1civ_A385 Chloroplast Nadp-Dependent Malate Dehydrogenase Fro 1e-167
7mdh_A375 Structural Basis For Light Acitvation Of A Chloropl 1e-165
1wze_A327 Structural Basis For Alteration Of Cofactor Specifi 5e-81
1iz9_A327 Crystal Structure Of Malate Dehydrogenase From Ther 3e-77
1bmd_A327 Determinants Of Protein Thermostability Observed In 3e-77
1bdm_A327 The Structure At 1.8 Angstroms Resolution Of A Sing 2e-76
1b8p_A329 Malate Dehydrogenase From Aquaspirillum Arcticum Le 2e-69
4mdh_A334 Refined Crystal Structure Of Cytoplasmic Malate Deh 6e-69
5mdh_A333 Crystal Structure Of Ternary Complex Of Porcine Cyt 6e-69
3d5t_A331 Crystal Structure Of Malate Dehydrogenase From Burk 6e-66
4h7p_A345 Crystal Structure Of A Putative Cytosolic Malate De 6e-64
3fi9_A343 Crystal Structure Of Malate Dehydrogenase From Porp 2e-15
1hyg_A313 Crystal Structure Of Mj0490 Gene Product, The Famil 5e-12
1a5z_A319 Lactate Dehydrogenase From Thermotoga Maritima (tml 1e-10
2hjr_A328 Crystal Structure Of Cryptosporidium Parvum Malate 2e-08
1gv0_A310 Structural Basis For Thermophilic Protein Stability 3e-08
2d4a_A308 Structure Of The Malate Dehydrogenase From Aeropyru 1e-07
3nep_X314 1.55a Resolution Structure Of Malate Dehydrogenase 2e-07
1guy_A309 Structural Basis For Thermophilic Protein Stability 9e-07
1uxh_A309 Large Improvement In The Thermal Stability Of A Tet 2e-06
1ur5_A309 Stabilization Of A Tetrameric Malate Dehydrogenase 2e-06
1uxi_A309 Large Improvement In The Thermal Stability Of A Tet 2e-06
3gvh_A324 Crystal Structure Of LactateMALATE DEHYDROGENASE FR 3e-06
1y6j_A318 L-Lactate Dehydrogenase From Clostridium Thermocell 7e-06
1gv1_A310 Structural Basis For Thermophilic Protein Stability 1e-05
1guz_A310 Structural Basis For Thermophilic Protein Stability 2e-05
3p7m_A321 Structure Of Putative Lactate Dehydrogenase From Fr 5e-05
1sov_A328 Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Ap 6e-05
3czm_A326 T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex 6e-05
4e0b_A313 2.17 Angstrom Resolution Crystal Structure Of Malat 1e-04
3vku_A326 Penta Mutant Of Lactobacillus Casei Lactate Dehydro 6e-04
1pzg_A331 T.Gondii Ldh1 Complexed With Apad And Sulfate At 1. 8e-04
>pdb|1CIV|A Chain A, Chloroplast Nadp-Dependent Malate Dehydrogenase From Flaveria Bidentis Length = 385 Back     alignment and structure

Iteration: 1

Score = 583 bits (1503), Expect = e-167, Method: Compositional matrix adjust. Identities = 275/330 (83%), Positives = 306/330 (92%), Gaps = 6/330 (1%) Query: 52 SVNQVQAPVAVEQDDPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANH 111 S +Q+QAP+ P + +C+GVFCLTYDLKAEEETKSWKK++N+AVSGAAGMI+NH Sbjct: 4 SSDQIQAPL------PAKQKPECFGVFCLTYDLKAEEETKSWKKIINVAVSGAAGMISNH 57 Query: 112 LLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFE 171 LLFKLA+GEV GPDQPI+LKLLGSERS ALEGVAMELEDSL+PLLR+V IGI+PYE+F+ Sbjct: 58 LLFKLASGEVFGPDQPISLKLLGSERSFAALEGVAMELEDSLYPLLRQVSIGIDPYEIFQ 117 Query: 172 DAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALI 231 DAEWALLIGAKPRGPGMERA LLDINGQIFAEQGKALNAVAS NVKV+VVGNPCNTNALI Sbjct: 118 DAEWALLIGAKPRGPGMERADLLDINGQIFAEQGKALNAVASPNVKVMVVGNPCNTNALI 177 Query: 232 CLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNAR 291 CLKNAP+IP KNFHALTRLDENRAKCQLALKAGVFYDKVSN+TIWGNHSTTQVPDFLNA+ Sbjct: 178 CLKNAPNIPPKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAK 237 Query: 292 INGLPVKEIIKDHKWLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPE 351 I+G+PV E+I+D KWLE+ FT +Q RGG+LIKKWGRSSAASTAVSIVDA++SLVTPTPE Sbjct: 238 IHGIPVTEVIRDRKWLEDEFTNMVQTRGGVLIKKWGRSSAASTAVSIVDAIRSLVTPTPE 297 Query: 352 GDWFSSGVYTNGNPYGIAEDIVFSMPCRSK 381 GDWFS+GVYTNGNPYGIAEDIVFSMPCRSK Sbjct: 298 GDWFSTGVYTNGNPYGIAEDIVFSMPCRSK 327
>pdb|7MDH|A Chain A, Structural Basis For Light Acitvation Of A Chloroplast Enzyme. The Structure Of Sorghum Nadp-Malate Dehydrogenase In Its Oxidized Form Length = 375 Back     alignment and structure
>pdb|1WZE|A Chain A, Structural Basis For Alteration Of Cofactor Specificity Of Malate Dehydrogenase From Thermus Flavus Length = 327 Back     alignment and structure
>pdb|1IZ9|A Chain A, Crystal Structure Of Malate Dehydrogenase From Thermus Thermophilus Hb8 Length = 327 Back     alignment and structure
>pdb|1BMD|A Chain A, Determinants Of Protein Thermostability Observed In The 1.9 Angstroms Crystal Structure Of Malate Dehydrogenase From The Thermophilic Bacterium Thermus Flavus Length = 327 Back     alignment and structure
>pdb|1BDM|A Chain A, The Structure At 1.8 Angstroms Resolution Of A Single Site Mutant (T189i) Of Malate Dehydrogenase From Thermus Flavus With Increased Enzymatic Activity Length = 327 Back     alignment and structure
>pdb|1B8P|A Chain A, Malate Dehydrogenase From Aquaspirillum Arcticum Length = 329 Back     alignment and structure
>pdb|4MDH|A Chain A, Refined Crystal Structure Of Cytoplasmic Malate Dehydrogenase At 2.5-Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|5MDH|A Chain A, Crystal Structure Of Ternary Complex Of Porcine Cytoplasmic Malate Dehydrogenase Alpha-Ketomalonate And Tnad At 2.4 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|3D5T|A Chain A, Crystal Structure Of Malate Dehydrogenase From Burkholderia Pseudomallei Length = 331 Back     alignment and structure
>pdb|4H7P|A Chain A, Crystal Structure Of A Putative Cytosolic Malate Dehydrogenase From Leishmania Major Friedlin Length = 345 Back     alignment and structure
>pdb|3FI9|A Chain A, Crystal Structure Of Malate Dehydrogenase From Porphyromonas Gingivalis Length = 343 Back     alignment and structure
>pdb|1HYG|A Chain A, Crystal Structure Of Mj0490 Gene Product, The Family Of LactateMALATE DEHYDROGENASE Length = 313 Back     alignment and structure
>pdb|1A5Z|A Chain A, Lactate Dehydrogenase From Thermotoga Maritima (tmldh) Length = 319 Back     alignment and structure
>pdb|2HJR|A Chain A, Crystal Structure Of Cryptosporidium Parvum Malate Dehydrogenase Length = 328 Back     alignment and structure
>pdb|1GV0|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|2D4A|A Chain A, Structure Of The Malate Dehydrogenase From Aeropyrum Pernix Length = 308 Back     alignment and structure
>pdb|3NEP|X Chain X, 1.55a Resolution Structure Of Malate Dehydrogenase From Salinibacter Ruber Length = 314 Back     alignment and structure
>pdb|1GUY|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 309 Back     alignment and structure
>pdb|1UXH|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 Back     alignment and structure
>pdb|1UR5|A Chain A, Stabilization Of A Tetrameric Malate Dehydrogenase By Introduction Of A Disulfide Bridge At The DimerDIMER Interface Length = 309 Back     alignment and structure
>pdb|1UXI|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 Back     alignment and structure
>pdb|3GVH|A Chain A, Crystal Structure Of LactateMALATE DEHYDROGENASE FROM Brucella Melitensis Length = 324 Back     alignment and structure
>pdb|1Y6J|A Chain A, L-Lactate Dehydrogenase From Clostridium Thermocellum Cth-1135 Length = 318 Back     alignment and structure
>pdb|1GV1|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|1GUZ|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 Back     alignment and structure
>pdb|3P7M|A Chain A, Structure Of Putative Lactate Dehydrogenase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 321 Back     alignment and structure
>pdb|1SOV|A Chain A, Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Apo Form Length = 328 Back     alignment and structure
>pdb|3CZM|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex With Nad And Oxq Length = 326 Back     alignment and structure
>pdb|4E0B|A Chain A, 2.17 Angstrom Resolution Crystal Structure Of Malate Dehydrogenase From Vibrio Vulnificus Cmcp6 Length = 313 Back     alignment and structure
>pdb|3VKU|A Chain A, Penta Mutant Of Lactobacillus Casei Lactate Dehydrogenase Length = 326 Back     alignment and structure
>pdb|1PZG|A Chain A, T.Gondii Ldh1 Complexed With Apad And Sulfate At 1.6 Angstroms Length = 331 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 1e-158
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 1e-141
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 1e-140
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 1e-137
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 7e-87
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 4e-14
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 3e-13
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 3e-13
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 3e-13
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 4e-13
3tl2_A315 Malate dehydrogenase; center for structural genomi 4e-13
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 1e-12
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 1e-12
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 2e-12
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 9e-12
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 2e-11
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 2e-11
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 3e-11
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 3e-11
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 4e-11
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 7e-11
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 8e-11
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 1e-10
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 1e-10
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 3e-10
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 3e-10
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 4e-10
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 4e-10
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 4e-10
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 6e-10
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 1e-09
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 1e-09
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 1e-09
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 5e-09
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 1e-07
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Length = 375 Back     alignment and structure
 Score =  449 bits (1156), Expect = e-158
 Identities = 272/317 (85%), Positives = 295/317 (93%)

Query: 66  DPKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPD 125
           +  +   DC+GVFC TYDLKAE++TKSWKK+VNIAVSGAAGMI+NHLLFKLA+GEV G D
Sbjct: 2   EAPATRKDCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQD 61

Query: 126 QPIALKLLGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRG 185
           QPIALKLLGSERS QALEGVAMELEDSL+PLLREV IGI+PYE+FED +WALLIGAKPRG
Sbjct: 62  QPIALKLLGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRG 121

Query: 186 PGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFH 245
           PGMERA LLDINGQIFA+QGKALNAVAS+NVKV+VVGNPCNTNALICLKNAP IPAKNFH
Sbjct: 122 PGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALICLKNAPDIPAKNFH 181

Query: 246 ALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHK 305
           ALTRLDENRAKCQLALKAGVFYDKVSN+TIWGNHSTTQVPDFLNA+I+G PVKE+IK  K
Sbjct: 182 ALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKIDGRPVKEVIKRTK 241

Query: 306 WLEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNP 365
           WLEE FT T+QKRGG LI+KWGRSSAASTAVSI DA+KSLVTPTPEGDWFS+GVYT GNP
Sbjct: 242 WLEEEFTITVQKRGGALIQKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNP 301

Query: 366 YGIAEDIVFSMPCRSKK 382
           YGIAEDIVFSMPCRSK 
Sbjct: 302 YGIAEDIVFSMPCRSKG 318


>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Length = 327 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Length = 343 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query398
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 100.0
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 100.0
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 100.0
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 100.0
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 100.0
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 100.0
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 100.0
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 100.0
3tl2_A315 Malate dehydrogenase; center for structural genomi 100.0
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 100.0
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 100.0
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 100.0
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 100.0
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 100.0
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 100.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 100.0
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 100.0
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 100.0
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 100.0
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 100.0
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 100.0
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 100.0
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 100.0
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 100.0
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 100.0
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 100.0
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 100.0
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 100.0
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 100.0
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 100.0
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 100.0
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 100.0
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 100.0
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 100.0
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 100.0
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 100.0
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 100.0
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 100.0
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 100.0
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 100.0
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 100.0
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 100.0
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 100.0
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 100.0
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 98.49
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.33
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 98.25
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 98.23
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.17
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 98.17
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 98.17
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 98.15
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.1
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.06
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 98.05
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.01
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.95
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.94
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 97.92
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.87
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.86
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.8
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 97.8
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.79
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.78
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.78
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.78
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.77
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.75
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.75
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.75
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.72
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.72
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.7
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.67
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.66
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.66
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.65
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.62
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.58
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.58
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.58
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.58
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.57
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 97.57
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.56
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.55
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.53
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 97.53
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.52
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.51
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.5
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 97.5
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.48
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.48
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.46
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.45
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.45
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.44
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.42
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.42
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.4
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 97.4
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.39
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.39
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.38
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 97.36
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.36
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.35
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 97.33
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.32
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 97.32
4ezb_A317 Uncharacterized conserved protein; structural geno 97.32
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.3
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.3
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.29
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.29
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 97.29
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.28
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.27
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 97.27
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.26
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.25
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.24
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.23
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.22
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.21
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 97.2
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 97.19
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.19
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.17
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.16
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.16
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.15
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 97.13
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.12
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 97.11
3slg_A372 PBGP3 protein; structural genomics, seattle struct 97.11
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.1
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 97.09
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.05
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.05
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.02
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 97.01
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.99
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 96.98
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 96.97
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.96
1xq6_A253 Unknown protein; structural genomics, protein stru 96.94
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 96.94
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.93
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.92
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.9
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.9
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.9
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 96.89
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.89
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.88
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.87
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.87
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.87
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.86
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.86
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 96.85
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 96.83
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.82
3tjr_A301 Short chain dehydrogenase; structural genomics, se 96.81
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.81
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.8
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.8
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.8
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.8
1nff_A260 Putative oxidoreductase RV2002; directed evolution 96.79
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.79
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 96.79
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.79
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.79
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 96.79
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.78
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.76
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.76
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.76
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 96.76
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.75
4f6c_A427 AUSA reductase domain protein; thioester reductase 96.75
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.75
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.75
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.75
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.74
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.74
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 96.74
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 96.74
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.73
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 96.73
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.72
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.71
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.71
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.7
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 96.7
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.7
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.69
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.69
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.69
3cxt_A291 Dehydrogenase with different specificities; rossma 96.69
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 96.68
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.68
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.68
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.68
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.68
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.67
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.67
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 96.66
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.66
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 96.66
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.65
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.65
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.65
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.64
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.64
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.64
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 96.64
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.63
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 96.63
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.62
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.62
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.62
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.61
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 96.61
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.6
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.6
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 96.6
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 96.59
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.59
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.57
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.56
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.56
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.55
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.55
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 96.54
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.54
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.53
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.53
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 96.52
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.52
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.52
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.52
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.51
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.51
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.51
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 96.5
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 96.5
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 96.49
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.49
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 96.49
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 96.48
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.48
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.47
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.47
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.45
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.45
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 96.44
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.44
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.44
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.44
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.43
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.43
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 96.42
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.42
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.42
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.41
3rih_A293 Short chain dehydrogenase or reductase; structural 96.41
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 96.4
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.4
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.4
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.39
4eso_A255 Putative oxidoreductase; NADP, structural genomics 96.38
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.38
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.38
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.37
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 96.37
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 96.37
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 96.37
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.36
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.36
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.35
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.35
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.35
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.34
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.31
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 96.3
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.29
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.28
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 96.28
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.28
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.27
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.27
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.27
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 96.26
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 96.26
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 96.26
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.26
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 96.25
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.25
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.24
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.22
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 96.22
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.21
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 96.21
1xhl_A297 Short-chain dehydrogenase/reductase family member 96.21
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.21
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.2
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.2
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.2
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 96.18
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.18
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 96.17
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 96.16
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.16
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.16
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.15
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.15
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.15
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 96.15
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.14
4f6l_B508 AUSA reductase domain protein; thioester reductase 96.14
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.13
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 96.13
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 96.11
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 96.11
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.11
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.11
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 96.1
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.09
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.08
1spx_A278 Short-chain reductase family member (5L265); paral 96.08
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 96.08
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.08
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 96.07
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 96.07
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 96.07
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 96.06
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.05
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 96.05
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.04
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.04
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.03
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 96.03
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.02
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.0
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.99
1xkq_A280 Short-chain reductase family member (5D234); parra 95.99
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 95.99
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 95.99
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 95.97
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 95.97
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 95.96
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.95
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.95
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 95.94
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.93
3edm_A259 Short chain dehydrogenase; structural genomics, ox 95.93
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 95.93
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 95.91
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 95.9
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 95.89
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 95.88
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 95.85
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 95.85
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 95.83
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 95.81
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 95.76
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 95.76
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.75
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.74
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 95.74
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.74
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 95.74
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 95.74
3e03_A274 Short chain dehydrogenase; structural genomics, PS 95.72
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.72
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 95.71
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.68
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 95.65
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.63
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.6
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 95.57
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 95.57
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 95.55
3gem_A260 Short chain dehydrogenase; structural genomics, AP 95.54
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 95.52
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 95.51
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.5
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 95.5
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.49
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 95.48
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 95.47
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 94.45
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 95.46
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.46
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 95.44
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.41
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 95.41
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 95.4
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 95.39
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 95.38
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 95.37
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 95.35
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 95.32
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.28
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 95.26
3euw_A344 MYO-inositol dehydrogenase; protein structure init 95.25
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.23
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 95.19
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 95.19
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 95.16
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.14
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 95.14
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 95.13
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 95.13
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.12
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 95.11
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.1
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 95.09
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 95.07
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 95.07
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 95.04
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 95.04
3qlj_A322 Short chain dehydrogenase; structural genomics, se 95.03
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 95.03
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.03
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 95.0
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.0
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.97
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 94.97
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 94.96
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 94.89
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 94.85
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 94.81
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 94.79
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.79
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 94.78
1ooe_A236 Dihydropteridine reductase; structural genomics, P 94.76
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 94.74
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 94.74
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.72
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 94.71
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 94.69
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 94.68
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 94.62
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 94.57
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.54
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 94.46
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 94.44
4had_A350 Probable oxidoreductase protein; structural genomi 94.43
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 94.43
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 94.4
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 94.36
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 94.3
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 94.26
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.24
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.22
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 94.21
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 94.16
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 94.12
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.06
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 94.04
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 93.94
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 93.9
2d59_A144 Hypothetical protein PH1109; COA binding, structur 93.9
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.83
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 93.79
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 93.73
1ydw_A362 AX110P-like protein; structural genomics, protein 93.67
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 93.67
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 93.66
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 93.66
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 93.63
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 93.62
1iuk_A140 Hypothetical protein TT1466; structural genomics, 93.6
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 93.57
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 93.55
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 93.53
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 93.51
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 93.5
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 93.5
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.47
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.42
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 93.39
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 93.39
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 93.37
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 93.31
4g65_A 461 TRK system potassium uptake protein TRKA; structur 93.26
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 93.17
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 93.15
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.12
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 93.07
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 92.98
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 92.93
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
Probab=100.00  E-value=4.4e-81  Score=625.34  Aligned_cols=329  Identities=83%  Similarity=1.303  Sum_probs=297.1

Q ss_pred             CCCCCCCcceeeEEeeccchhHhhhhccCCCEEEEEcCCCchHHHHHHHHHhcCcCCCCCceEEEecccccchhhHHHHH
Q 015897           67 PKSKTNDCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVA  146 (398)
Q Consensus        67 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KI~IiGA~G~vG~~la~~L~~~~~~~~~~~i~L~L~d~D~~~~~l~g~a  146 (398)
                      ++.+..+||||||++||+++|.+.++|++++||+|+||+|+||+++++.|+.+++++++++|.|+++|+|.++++++|.+
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~KV~ViGAaG~VG~~la~~l~~~~l~~e~~~l~L~d~d~~~~~~~~~G~a   82 (375)
T 7mdh_A            3 APATRKDCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALKLLGSERSFQALEGVA   82 (375)
T ss_dssp             ------CCCGGGCC------------CCCCEEEEEETTTSHHHHHHHHHHHHTTTTCTTCCEEEEEECCGGGHHHHHHHH
T ss_pred             CccccccceeEEEEEeechhhhhHhhCCCCCEEEEECCCChHHHHHHHHHHcCCcCCCCceeEEEecCccchhhhhHHHH
Confidence            34456899999999999999999999999999999998899999999999999999988889999999999999999999


Q ss_pred             HHHhhhcCCCcceEEEecCcccccCCCcEEEEeCCCCCCCCCchhhhHHHHHHHHHHHHHHHHHhcCCCeEEEEECCCch
Q 015897          147 MELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCN  226 (398)
Q Consensus       147 ~DL~d~~~~~~~~v~i~~~~~eal~dADiViitag~~rk~g~~r~dll~~N~~i~~~i~~~i~~~a~p~a~vIvvtNP~d  226 (398)
                      |||+|+.++++.++.+++++|++++|||+||+++|.||+|||+|+|++.+|++|++++++.|.++++|++++|++|||+|
T Consensus        83 mDL~h~~~p~~~~v~i~~~~y~~~~daDvVVitag~prkpG~tR~DLl~~N~~I~k~i~~~i~~~a~p~~ivlVvsNPvD  162 (375)
T 7mdh_A           83 MELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCN  162 (375)
T ss_dssp             HHHHTTTCTTEEEEEEESCHHHHTTTCSEEEECCCCCCCTTCCHHHHHHHHHHHHHHHHHHHHHHSCTTCEEEECSSSHH
T ss_pred             HhHHhhhhhhcCCcEEecCCHHHhCCCCEEEEcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEecCchh
Confidence            99999987787788889999999999999999999999999999999999999999999999998679999999999999


Q ss_pred             hHHHHHHHHCCCCCCceEEecCchhHHHHHHHHHHHcCcCcCceeeEEEEeccCCCccccccceEEcCccchhhcccccc
Q 015897          227 TNALICLKNAPSIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVKEIIKDHKW  306 (398)
Q Consensus       227 ~~t~~~~k~~~~~~~kvig~gt~lDs~Rl~~~lA~~lgv~~~~V~~v~V~G~Hg~s~vp~~S~a~I~G~p~~~~i~~~~~  306 (398)
                      ++|++++|+++++|+|+||+||.||++|++++||+++|++|++|++++||||||++|||+||+++|+|+|+.+++.+++|
T Consensus       163 ~~t~ia~k~sg~~~~rvig~gT~LDsaR~r~~lA~~lgv~~~~V~~v~V~GeHgdt~vp~~S~a~V~G~pl~~~~~~~~~  242 (375)
T 7mdh_A          163 TNALICLKNAPDIPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKIDGRPVKEVIKRTKW  242 (375)
T ss_dssp             HHHHHHHHTCTTSCGGGEEECCHHHHHHHHHHHHHHTTSCGGGEECCEEEBCSSTTCEEECSSCEETTEEGGGTCCCHHH
T ss_pred             HHHHHHHHHcCCCCccEEEeeehHHHHHHHHHHHHHhCcChhhcccceEEecCCCceeeeeecccCCCEEhhHhccchhh
Confidence            99999999998888899999999999999999999999999999987999999999999999999999999999887778


Q ss_pred             cHHHHHHHHHhhhHHHHHhcCCCcHHHHHHHHHHHHHHhhcCCCCCcEEEEEEEeCCccCCCCCceEEEEeEEEcCCCce
Q 015897          307 LEEGFTETIQKRGGLLIKKWGRSSAASTAVSIVDAMKSLVTPTPEGDWFSSGVYTNGNPYGIAEDIVFSMPCRSKKVTSV  386 (398)
Q Consensus       307 ~~~el~~~v~~~~~~ii~~~G~t~~~s~A~~I~~aI~~~~~~~~~~~i~~~sv~~~G~~ygip~dv~~svP~~ig~~Gv~  386 (398)
                      ..++|.++++++|++|++.||.++|+++|.+++++|++|+.|+|+++|+|+|++++|++||+|+|+|||+||++|++|+ 
T Consensus       243 ~~~~i~~~v~~~g~eII~~kG~ts~a~aa~~i~~~i~~~l~g~d~~~v~~vs~~~~G~~YGi~~dv~~s~P~vlg~~Gv-  321 (375)
T 7mdh_A          243 LEEEFTITVQKRGGALIQKWGRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYTTGNPYGIAEDIVFSMPCRSKGDGD-  321 (375)
T ss_dssp             HHHHHHHHHHTHHHHHHHHTSSCCHHHHHHHHHHHHHHHHSCCCTTCCEEEEEECTTCSSCCCSSSEEEEEEECCSSSC-
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHHHhcCCCCCeEEEEEEEeCCccCCCCCceEEEEEEEEcCCee-
Confidence            8889999999999999999999999999999999999999877899999999999995599999999999999999999 


Q ss_pred             eeEeec-cCCCC
Q 015897          387 CREMVI-MNLSR  397 (398)
Q Consensus       387 ~~~i~~-l~L~~  397 (398)
                       +++++ ++|++
T Consensus       322 -~~iv~~l~L~~  332 (375)
T 7mdh_A          322 -YELATDVSNDD  332 (375)
T ss_dssp             -CEECCCCCCCH
T ss_pred             -EEecCCCCCCH
Confidence             88985 99875



>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 398
d7mdha1175 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( 6e-68
d1y7ta1154 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th 5e-43
d5mdha1154 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s 2e-41
d7mdha2188 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu 1e-39
d5mdha2179 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S 4e-32
d1y7ta2173 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu 3e-29
d2cmda1145 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichi 1e-21
d1b8pa2171 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp 4e-20
d1ldma2169 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi 1e-18
d1mlda1144 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s 3e-18
d1mlda2169 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S 1e-17
d1hyea1145 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge 3e-17
d2ldxa2172 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse 5e-17
d2cmda2167 d.162.1.1 (A:146-312) Malate dehydrogenase {Escher 2e-16
d1guza2163 d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro 2e-16
d1llda2170 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid 2e-16
d1guza1142 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium 6e-16
d1i0za2172 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human 2e-15
d1o6za1142 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon 2e-15
d1uxja2164 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro 2e-14
d1t2da2165 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar 7e-14
d1ez4a2171 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto 2e-13
d1hyea2168 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd 2e-13
d1a5za2172 d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm 2e-13
d1ldna2168 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil 3e-13
d1y6ja2169 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost 3e-13
d1hyha2163 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy 3e-12
d1llca2172 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto 6e-12
d1pzga2174 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop 2e-11
d1ojua1142 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon 7e-11
d1hyha1146 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydro 8e-11
d1a5za1140 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto 2e-10
d1llda1143 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac 2e-10
d1ldna1148 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus 4e-10
d1o6za2161 d.162.1.1 (A:163-330) Malate dehydrogenase {Archae 4e-10
d1i0za1160 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho 2e-09
d2ldxa1159 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu 8e-08
d1ez4a1146 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac 9e-08
d1uxja1142 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflex 9e-08
d1y6ja1142 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi 6e-06
d1pzga1154 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplas 3e-04
d1u8xx1167 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase 8e-04
d1up7a1162 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Ther 0.004
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: LDH N-terminal domain-like
domain: Malate dehydrogenase
species: Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]
 Score =  210 bits (536), Expect = 6e-68
 Identities = 154/175 (88%), Positives = 167/175 (95%)

Query: 73  DCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKL 132
           DC+GVFC TYDLKAE++TKSWKK+VNIAVSGAAGMI+NHLLFKLA+GEV G DQPIALKL
Sbjct: 1   DCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALKL 60

Query: 133 LGSERSLQALEGVAMELEDSLFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAG 192
           LGSERS QALEGVAMELEDSL+PLLREV IGI+PYE+FED +WALLIGAKPRGPGMERA 
Sbjct: 61  LGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAA 120

Query: 193 LLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALICLKNAPSIPAKNFHAL 247
           LLDINGQIFA+QGKALNAVAS+NVKV+VVGNPCNTNALICLKNAP IPAKNFHAL
Sbjct: 121 LLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALICLKNAPDIPAKNFHAL 175


>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 Back     information, alignment and structure
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 142 Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query398
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 100.0
d7mdha2188 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 100.0
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 100.0
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 100.0
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 100.0
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 100.0
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 100.0
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 100.0
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 99.98
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 99.98
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 99.98
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 99.98
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 99.97
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 99.97
d5mdha2179 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.97
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 99.97
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.97
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.97
d1i0za2172 Lactate dehydrogenase {Human (Homo sapiens), heart 99.97
d1llda2170 Lactate dehydrogenase {Bifidobacterium longum, str 99.96
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 99.96
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 99.96
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.96
d1y7ta2173 Malate dehydrogenase {Thermus thermophilus [TaxId: 99.96
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 99.96
d1hyea2168 MJ0490, lactate/malate dehydrogenase {Archaeon Met 99.96
d1y6ja2169 Lactate dehydrogenase {Clostridium thermocellum [T 99.96
d1b8pa2171 Malate dehydrogenase {Aquaspirillum arcticum [TaxI 99.96
d1guza2163 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 99.96
d1ojua2152 Lactate dehydrogenase {Archaeon Archaeoglobus fulg 99.96
d1ldma2169 Lactate dehydrogenase {Dogfish (Squalus acanthias) 99.96
d1a5za2172 Lactate dehydrogenase {Thermotoga maritima [TaxId: 99.96
d2ldxa2172 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 99.96
d1hyha2163 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 99.95
d1pzga2174 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 99.95
d1uxja2164 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 99.95
d1ez4a2171 Lactate dehydrogenase {Lactobacillus pentosus [Tax 99.95
d1t2da2165 Lactate dehydrogenase {Malaria parasite (Plasmodiu 99.95
d1ldna2168 Lactate dehydrogenase {Bacillus stearothermophilus 99.95
d1llca2172 Lactate dehydrogenase {Lactobacillus casei [TaxId: 99.94
d1o6za2161 Malate dehydrogenase {Archaeon Haloarcula marismor 99.93
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 99.91
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 99.91
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 99.89
d1mlda2169 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 99.89
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 99.89
d2cmda2167 Malate dehydrogenase {Escherichia coli [TaxId: 562 99.85
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 99.41
d1up7a2253 6-phospho-beta-glucosidase {Thermotoga maritima [T 99.17
d1s6ya2270 6-phospho-beta-glucosidase {Bacillus stearothermop 98.97
d1u8xx2276 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 98.87
d1obba2308 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.82
d1vjta2278 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.72
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 98.7
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 98.56
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.36
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.21
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 98.06
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.05
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.0
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.87
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.78
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.77
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.58
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.58
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.56
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.45
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.35
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.3
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.23
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 97.22
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.15
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.07
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 97.01
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.94
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.83
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.82
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.82
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.8
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.78
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.77
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.76
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 96.75
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.73
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.72
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.66
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.65
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.62
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.58
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.57
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.57
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 96.55
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.5
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.5
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.49
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.49
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.47
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.47
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.46
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.44
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.44
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.41
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.4
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 96.39
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.36
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.35
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.29
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.28
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.27
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.22
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.22
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.21
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.19
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 96.13
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.07
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.03
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 95.99
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 95.98
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 95.91
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 95.85
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.84
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 95.82
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 95.82
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 95.8
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.8
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.76
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.76
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.69
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 95.65
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.58
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.55
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 95.54
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.52
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.44
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 95.43
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.39
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 95.39
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 95.39
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.31
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.26
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.23
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 95.19
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.12
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.11
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 95.08
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.97
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 94.93
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 94.9
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.85
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 94.76
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 94.74
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.72
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 94.65
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.56
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 94.5
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.47
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 94.1
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 93.95
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 93.94
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 93.94
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 93.85
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.82
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 93.77
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 93.75
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.7
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.63
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 93.61
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 93.54
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 93.52
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 93.48
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 93.44
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 93.38
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 93.37
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 93.36
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 93.18
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.16
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.87
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.85
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.84
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.84
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 92.62
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 92.55
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 92.47
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 92.32
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.3
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.02
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.92
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.88
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 91.82
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 91.8
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.79
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 91.77
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.6
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.59
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 91.57
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 91.41
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 91.4
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 90.84
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 90.83
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.82
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 90.81
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 90.79
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.75
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 90.7
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 90.63
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 90.6
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.5
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.3
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.24
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 89.8
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 89.77
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.76
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 89.61
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.42
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.02
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.97
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.53
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.48
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 88.46
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 88.28
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.96
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 87.81
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 87.64
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 87.6
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 87.59
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.29
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 87.18
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.0
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 86.96
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 86.9
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 86.77
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 86.52
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.91
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 85.85
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 85.75
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 85.7
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 85.51
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 85.29
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 84.73
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 84.49
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 84.4
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 84.34
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 84.32
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 84.28
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 84.21
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.9
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 83.42
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 83.39
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 83.18
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 82.85
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 82.82
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 82.58
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.2
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 81.84
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 81.62
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.38
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 80.67
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 80.64
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 80.35
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 80.07
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: LDH N-terminal domain-like
domain: Malate dehydrogenase
species: Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]
Probab=100.00  E-value=1.3e-41  Score=305.65  Aligned_cols=174  Identities=88%  Similarity=1.391  Sum_probs=153.5

Q ss_pred             CcceeeEEeeccchhHhhhhccCCCEEEEEcCCCchHHHHHHHHHhcCcCCCCCceEEEecccccchhhHHHHHHHHhhh
Q 015897           73 DCYGVFCLTYDLKAEEETKSWKKMVNIAVSGAAGMIANHLLFKLAAGEVLGPDQPIALKLLGSERSLQALEGVAMELEDS  152 (398)
Q Consensus        73 ~~~~~~~~~~~~~~~~~~~~~~~~~KI~IiGA~G~vG~~la~~L~~~~~~~~~~~i~L~L~d~D~~~~~l~g~a~DL~d~  152 (398)
                      |||+|||.+|++..|++.++++++.||+|+||+|+||+++++.|++++++++++++.|+|+|++.+.+.++|.++|++|+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~k~~~kV~I~GA~G~Ig~~l~~~La~g~v~g~~~~i~L~L~di~~~~~~l~g~~mdl~d~   80 (175)
T d7mdha1           1 DCFGVFCTTYDLKAEDKTKSWKKLVNIAVSGAAGMISNHLLFKLASGEVFGQDQPIALKLLGSERSFQALEGVAMELEDS   80 (175)
T ss_dssp             CCCGGGCC------------CCCCEEEEEETTTSHHHHHHHHHHHHTTTTCTTCCEEEEEECCGGGHHHHHHHHHHHHTT
T ss_pred             CceEeeecccccccchhhhccCCCcEEEEECCCcHHHHHHHHHHHcCcccCCCceEEEEEecCccccchhcchhhhhccc
Confidence            79999999999999999999999999999999999999999999999999998899999999999999999999999999


Q ss_pred             cCCCcceEEEecCcccccCCCcEEEEeCCCCCCCCCchhhhHHHHHHHHHHHHHHHHHhcCCCeEEEEECCCchhHHHHH
Q 015897          153 LFPLLREVKIGINPYELFEDAEWALLIGAKPRGPGMERAGLLDINGQIFAEQGKALNAVASRNVKVIVVGNPCNTNALIC  232 (398)
Q Consensus       153 ~~~~~~~v~i~~~~~eal~dADiViitag~~rk~g~~r~dll~~N~~i~~~i~~~i~~~a~p~a~vIvvtNP~d~~t~~~  232 (398)
                      .++....+.++++++++++|||+||+++|.||+|||+|.|++.+|++|+++++++|+++|.++++|+++|||+|++|+++
T Consensus        81 a~~~~~~~~~~~~~~~~~~~aDvVvi~ag~~rkpg~tR~Dll~~N~~I~k~~~~~i~~~a~~~~~vlvv~NPvd~~t~ia  160 (175)
T d7mdha1          81 LYPLLREVSIGIDPYEVFEDVDWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALIC  160 (175)
T ss_dssp             TCTTEEEEEEESCHHHHTTTCSEEEECCCCCCCTTCCHHHHHHHHHHHHHHHHHHHHHHSCTTCEEEECSSSHHHHHHHH
T ss_pred             ccccccCccccccchhhccCCceEEEeeccCCCCCCcHHHHHHHHHHHHHHHHHHHHhhCCCCcEEEEecCcHHHHHHHH
Confidence            97777788889999999999999999999999999999999999999999999999999756999999999999999999


Q ss_pred             HHHCCCCCCceEEe
Q 015897          233 LKNAPSIPAKNFHA  246 (398)
Q Consensus       233 ~k~~~~~~~kvig~  246 (398)
                      +++++++|+++|.+
T Consensus       161 ~k~a~~ip~~~i~~  174 (175)
T d7mdha1         161 LKNAPDIPAKNFHA  174 (175)
T ss_dssp             HHTCTTSCGGGEEE
T ss_pred             HHHCCCCCHHHEeC
Confidence            99989999966543



>d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Back     information, alignment and structure
>d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Back     information, alignment and structure
>d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjta2 d.162.1.2 (A:192-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure