Citrus Sinensis ID: 015974


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MMDKKKSEDNNISAPSSIFTTLFGGIPNESTVASSLFSDSNPFKRQHRESQSAENESIFNPMNSDSLDSNNSELKKIKKTRQEKPNPDLPDAEGAATKTLSLSNKSTKLIYPRSILGFEPNGTIENEIKKEHSSNVGSESYLNRQKQNSNFSVEGKKRSENKKTKKRKRDDVEKDYVEKKYGVIAKEEEGKKVGVGEKRKKADNETEDMLVHRKEEGFDDEGKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRDNWIE
cccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccHHHHHHHccccccccccccccHHHHHHccccHHHHHHHHHHHccHHHHHHcccccccccccccccccHHHHcccccccccccccccccEEEccccccccHHHHHHHHHHcccEEEEEEEEcccccccccccccEEccccccccccEEEEEEEccHHHHHHHHHccccccccEEEEEccccccccccccccccccccccEEEEccccccccHHHHHHHHHHcccccccEEEEEEEccccccccccEEEEEEcccccccc
ccccccccccccccccHHHHHHHccccccccccHHccccccccccccccccccccccccccccccccccccHHHHHHHcccHccccccccccHccHcEEEccccccccccccccccccccccccccccccccHcHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEEccccccccccEEEEEEEccccccccEEEEEEccHHHHHHHHHHcccEEcccEEEEccccccccccccccccccccccEEEEccccccccHHHHHHHHHHcccccccEEEEEEEEccccccccEEEEEEEccHHHHcc
mmdkkksednnisapssifttlfggipnestvasslfsdsnpfkrqhresqsaenesifnpmnsdsldsnnSELKKIKKTrqekpnpdlpdaegaatktlslsnkstkliyprsilgfepngtieneikkehssnvgsesylnrqkqnsnfsvegkkrsenkktkkrkrddVEKDYVEKKYGVIakeeegkkvgvgekrkkadneTEDMLVHrkeegfddegKLLRTIFVgnlplkvkKKTLIKEFIKfgeidsvrirsvpiidtkiprkGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGgnhirldracpprkklkgedaplydikktvfvgnlpfdvkdEEIYQLFCGLNDLESSVEAVRVIrhphmrvgKGIAYVLFKTRDNWIE
mmdkkksednnisapSSIFTTLFGGIPNESTVASSLFSDSNPFKRQHRESQSaenesifnpmnsdsldsnNSELKKIKKtrqekpnpdlpdaegaatktlslsnkstkliyprsiLGFEPNGTIENEIKKEHssnvgsesylnrqkqnsnfsvegkkrsenkktkkrkrddvekdyvekkygviakeeegkkvgvgekrkkadnetedmlvhrkeegfddegkllrtifvgnlplkvkkkTLIKEFikfgeidsvrirsvpiidtkiprkGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLkgedaplydikktvFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRvirhphmrvgkgiayvlfktrdnwie
MMDKKKSEDNNISAPSSIFTTLFGGIPNESTVASSLFSDSNPFKRQHRESQSAENESIFNPMnsdsldsnnsELKKIKKTRQEKPNPDLPDAEGAATKTLSLSNKSTKLIYPRSILGFEPNGTIENEIKKEHSSNVGSESYLNRQKQNSNFSVegkkrsenkktkkrkrddvekdYVEKKYGVIAkeeegkkvgvgekrkkADNETEDMLVHRKEEGFDDEGKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRDNWIE
*****************IFTTLFGGI**********************************************************************************LIYPRSILGF******************************************************************************************************EGKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRDNW**
***********************************************************************************************************************************************************************************************************************************IFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPI**************QINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIR************************VFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRD****
***********ISAPSSIFTTLFGGIPNESTVASSLFSD*****************SIFNPMNSDSLDSNNSELKKIKKTRQEKPNPDLPDAEGAATKTLSLSNKSTKLIYPRSILGFEPNGTIENEIKKEHSSNVGSESYLNR****************************EKDYVEKKYGVIAKEEEGKKVGVGEKRKKADNETEDMLVHRKEEGFDDEGKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRDNWIE
******************************************************************************************************************************************************************************DY***********************************************LLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRAC***************IKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRDNWIE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDKKKSEDNNISAPSSIFTTLFGGIPNESTVASSLFSDSNPFKRQHRESQSAENESIFNPMNSDSLDSNNSELKKIKKTRQEKPNPDLPDAEGAATKTLSLSNKSTKLIYPRSILGFEPNGTIENEIKKEHSSNVGSESYLNRQKQNSNFSVEGKKRSENKKTKKRKRDDVEKDYVEKKYGVIAKEEEGKKVGVGEKRKKADNETEDMLVHRKEEGFDDEGKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRDNWIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query397 2.2.26 [Sep-21-2011]
Q5AHI7 454 Nucleolar protein 12 OS=C N/A no 0.385 0.337 0.394 4e-25
O13741 438 Nucleolar protein 12 OS=S yes no 0.375 0.340 0.372 2e-23
P42696430 RNA-binding protein 34 OS yes no 0.465 0.430 0.360 3e-23
Q8C5L7375 RNA-binding protein 34 OS no no 0.382 0.405 0.385 4e-23
Q5M9F1428 RNA-binding protein 34 OS yes no 0.382 0.355 0.385 5e-23
Q6C2Q7 509 Nucleolar protein 12 OS=Y yes no 0.377 0.294 0.384 2e-22
Q75BJ7 426 Nucleolar protein 12 OS=A yes no 0.382 0.356 0.329 5e-21
Q6BTS9 462 Nucleolar protein 12 OS=D yes no 0.385 0.331 0.374 2e-20
Q6FUS6 396 Nucleolar protein 12 OS=C yes no 0.390 0.391 0.372 2e-18
Q08208 459 Nucleolar protein 12 OS=S yes no 0.392 0.339 0.318 1e-17
>sp|Q5AHI7|NOP12_CANAL Nucleolar protein 12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP12 PE=3 SV=1 Back     alignment and function desciption
 Score =  115 bits (289), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 100/170 (58%), Gaps = 17/170 (10%)

Query: 226 RTIFVGNLPLKVKKKTLIKE-----FIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINE 280
           RT+FVGN+P  V    +I +     F  +G+IDS+R RS+   D  +PRK A  +K +++
Sbjct: 159 RTVFVGNVPADVITSKIIAKNFKNLFKHYGKIDSIRYRSISF-DEHLPRKVAFAKKNLHK 217

Query: 281 NADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVF 340
           + DSV+AYIV+K + ++ AA   N  V   +H+R+D    P        AP  D K+T+F
Sbjct: 218 SRDSVNAYIVYKEKPASIAAKELNATVFEDHHLRVDHVSHP--------AP-KDNKRTIF 268

Query: 341 VGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFK 390
           VGNL F+ K+E +++ F     L+  VE+VR+IR     +GKG A V FK
Sbjct: 269 VGNLDFEEKEETLWKYFNS--KLDQDVESVRIIRDSKTNLGKGFALVQFK 316




Involved in pre-25S rRNA processing.
Candida albicans (strain SC5314 / ATCC MYA-2876) (taxid: 237561)
>sp|O13741|NOP12_SCHPO Nucleolar protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop12 PE=1 SV=1 Back     alignment and function description
>sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 Back     alignment and function description
>sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 Back     alignment and function description
>sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=2 SV=1 Back     alignment and function description
>sp|Q6C2Q7|NOP12_YARLI Nucleolar protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP12 PE=3 SV=1 Back     alignment and function description
>sp|Q75BJ7|NOP12_ASHGO Nucleolar protein 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP12 PE=3 SV=1 Back     alignment and function description
>sp|Q6BTS9|NOP12_DEBHA Nucleolar protein 12 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP12 PE=3 SV=2 Back     alignment and function description
>sp|Q6FUS6|NOP12_CANGA Nucleolar protein 12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP12 PE=3 SV=1 Back     alignment and function description
>sp|Q08208|NOP12_YEAST Nucleolar protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP12 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
224138160487 predicted protein [Populus trichocarpa] 0.808 0.659 0.533 1e-102
224071371491 predicted protein [Populus trichocarpa] 0.808 0.653 0.546 3e-99
255573457 830 RNA binding protein, putative [Ricinus c 0.564 0.269 0.737 7e-92
356529724 519 PREDICTED: nucleolar protein 12-like [Gl 0.869 0.664 0.515 3e-88
225427165 541 PREDICTED: uncharacterized protein LOC10 0.926 0.680 0.527 3e-87
356496350 515 PREDICTED: nucleolar protein 12-like [Gl 0.861 0.664 0.513 9e-85
449462029 559 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.916 0.651 0.475 9e-81
15237960 501 RNA recognition motif-containing protein 0.564 0.447 0.681 3e-80
169219255 566 putative RNA recognition motif-containin 0.899 0.630 0.481 3e-80
21554835 501 unknown [Arabidopsis thaliana] 0.564 0.447 0.676 1e-79
>gi|224138160|ref|XP_002326533.1| predicted protein [Populus trichocarpa] gi|222833855|gb|EEE72332.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 209/392 (53%), Positives = 255/392 (65%), Gaps = 71/392 (18%)

Query: 3   DKKKSEDNNISAPSSIFTTLFGGIPNESTVASSLFSDSNPFKRQHRESQSAENESIFNPM 62
           D   ++++  SA S +F TLF G  +++   SSLFSDSNPFKR+  + +S EN S     
Sbjct: 10  DTSTAQNHTASALSDVFQTLFSGA-DQTASTSSLFSDSNPFKRKPEDPKSNENPST---- 64

Query: 63  NSDSLDSNNSE-LKKIKKTRQEKPNPDLPDAEGAATKTLSLSNKSTKLIYPRSILGFEPN 121
           + D+   N  E  +K+KK + E PN                             LGFEP 
Sbjct: 65  DVDTQKPNFYETTEKLKKVKTENPN-----------------------------LGFEP- 94

Query: 122 GTIENEIKKEHSSNVGSESYLNRQKQNSNFSVEGKKRSENKKTKKRKRDDVEKDYVEKKY 181
                   KE  +  G                           KKRKRDD+E++Y  KKY
Sbjct: 95  --------KEEETLRGR--------------------------KKRKRDDLEREYEAKKY 120

Query: 182 GVIAKEEEGKKVGVGEKRKKADNETEDMLVHRKEEGFDDEGKLLRTIFVGNLPLKVKKKT 241
           G +   EE   V VG KRK  D +  D+LV ++ EGFDDE KLLRT+FVGNLPLKVKKKT
Sbjct: 121 GPVVDNEENASVVVGAKRKNTD-DAADVLVSKESEGFDDESKLLRTVFVGNLPLKVKKKT 179

Query: 242 LIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAAL 301
           LIKEF KFG+++SVRIRSVPI ++KIPRKGAIL K+ N+N DSVHAY+VFK+EQS EA+L
Sbjct: 180 LIKEFSKFGDVESVRIRSVPIAESKIPRKGAILLKKFNDNVDSVHAYVVFKNEQSAEASL 239

Query: 302 AFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLN 361
           + NMAV+GGNHIR+DRACPPRKKLKG DAPLYD K+TVFVGNLPFDVKDEE+YQLF G+ 
Sbjct: 240 SHNMAVVGGNHIRVDRACPPRKKLKGSDAPLYDNKRTVFVGNLPFDVKDEELYQLFTGIK 299

Query: 362 DLESSVEAVRVIRHPHMRVGKGIAYVLFKTRD 393
           DL SS+EAVRVIR PH+ +GKGIAYVLFKTR+
Sbjct: 300 DLASSIEAVRVIRDPHVGLGKGIAYVLFKTRE 331




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224071371|ref|XP_002303427.1| predicted protein [Populus trichocarpa] gi|222840859|gb|EEE78406.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573457|ref|XP_002527654.1| RNA binding protein, putative [Ricinus communis] gi|223532959|gb|EEF34725.1| RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356529724|ref|XP_003533438.1| PREDICTED: nucleolar protein 12-like [Glycine max] Back     alignment and taxonomy information
>gi|225427165|ref|XP_002277589.1| PREDICTED: uncharacterized protein LOC100266124 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356496350|ref|XP_003517031.1| PREDICTED: nucleolar protein 12-like [Glycine max] Back     alignment and taxonomy information
>gi|449462029|ref|XP_004148744.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101206555 [Cucumis sativus] Back     alignment and taxonomy information
>gi|15237960|ref|NP_199496.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|8809667|dbj|BAA97218.1| unnamed protein product [Arabidopsis thaliana] gi|32441262|gb|AAP81806.1| At5g46840 [Arabidopsis thaliana] gi|110736326|dbj|BAF00133.1| hypothetical protein [Arabidopsis thaliana] gi|332008049|gb|AED95432.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|169219255|gb|ACA50448.1| putative RNA recognition motif-containing protein [Cucumis sativus] Back     alignment and taxonomy information
>gi|21554835|gb|AAM63703.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query397
TAIR|locus:2172937 501 AT5G46840 [Arabidopsis thalian 0.473 0.375 0.701 3.2e-77
ZFIN|ZDB-GENE-040718-77 411 rbm34 "RNA binding motif prote 0.445 0.430 0.390 9.4e-27
DICTYBASE|DDB_G0289941481 DDB_G0289941 "Nucleolar protei 0.390 0.322 0.363 3e-25
CGD|CAL0002615 454 orf19.809 [Candida albicans (t 0.385 0.337 0.4 3.5e-24
POMBASE|SPAC16E8.06c 438 nop12 "RNA-binding protein Nop 0.375 0.340 0.377 1e-23
UNIPROTKB|P42696430 RBM34 "RNA-binding protein 34" 0.440 0.406 0.368 7.7e-23
MGI|MGI:1098653375 Rbm34 "RNA binding motif prote 0.410 0.434 0.370 7.8e-23
UNIPROTKB|F1NIM5392 RBM34 "Uncharacterized protein 0.420 0.426 0.367 1e-22
UNIPROTKB|J9NU83344 RBM34 "Uncharacterized protein 0.435 0.502 0.357 3.4e-22
UNIPROTKB|F1RGW8424 RBM34 "Uncharacterized protein 0.428 0.400 0.362 3.4e-22
TAIR|locus:2172937 AT5G46840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 705 (253.2 bits), Expect = 3.2e-77, Sum P(2) = 3.2e-77
 Identities = 134/191 (70%), Positives = 164/191 (85%)

Query:   204 NETEDMLVHRKEEGFDDEGKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPII 263
             +E  D +V +  EGFDDE KLLRT+FVGNLPLKVKKK ++KEF KFGE++SVRIRSVPI+
Sbjct:   151 DEVADTMVSK--EGFDDESKLLRTVFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVPIV 208

Query:   264 DTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRK 323
             D+K  RKGAI+ KQINE A SVHAY+VF++EQS  A+LA NM++I GNH+R+DRACPPRK
Sbjct:   209 DSKRTRKGAIMLKQINEKASSVHAYVVFETEQSAAASLAHNMSLIDGNHVRVDRACPPRK 268

Query:   324 KLKG-EDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGK 382
             K KG +D  LYD K+TVF+GNLPFDVKDEE+YQLF G ++LE+S+EAVRVIR PH+ +GK
Sbjct:   269 KQKGHDDTHLYDPKRTVFMGNLPFDVKDEEVYQLFTGKSNLENSIEAVRVIRDPHLNIGK 328

Query:   383 GIAYVLFKTRD 393
             GIAYVLFKTR+
Sbjct:   329 GIAYVLFKTRE 339


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006312 "mitotic recombination" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
ZFIN|ZDB-GENE-040718-77 rbm34 "RNA binding motif protein 34" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289941 DDB_G0289941 "Nucleolar protein 12" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0002615 orf19.809 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
POMBASE|SPAC16E8.06c nop12 "RNA-binding protein Nop12 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|P42696 RBM34 "RNA-binding protein 34" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1098653 Rbm34 "RNA binding motif protein 34" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIM5 RBM34 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NU83 RBM34 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGW8 RBM34 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 4e-32
cd12669105 cd12669, RRM1_Nop12p_like, RNA recognition motif 1 2e-19
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-19
smart0036073 smart00360, RRM, RNA recognition motif 4e-09
smart0036073 smart00360, RRM, RNA recognition motif 5e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 7e-09
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 9e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 3e-08
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 7e-08
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 4e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 5e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-06
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 9e-06
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 1e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-05
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-05
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 6e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 8e-05
cd12294102 cd12294, RRM_Rrp7A, RNA recognition motif in ribos 8e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-04
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 1e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 3e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 3e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-04
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 4e-04
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 5e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 5e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 7e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 7e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 0.001
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 0.001
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 0.001
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 0.001
cd1250880 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 0.001
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 0.002
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 0.002
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 0.002
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 0.002
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.003
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 0.004
PLN03120 260 PLN03120, PLN03120, nucleic acid binding protein; 0.004
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
 Score =  116 bits (292), Expect = 4e-32
 Identities = 48/91 (52%), Positives = 66/91 (72%)

Query: 226 RTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSV 285
           RT+FVGNLPL  KKK L K F +FG I+SVR RSVP+ + K+P+K A ++K+ ++  D+V
Sbjct: 1   RTVFVGNLPLTTKKKDLKKLFKQFGPIESVRFRSVPVKEKKLPKKVAAIKKKFHDKKDNV 60

Query: 286 HAYIVFKSEQSTEAALAFNMAVIGGNHIRLD 316
           +AY+VFK E+S E AL  N     G+HIR+D
Sbjct: 61  NAYVVFKEEESAEKALKLNGTEFEGHHIRVD 91


This subfamily corresponds to the RRM1 of RBM34, a putative RNA-binding protein containing two RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains). Although the function of RBM34 remains unclear currently, its RRM domains may participate in mRNA processing. RBM34 may act as an mRNA processing-related protein. . Length = 91

>gnl|CDD|241113 cd12669, RRM1_Nop12p_like, RNA recognition motif 1 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240740 cd12294, RRM_Rrp7A, RNA recognition motif in ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240952 cd12508, RRM2_ESRPs_Fusilli, RNA recognition motif 2 in epithelial splicing regulatory protein ESRP1, ESRP2, Drosophila RNA-binding protein Fusilli and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 397
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.94
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.93
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.92
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.92
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.9
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.89
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.88
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 99.87
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.85
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.84
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.84
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.84
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.83
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.83
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.82
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.82
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.82
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.81
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.8
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.76
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.75
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 99.75
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.73
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.73
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.72
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.72
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.72
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 99.71
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.68
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.66
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.59
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.58
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.57
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.57
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.53
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.52
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.48
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.47
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 99.45
PLN03120 260 nucleic acid binding protein; Provisional 99.43
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.41
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.41
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.36
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.34
PLN03121243 nucleic acid binding protein; Provisional 99.33
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.32
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.28
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.28
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.27
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.24
PLN03213 759 repressor of silencing 3; Provisional 99.24
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.24
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.22
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.21
smart0036272 RRM_2 RNA recognition motif. 99.21
KOG0122270 consensus Translation initiation factor 3, subunit 99.2
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.17
KOG0110 725 consensus RNA-binding protein (RRM superfamily) [G 99.16
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.15
smart0036071 RRM RNA recognition motif. 99.15
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 99.15
KOG4207256 consensus Predicted splicing factor, SR protein su 99.11
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.11
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.1
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.08
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.08
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.06
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 99.01
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 98.99
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 98.95
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.95
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 98.9
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.88
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.83
KOG4210285 consensus Nuclear localization sequence binding pr 98.81
KOG0122270 consensus Translation initiation factor 3, subunit 98.8
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.78
KOG0121153 consensus Nuclear cap-binding protein complex, sub 98.76
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.75
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 98.75
smart0036170 RRM_1 RNA recognition motif. 98.75
KOG0126 219 consensus Predicted RNA-binding protein (RRM super 98.71
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.7
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.7
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.67
smart0036272 RRM_2 RNA recognition motif. 98.61
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 98.6
COG0724 306 RNA-binding proteins (RRM domain) [General functio 98.59
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.59
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 98.56
smart0036071 RRM RNA recognition motif. 98.56
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 98.54
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.52
KOG0120 500 consensus Splicing factor U2AF, large subunit (RRM 98.51
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.5
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.49
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.49
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 98.47
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.46
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.44
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.42
KOG4207 256 consensus Predicted splicing factor, SR protein su 98.41
PLN03213 759 repressor of silencing 3; Provisional 98.39
KOG0114124 consensus Predicted RNA-binding protein (RRM super 98.37
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.35
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.34
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 98.31
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.3
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.27
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 98.26
KOG0151 877 consensus Predicted splicing regulator, contains R 98.25
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 98.24
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.23
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.22
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.16
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.11
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.1
KOG4208 214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.02
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 98.01
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.0
smart0036170 RRM_1 RNA recognition motif. 97.76
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.75
KOG0226290 consensus RNA-binding proteins [General function p 97.72
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 97.66
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 97.66
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.65
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.54
KOG0153377 consensus Predicted RNA-binding protein (RRM super 97.46
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 97.42
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 97.42
KOG0226290 consensus RNA-binding proteins [General function p 97.41
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 97.4
PLN03121 243 nucleic acid binding protein; Provisional 97.35
KOG4210285 consensus Nuclear localization sequence binding pr 97.29
PLN03120 260 nucleic acid binding protein; Provisional 97.25
KOG4206 221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 97.25
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 97.19
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.19
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.14
KOG1995 351 consensus Conserved Zn-finger protein [General fun 97.05
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.05
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.01
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 96.99
KOG0533 243 consensus RRM motif-containing protein [RNA proces 96.87
KOG1457284 consensus RNA binding protein (contains RRM repeat 96.85
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 96.77
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 96.76
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.76
KOG1855484 consensus Predicted RNA-binding protein [General f 96.71
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.68
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 96.66
KOG3152278 consensus TBP-binding protein, activator of basal 96.42
KOG1548382 consensus Transcription elongation factor TAT-SF1 96.37
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.26
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 96.22
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.16
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 95.75
KOG0151 877 consensus Predicted splicing regulator, contains R 95.5
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 95.48
KOG4660 549 consensus Protein Mei2, essential for commitment t 95.39
KOG2314 698 consensus Translation initiation factor 3, subunit 95.36
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 95.26
KOG1996378 consensus mRNA splicing factor [RNA processing and 95.2
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.01
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 93.83
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 93.79
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 93.11
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 92.76
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 92.4
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 92.01
KOG2135526 consensus Proteins containing the RNA recognition 91.82
KOG1995 351 consensus Conserved Zn-finger protein [General fun 91.35
PF15023166 DUF4523: Protein of unknown function (DUF4523) 90.77
KOG1855 484 consensus Predicted RNA-binding protein [General f 90.75
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 90.64
KOG2068327 consensus MOT2 transcription factor [Transcription 90.05
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 89.56
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 89.2
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 87.66
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 87.11
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 86.9
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 84.74
KOG2314 698 consensus Translation initiation factor 3, subunit 80.49
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=99.94  E-value=2.4e-26  Score=230.21  Aligned_cols=143  Identities=20%  Similarity=0.334  Sum_probs=128.3

Q ss_pred             ccCEEEEecCCCCCcHHHHHHHhcccCCeeEEEEeeecccCCCCCccchhhhhccccCCCcceEEEEecCHHHHHHHH-H
Q 015974          224 LLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAAL-A  302 (397)
Q Consensus       224 ~~rtVFVgNLp~~~Tee~L~~~Fs~~G~I~~Iri~~~~~~~~~~prk~a~i~~~~~~g~skG~AFV~F~s~e~A~~Al-~  302 (397)
                      ..++|||+|||+++|+++|+++|+.||.|.+|+|+.+.                 .++.++|||||+|.++++|..|| .
T Consensus       106 ~~~~LfVgnLp~~~te~~L~~lF~~~G~V~~v~i~~d~-----------------~tg~srGyaFVeF~~~e~A~~Ai~~  168 (346)
T TIGR01659       106 SGTNLIVNYLPQDMTDRELYALFRTIGPINTCRIMRDY-----------------KTGYSFGYAFVDFGSEADSQRAIKN  168 (346)
T ss_pred             CCcEEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecC-----------------CCCccCcEEEEEEccHHHHHHHHHH
Confidence            46889999999999999999999999999999997754                 34567899999999999999999 6


Q ss_pred             hcCceecceeeEEecCCCCccccCCCCCCccccccceecCCCCccCcHHHHHHHhccCCCCCCCeEEEEEeeCCCCCCCc
Q 015974          303 FNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGK  382 (397)
Q Consensus       303 lng~~l~Gr~I~V~~a~~~~k~~~~~~~~~~~~~~tLfVgNLp~~vteedL~~~F~~f~~~~G~I~~Vri~rd~~tg~~k  382 (397)
                      ||+..|.+++|.|.++.+...         .....+|||+|||..+|+++|+++|+.|    |.|..|+|+++..++.++
T Consensus       169 LnG~~l~gr~i~V~~a~p~~~---------~~~~~~lfV~nLp~~vtee~L~~~F~~f----G~V~~v~i~~d~~tg~~k  235 (346)
T TIGR01659       169 LNGITVRNKRLKVSYARPGGE---------SIKDTNLYVTNLPRTITDDQLDTIFGKY----GQIVQKNILRDKLTGTPR  235 (346)
T ss_pred             cCCCccCCceeeeeccccccc---------ccccceeEEeCCCCcccHHHHHHHHHhc----CCEEEEEEeecCCCCccc
Confidence            999999999999999865321         1134689999999999999999999999    999999999999899999


Q ss_pred             cEEEEEeccccccc
Q 015974          383 GIAYVLFKTRDNWI  396 (397)
Q Consensus       383 GfAFV~F~s~e~A~  396 (397)
                      |||||+|.+.++|+
T Consensus       236 G~aFV~F~~~e~A~  249 (346)
T TIGR01659       236 GVAFVRFNKREEAQ  249 (346)
T ss_pred             eEEEEEECCHHHHH
Confidence            99999999998885



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
1wi8_A104 Solution Structure Of The Rna Binding Domain Of Euk 5e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 7e-04
2j76_E100 Solution Structure And Rna Interactions Of The Rna 7e-04
>pdb|1WI8|A Chain A, Solution Structure Of The Rna Binding Domain Of Eukaryotic Initiation Factor 4b Length = 104 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query: 338 TVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHP-HMRVGKGIAYVLFK 390 T F+GNLP+DV +E I + F GLN + AVR+ R P + KG Y F+ Sbjct: 17 TAFLGNLPYDVTEESIKEFFRGLN-----ISAVRLPREPSNPERLKGFGYAEFE 65
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|2J76|E Chain E, Solution Structure And Rna Interactions Of The Rna Recognition Motif From Eukaryotic Translation Initiation Factor 4b Length = 100 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query397
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-21
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 9e-09
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-18
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-18
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 6e-07
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-04
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-16
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-15
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-15
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-15
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-07
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-15
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-13
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-13
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-13
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 9e-12
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-04
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 6e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 4e-10
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 3e-10
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-04
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 5e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 9e-10
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-09
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 5e-07
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-09
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 8e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-09
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 6e-07
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 6e-09
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 8e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-09
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-08
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-08
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 8e-06
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-08
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-08
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 5e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-08
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 4e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-08
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-07
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 5e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 7e-08
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-04
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-07
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-07
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-07
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-07
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-07
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-05
2div_A99 TRNA selenocysteine associated protein; structural 4e-07
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-07
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 4e-05
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 6e-07
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 7e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-04
2cpj_A99 Non-POU domain-containing octamer-binding protein; 9e-07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 6e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-04
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 4e-05
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-06
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-04
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-06
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-04
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-06
1x5p_A97 Negative elongation factor E; structure genomics, 3e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 5e-05
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-04
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 3e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-05
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-06
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 4e-06
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-06
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 5e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 5e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-04
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 5e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-04
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-06
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 6e-06
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-04
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 6e-06
2la6_A99 RNA-binding protein FUS; structural genomics, nort 6e-06
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-04
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 6e-06
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 7e-06
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 8e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-05
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-05
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-05
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 9e-04
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-05
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-05
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-05
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-05
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-04
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 4e-04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-05
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-05
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-04
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-05
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-04
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-05
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-05
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-05
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-04
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 6e-05
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 6e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 7e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 7e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 7e-04
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 7e-05
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-04
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-04
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-04
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-04
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-04
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-04
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-04
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-04
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-04
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-04
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 7e-04
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-04
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-04
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 4e-04
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-04
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-04
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 4e-04
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-04
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 4e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-04
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 6e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 7e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-04
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 8e-04
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
 Score = 90.4 bits (225), Expect = 1e-21
 Identities = 29/172 (16%), Positives = 69/172 (40%), Gaps = 33/172 (19%)

Query: 226 RTIFVGNLPLKVKKKTLIKEFIKFGEIDSVR-IRSVPIIDTKIPR-KGAILQKQINENAD 283
           R ++VGN+P  + ++ ++  F     +  +      P++  +I + K             
Sbjct: 5   RRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKN------------ 52

Query: 284 SVHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGN 343
              A++ F+S   T  A+AF+  +  G  +++ R    +                +F+G 
Sbjct: 53  --FAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPL---------PGAHKLFIGG 101

Query: 344 LPFDVKDEEIYQLF--CGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRD 393
           LP  + D+++ +L    G       ++A  +++     + KG A+  +   +
Sbjct: 102 LPNYLNDDQVKELLTSFG------PLKAFNLVKDSATGLSKGYAFCEYVDIN 147


>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.96
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.95
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.95
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.95
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.95
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.94
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.94
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.93
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.93
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.93
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.93
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.92
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.92
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.92
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.91
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.9
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.9
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.75
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.71
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.7
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.7
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.7
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.69
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.69
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.68
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.68
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.68
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.68
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.68
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.68
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.67
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.67
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.67
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.67
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.67
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.67
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.67
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.67
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.67
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.67
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.66
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.66
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.66
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.66
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.66
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.66
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.66
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.66
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.66
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.66
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.66
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.66
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.65
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.65
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.65
2div_A99 TRNA selenocysteine associated protein; structural 99.65
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.65
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.65
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.64
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.64
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.64
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.64
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.64
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.64
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.64
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.64
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.64
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.64
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.63
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.63
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.63
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.63
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.63
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.63
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.63
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.63
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.62
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.62
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.62
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.62
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.62
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.62
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.62
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.62
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.62
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.62
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.62
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.62
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.61
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.61
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.61
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.61
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.61
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.61
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.61
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.6
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.6
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.6
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.6
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.6
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.6
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.6
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.6
2dis_A109 Unnamed protein product; structural genomics, RRM 99.6
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.59
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.59
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.59
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.59
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.59
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.59
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.59
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.59
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.59
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.58
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.58
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.58
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.58
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.58
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.58
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.57
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.57
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.57
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.57
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.57
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.57
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.57
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.57
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.57
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.57
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.57
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.57
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.57
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.56
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.56
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.56
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.56
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.56
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.56
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.56
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.55
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.55
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.54
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.54
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.54
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.54
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.54
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.54
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.54
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.54
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.53
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.53
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.3
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.53
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.52
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.52
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.51
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.51
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.51
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.51
1x5p_A97 Negative elongation factor E; structure genomics, 99.5
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.5
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.49
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.49
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.49
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.48
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.47
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.47
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.47
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.47
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.46
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.44
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.44
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.43
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.43
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.43
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.42
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.42
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.42
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.41
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.41
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.39
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.39
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.39
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.37
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.36
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.36
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.34
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.32
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.31
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.31
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.3
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.3
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.29
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.28
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.28
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.27
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.26
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.26
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.25
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.25
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.25
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.25
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.25
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.25
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.24
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.24
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.24
2div_A99 TRNA selenocysteine associated protein; structural 99.24
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.24
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.24
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.23
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.23
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.23
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.23
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.23
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.23
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.23
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.23
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.22
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.22
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.22
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.22
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.21
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.21
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.21
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.21
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.21
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.2
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.2
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.2
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.2
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.2
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.2
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.2
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.2
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.2
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.19
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.19
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.19
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.19
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.19
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.19
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.18
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.18
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.18
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.18
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.17
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.17
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.17
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.17
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.17
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.17
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.17
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.17
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.17
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.17
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.16
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.16
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.15
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.14
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.14
2dis_A109 Unnamed protein product; structural genomics, RRM 99.13
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.13
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.13
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.13
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.12
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.12
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.11
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.11
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.11
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.11
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.11
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.11
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.11
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.1
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.1
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.1
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.09
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.09
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.09
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.09
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.08
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 99.08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.08
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.08
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.06
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.03
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.02
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.02
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.02
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.02
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.02
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.01
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.56
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.99
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.98
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.97
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.96
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.95
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.95
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.95
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.94
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.94
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.93
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.93
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.93
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.92
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.92
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.92
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.91
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.91
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.91
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.9
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.88
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.88
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.85
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.84
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.84
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.84
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.84
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.84
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.84
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.83
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.83
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.83
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.83
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.82
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.82
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.81
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.79
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.76
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.73
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.7
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.67
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.67
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.65
1x5p_A97 Negative elongation factor E; structure genomics, 98.63
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.62
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.61
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.57
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.57
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.53
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.52
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.48
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.41
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.39
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.38
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.22
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.21
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.21
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.16
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.15
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.03
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.93
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.85
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 97.38
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.09
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.89
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.82
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.46
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.38
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 96.25
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 96.03
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.14
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 95.11
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 94.02
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.92
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 93.52
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 93.43
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 93.19
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 91.82
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 85.81
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 84.22
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 81.66
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 80.23
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
Probab=99.96  E-value=4.4e-29  Score=224.86  Aligned_cols=151  Identities=18%  Similarity=0.354  Sum_probs=128.6

Q ss_pred             CCccCEEEEecCCCCCcHHHHHHHhcccCCeeEEEEeeecccCCCCCccchhhhhccccCCCcceEEEEecCHHHHHHHH
Q 015974          222 GKLLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAAL  301 (397)
Q Consensus       222 ~~~~rtVFVgNLp~~~Tee~L~~~Fs~~G~I~~Iri~~~~~~~~~~prk~a~i~~~~~~g~skG~AFV~F~s~e~A~~Al  301 (397)
                      ....++|||+|||+.+|+++|+.+|+.||.|.+|.|+.++                 .+|.++|||||+|.+.++|..||
T Consensus        10 ~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~-----------------~~g~~~g~afV~f~~~~~A~~A~   72 (196)
T 1l3k_A           10 PEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDP-----------------NTKRSRGFGFVTYATVEEVDAAM   72 (196)
T ss_dssp             CGGGGEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECT-----------------TTCCEEEEEEEEESSHHHHHHHH
T ss_pred             CCCCCEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEEcC-----------------CCCCccceEEEEeCCHHHHHHHH
Confidence            3457899999999999999999999999999999997754                 23456799999999999999999


Q ss_pred             HhcCceecceeeEEecCCCCccccCCCCCCccccccceecCCCCccCcHHHHHHHhccCCCCCCCeEEEEEeeCCCCCCC
Q 015974          302 AFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVG  381 (397)
Q Consensus       302 ~lng~~l~Gr~I~V~~a~~~~k~~~~~~~~~~~~~~tLfVgNLp~~vteedL~~~F~~f~~~~G~I~~Vri~rd~~tg~~  381 (397)
                      .+++..|.|+.|.|.++.+.......   ......++|||+|||+.+++++|+++|+.|    |.|..|+|+++..+|.+
T Consensus        73 ~~~~~~~~g~~l~v~~~~~~~~~~~~---~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~----G~i~~v~i~~~~~~g~~  145 (196)
T 1l3k_A           73 NARPHKVDGRVVEPKRAVSREDSQRP---GAHLTVKKIFVGGIKEDTEEHHLRDYFEQY----GKIEVIEIMTDRGSGKK  145 (196)
T ss_dssp             HTCSCEETTEECEEEECCC--------------CCSEEEEECCTTTCCHHHHHHHHTTT----SCEEEEEEEECTTTCCE
T ss_pred             hcCCCEECCEEeeeecccCccccccc---ccCCCcceEEEeCCCCCCCHHHHHHHHhcC----CCeEEEEEeecCCCCCc
Confidence            88999999999999998754322211   123346899999999999999999999999    99999999999989999


Q ss_pred             ccEEEEEeccccccc
Q 015974          382 KGIAYVLFKTRDNWI  396 (397)
Q Consensus       382 kGfAFV~F~s~e~A~  396 (397)
                      +|||||+|.+.++|.
T Consensus       146 ~g~afV~F~~~~~A~  160 (196)
T 1l3k_A          146 RGFAFVTFDDHDSVD  160 (196)
T ss_dssp             EEEEEEEESSHHHHH
T ss_pred             cceEEEEECCHHHHH
Confidence            999999999998874



>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 397
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.001
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-08
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 0.002
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-07
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-07
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 0.003
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-07
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 0.002
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-07
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 5e-07
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 7e-04
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-07
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 8e-06
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-06
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.004
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-06
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-04
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-06
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-06
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 0.001
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-06
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-06
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-04
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 4e-04
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-06
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-05
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-06
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-06
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 9e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-06
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 0.001
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 8e-06
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-04
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.003
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-05
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.002
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-05
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 0.004
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-05
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-05
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 6e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-05
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-04
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-05
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-05
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 0.002
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 5e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 9e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 6e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 4e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 7e-05
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 9e-05
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-04
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-04
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 0.001
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 8e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 4e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.001
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-04
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-04
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 5e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.001
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 7e-04
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 0.003
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 0.001
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.001
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.002
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 0.001
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 0.003
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 0.001
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 0.001
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 0.003
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 0.004
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.2 bits (129), Expect = 3e-09
 Identities = 26/169 (15%), Positives = 59/169 (34%), Gaps = 24/169 (14%)

Query: 225 LRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADS 284
           LR +F+G L  +   ++L   F ++G +    +                  +  N     
Sbjct: 6   LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVV-----------------MRDPNTKRSR 48

Query: 285 VHAYIVFKSEQSTEAALAFNMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNL 344
              ++ + + +  +AA+      + G  +   RA     +   +    +   K +FVG +
Sbjct: 49  GFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRA---VSREDSQRPGAHLTVKKIFVGGI 105

Query: 345 PFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKGIAYVLFKTRD 393
             D ++  +   F         +E + ++        +G A+V F   D
Sbjct: 106 KEDTEEHHLRDYFEQ----YGKIEVIEIMTDRGSGKKRGFAFVTFDDHD 150


>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query397
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.95
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.76
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.75
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.75
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.74
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.74
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.73
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.73
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.73
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.73
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.73
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.72
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.72
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.72
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.71
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.71
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.71
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.7
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.7
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.7
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.7
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.7
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.69
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.69
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.69
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.69
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.69
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.68
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.68
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.67
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.66
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.66
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.65
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.64
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.64
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.63
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.63
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.63
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.63
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.63
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.62
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.62
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.62
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.61
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.61
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.6
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.6
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.6
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.6
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.59
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.59
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.59
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.58
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.57
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.57
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.56
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.55
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.55
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.55
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.54
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.52
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.51
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.49
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.49
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.43
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.39
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.39
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.39
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.38
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.38
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.36
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.36
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.35
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.35
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.35
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.34
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.34
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.34
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.33
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.33
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.33
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.32
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.31
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.3
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.3
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.3
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.3
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.29
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.27
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.27
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.27
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.26
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.25
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.25
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.24
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.24
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.23
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.22
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.21
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.21
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.2
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.2
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.2
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.18
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.18
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.15
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.15
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.14
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.14
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.14
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.12
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.12
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.1
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.08
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.06
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.06
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.06
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.06
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.06
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.05
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.05
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.05
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.04
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.02
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.01
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.01
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.0
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.99
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.97
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.97
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.97
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.94
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.94
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.93
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.93
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.91
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.91
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.88
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.87
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.85
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.82
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.77
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.76
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.74
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.73
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.68
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.62
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.37
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.34
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.29
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.81
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 97.74
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.79
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.2
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.17
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 94.15
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.02
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2e-27  Score=211.58  Aligned_cols=149  Identities=18%  Similarity=0.360  Sum_probs=129.5

Q ss_pred             ccCEEEEecCCCCCcHHHHHHHhcccCCeeEEEEeeecccCCCCCccchhhhhccccCCCcceEEEEecCHHHHHHHHHh
Q 015974          224 LLRTIFVGNLPLKVKKKTLIKEFIKFGEIDSVRIRSVPIIDTKIPRKGAILQKQINENADSVHAYIVFKSEQSTEAALAF  303 (397)
Q Consensus       224 ~~rtVFVgNLp~~~Tee~L~~~Fs~~G~I~~Iri~~~~~~~~~~prk~a~i~~~~~~g~skG~AFV~F~s~e~A~~Al~l  303 (397)
                      ..|+|||||||+.+|+++|+++|++||.|.+|.+++++                 .++.++|||||+|.+.++|..|+.+
T Consensus         5 ~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~-----------------~~~~~~g~afv~f~~~~~a~~a~~~   67 (183)
T d1u1qa_           5 QLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDP-----------------NTKRSRGFGFVTYATVEEVDAAMNA   67 (183)
T ss_dssp             HHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECT-----------------TTCCEEEEEEEEESSHHHHHHHHHT
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecc-----------------cCCCccCceecccCCHHHHHHHHHh
Confidence            35899999999999999999999999999999987654                 2445679999999999999999998


Q ss_pred             cCceecceeeEEecCCCCccccCCCCCCccccccceecCCCCccCcHHHHHHHhccCCCCCCCeEEEEEeeCCCCCCCcc
Q 015974          304 NMAVIGGNHIRLDRACPPRKKLKGEDAPLYDIKKTVFVGNLPFDVKDEEIYQLFCGLNDLESSVEAVRVIRHPHMRVGKG  383 (397)
Q Consensus       304 ng~~l~Gr~I~V~~a~~~~k~~~~~~~~~~~~~~tLfVgNLp~~vteedL~~~F~~f~~~~G~I~~Vri~rd~~tg~~kG  383 (397)
                      ++..+.++.+.+.+..+.......   ......++|||+|||+.+|+++|+++|+.|    |.|..|.|+.+..+|.++|
T Consensus        68 ~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~i~V~~lp~~~te~~L~~~f~~~----G~v~~~~i~~~~~~~~~~g  140 (183)
T d1u1qa_          68 RPHKVDGRVVEPKRAVSREDSQRP---GAHLTVKKIFVGGIKEDTEEHHLRDYFEQY----GKIEVIEIMTDRGSGKKRG  140 (183)
T ss_dssp             CSCEETTEECEEEECCCTTGGGST---TTTCCCSEEEEECCCTTCCHHHHHHHHGGG----SCEEEEEEEECTTTCCEEE
T ss_pred             cCCcccccchhhhhhhhccccccc---ccccccceeEEccCCCcCCHHHHhhhhccC----CceeeeeeecccccCccce
Confidence            899999999988887654332222   124456899999999999999999999999    9999999999999999999


Q ss_pred             EEEEEeccccccc
Q 015974          384 IAYVLFKTRDNWI  396 (397)
Q Consensus       384 fAFV~F~s~e~A~  396 (397)
                      ||||+|.+.++|.
T Consensus       141 ~~fV~f~~~e~A~  153 (183)
T d1u1qa_         141 FAFVTFDDHDSVD  153 (183)
T ss_dssp             EEEEEESCHHHHH
T ss_pred             eEEEEECCHHHHH
Confidence            9999999998874



>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure