Citrus Sinensis ID: 016114


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQKVQY
cHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHccc
cHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccc
mmsgivdslkddePLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILElnrgtesadlvlplfslgslfikegkavdaESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIkdsnymsldDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITekykgkehpsFVTHLLNLAASYSRSKNFVEAERLLRICLDImtktvgpddqsisfpmlhLGITLYHLNRDKEAEKLVLEALYIREIafgkdslpvgeALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLgrkeekfplKKRLSNLRMKYKQKVQY
mmsgivdslkdDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILelnrgtesADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEkykgkehpSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAfgkdslpvgEALDCLVSIQtrlgeddtklLELLKRVLRIqerefgseseevmLTLKKVVSyldklgrkeekfplkkrlsnlrmkykqkvqy
MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVgrgqegrelleecllITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQKVQY
*************PLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKL**************************
MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKRLSN****Y******
MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQKVQY
MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSGIVDSLKDDEPLLDAILLHMGSMYSTxxxxxxxxxxxxxxxxxxxxxYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQKVQY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query395 2.2.26 [Sep-21-2011]
Q6AZT71300 Nephrocystin-3 OS=Xenopus N/A no 0.815 0.247 0.246 7e-15
A0JM231311 Nephrocystin-3 OS=Xenopus yes no 0.769 0.231 0.238 6e-14
Q7TNH61325 Nephrocystin-3 OS=Mus mus yes no 0.802 0.239 0.239 2e-13
Q7Z4941330 Nephrocystin-3 OS=Homo sa yes no 0.810 0.240 0.237 3e-13
P0CI651303 Nephrocystin-3 OS=Danio r yes no 0.870 0.264 0.242 6e-13
P46822540 Kinesin light chain OS=Ca yes no 0.498 0.364 0.320 3e-10
P46825 571 Kinesin light chain OS=Do N/A no 0.430 0.297 0.304 7e-10
Q05090 686 Kinesin light chain OS=St no no 0.410 0.236 0.306 2e-09
Q5R581560 Kinesin light chain 1 OS= yes no 0.564 0.398 0.252 1e-08
Q07866573 Kinesin light chain 1 OS= no no 0.564 0.389 0.252 2e-08
>sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 Back     alignment and function desciption
 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 86/349 (24%), Positives = 148/349 (42%), Gaps = 27/349 (7%)

Query: 59   VTSLLGMAKVLG----SIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKE 114
            +TSL  + + LG     +G   +AV    R + I E     +   +   L  L  ++++ 
Sbjct: 912  MTSLADLYETLGRFLKDLGLLSQAVTPLQRSLEIRETALDPDHPSVAQSLHQLAGVYMQS 971

Query: 115  GKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIK 174
             K  +AE ++ + L+I    YG    RV   + +LA         E+A +L KK+L++ +
Sbjct: 972  KKFGNAEQLYKQALEISENAYGSEHLRVARELDALAVLYQKQNKFEQAEQLRKKSLKIRQ 1031

Query: 175  DS--------------------NYMSLDDSIMENMRI--DLAELLHIVGRGQEGRELLEE 212
             S                      ++L     +N R   +L  L ++    +     L+ 
Sbjct: 1032 KSARRKGSMYGFALLRRRALQLEELTLGKDTSDNARTLNELGVLYYLQNNLETAETFLKR 1091

Query: 213  CLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISF 272
             L + E+  G +HP     + NLAA Y+  K + +AE L    LDI  + + PD  S+++
Sbjct: 1092 SLEMRERVLGADHPDCAQSINNLAALYNEKKQYDKAEELYERALDIRRRALSPDHPSLAY 1151

Query: 273  PMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTK 332
             + HL +      +  +A  L   A+ IR+ +FG     V  AL  L  +  ++ + D  
Sbjct: 1152 TVKHLAVLYKRKGKLDKAVPLYELAVDIRQKSFGPKHPSVATALVNLAVLYCQMKKQDDA 1211

Query: 333  LLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKFPLKKR 381
             L L +R ++I E   G     V  TLK +     + G  E+   L KR
Sbjct: 1212 -LPLYERAMKIYEDSLGRMHPRVGETLKNLAVLRYEEGDYEKAAELYKR 1259




Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling that regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Xenopus laevis (taxid: 8355)
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function description
>sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 Back     alignment and function description
>sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 Back     alignment and function description
>sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 Back     alignment and function description
>sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 Back     alignment and function description
>sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 Back     alignment and function description
>sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 Back     alignment and function description
>sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 Back     alignment and function description
>sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
225455344 573 PREDICTED: nephrocystin-3-like [Vitis vi 1.0 0.689 0.731 1e-168
302143919 559 unnamed protein product [Vitis vinifera] 1.0 0.706 0.731 1e-168
224135115 579 predicted protein [Populus trichocarpa] 0.989 0.675 0.721 1e-165
255561868 505 kinesin light chain, putative [Ricinus c 1.0 0.782 0.708 1e-163
297792665 562 hypothetical protein ARALYDRAFT_495375 [ 0.994 0.699 0.643 1e-150
356509235 577 PREDICTED: nephrocystin-3-like [Glycine 1.0 0.684 0.683 1e-150
449497357 561 PREDICTED: nephrocystin-3-like [Cucumis 1.0 0.704 0.658 1e-150
18423468 564 kinesin light chain-related protein [Ara 1.0 0.700 0.645 1e-148
449456393 564 PREDICTED: nephrocystin-3-like [Cucumis 1.0 0.700 0.645 1e-145
357463995 580 Kinesin light chain [Medicago truncatula 0.987 0.672 0.687 1e-144
>gi|225455344|ref|XP_002272297.1| PREDICTED: nephrocystin-3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 289/395 (73%), Positives = 341/395 (86%)

Query: 1   MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVT 60
           MM  IVD LKDDE LLD++LLHMGS+YSTL  +EKSML+Y+R + +LE  YGK S  L+T
Sbjct: 179 MMDKIVDGLKDDEALLDSVLLHMGSVYSTLGKFEKSMLMYRRALEILEMTYGKDSAFLIT 238

Query: 61  SLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDA 120
            LLGMAK LGSIGR  KAVEIYH+ I ILEL+RG ES DLV+PL  LG+L IKE KA DA
Sbjct: 239 PLLGMAKALGSIGRVTKAVEIYHQAIAILELSRGAESEDLVVPLLGLGNLLIKERKATDA 298

Query: 121 ESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMS 180
           E  F+RIL IY + YGENDGRVG+AMCSLAH KCA G+A+EA++LY+ AL+++K S YM+
Sbjct: 299 EIPFTRILNIYKRSYGENDGRVGIAMCSLAHVKCAKGDADEAIQLYRNALQIVKVSKYMA 358

Query: 181 LDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYS 240
           LDD+IME MRIDLAELLH+VGRG+EGRELLEECLLITEKYKG++HPS VTHL+NLA SYS
Sbjct: 359 LDDNIMEKMRIDLAELLHVVGRGKEGRELLEECLLITEKYKGEDHPSSVTHLINLATSYS 418

Query: 241 RSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYI 300
           RSKNFVEAERLLR  L IM KT+GPDDQSI+FPMLHL +TLYHL RD+EAE+L L+AL I
Sbjct: 419 RSKNFVEAERLLRTSLRIMMKTMGPDDQSITFPMLHLAVTLYHLKRDEEAEQLTLKALQI 478

Query: 301 REIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLK 360
           RE AFGK+SLPVGEALDCLVSIQTR+G+DD++LL+LLKRVL IQE+EFG ESEEVM+TLK
Sbjct: 479 REAAFGKESLPVGEALDCLVSIQTRVGKDDSELLDLLKRVLIIQEKEFGYESEEVMITLK 538

Query: 361 KVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQKVQY 395
           K+V YLDK+GRK+EKFPL+KRLS LR K+K+ +QY
Sbjct: 539 KIVFYLDKMGRKDEKFPLQKRLSLLRNKHKESIQY 573




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302143919|emb|CBI23024.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224135115|ref|XP_002321987.1| predicted protein [Populus trichocarpa] gi|222868983|gb|EEF06114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255561868|ref|XP_002521943.1| kinesin light chain, putative [Ricinus communis] gi|223538868|gb|EEF40467.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297792665|ref|XP_002864217.1| hypothetical protein ARALYDRAFT_495375 [Arabidopsis lyrata subsp. lyrata] gi|297310052|gb|EFH40476.1| hypothetical protein ARALYDRAFT_495375 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356509235|ref|XP_003523356.1| PREDICTED: nephrocystin-3-like [Glycine max] Back     alignment and taxonomy information
>gi|449497357|ref|XP_004160380.1| PREDICTED: nephrocystin-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18423468|ref|NP_568784.1| kinesin light chain-related protein [Arabidopsis thaliana] gi|53828571|gb|AAU94395.1| At5g53080 [Arabidopsis thaliana] gi|332008918|gb|AED96301.1| kinesin light chain-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449456393|ref|XP_004145934.1| PREDICTED: nephrocystin-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357463995|ref|XP_003602279.1| Kinesin light chain [Medicago truncatula] gi|355491327|gb|AES72530.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
TAIR|locus:2168387564 AT5G53080 [Arabidopsis thalian 1.0 0.700 0.610 2.8e-128
UNIPROTKB|Q5LU72374 SPO1186 "TPR domain protein" [ 0.718 0.759 0.272 6.5e-16
TIGR_CMR|SPO_1186374 SPO_1186 "TPR domain protein" 0.718 0.759 0.272 6.5e-16
ASPGD|ASPL0000018313 1288 AN3547 [Emericella nidulans (t 0.896 0.274 0.254 3e-15
UNIPROTKB|E1BSU81316 NPHP3 "Uncharacterized protein 0.420 0.126 0.315 1.5e-14
UNIPROTKB|Q6AZT71300 nphp3 "Nephrocystin-3" [Xenopu 0.524 0.159 0.252 1.6e-13
UNIPROTKB|A0JM231311 nphp3 "Nephrocystin-3" [Xenopu 0.407 0.122 0.242 2e-08
ZFIN|ZDB-GENE-091204-1171302 nphp3 "nephronophthisis 3" [Da 0.420 0.127 0.309 2.1e-12
RGD|15638561325 Nphp3 "nephronophthisis 3 (ado 0.420 0.125 0.309 2.7e-12
UNIPROTKB|D4A1W71325 Acad11 "Acyl-CoA dehydrogenase 0.420 0.125 0.309 2.7e-12
TAIR|locus:2168387 AT5G53080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1259 (448.2 bits), Expect = 2.8e-128, P = 2.8e-128
 Identities = 241/395 (61%), Positives = 314/395 (79%)

Query:     1 MMSGIVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVT 60
             M++ IVD+LKD EPLLD++L+H+GSMYS +  +E ++LV+QR I +LE+RYGK + LLVT
Sbjct:   170 MINKIVDNLKDSEPLLDSVLMHVGSMYSVIGKFENAILVHQRAIRILENRYGKCNTLLVT 229

Query:    61 SLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDA 120
              LLGMAK   S G+A KA+ +Y R +TILE NRG+ES DLV+PLFSLG L +KEGKA +A
Sbjct:   230 PLLGMAKSFASDGKATKAIGVYERTLTILERNRGSESEDLVVPLFSLGKLLLKEGKAAEA 289

Query:   121 ESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMS 180
             E  F+ I+ IY K+YGE DGRVGMAMCSLA+AKC+ G+A EAV++Y+ ALR+IKDSNYM+
Sbjct:   290 EIPFTSIVNIYKKIYGERDGRVGMAMCSLANAKCSKGDANEAVDIYRNALRIIKDSNYMT 349

Query:   181 LDDSIMENMRIDLAELLHIVXXXXXXXXXXXXXXXITEKYKGKEHPSFVTHLLNLAASYS 240
             +D+SI+ENMRIDLAELLH V               I E++KGK HPS  THL+NLAASYS
Sbjct:   350 IDNSILENMRIDLAELLHFVGRGDEGRELLEECLLINERFKGKNHPSMATHLINLAASYS 409

Query:   241 RSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYI 300
             RSKN+VEAERLLR CL+IM  +VG + QSI+FPML+L +TL  LNRD+EAE++ L+ L I
Sbjct:   410 RSKNYVEAERLLRTCLNIMEVSVGSEGQSITFPMLNLAVTLSQLNRDEEAEQIALKVLRI 469

Query:   301 REIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLK 360
             RE AFG+DSLPVGEALDCLVSIQ RLG DD ++L LLKRV+ IQE+EFG  ++E+++TL+
Sbjct:   470 REKAFGEDSLPVGEALDCLVSIQARLGRDDGEILGLLKRVMMIQEKEFGPSAQELIVTLQ 529

Query:   361 KVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQKVQY 395
             K++ +L+KL  K++KF  ++RL+ LR +YKQ + Y
Sbjct:   530 KIIHFLEKLEMKDDKFKFRRRLALLRERYKQSLSY 564




GO:0009507 "chloroplast" evidence=ISM
GO:0042802 "identical protein binding" evidence=IEA
UNIPROTKB|Q5LU72 SPO1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1186 SPO_1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSU8 NPHP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZT7 nphp3 "Nephrocystin-3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A0JM23 nphp3 "Nephrocystin-3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-117 nphp3 "nephronophthisis 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1563856 Nphp3 "nephronophthisis 3 (adolescent)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A1W7 Acad11 "Acyl-CoA dehydrogenase family member 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037240001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (542 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00004706001
SubName- Full=Chromosome undetermined scaffold_784, whole genome shotgun sequence; (220 aa)
       0.504
GSVIVG00032964001
SubName- Full=Chromosome chr14 scaffold_63, whole genome shotgun sequence; (224 aa)
       0.482

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 0.003
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
 Score = 47.0 bits (112), Expect = 4e-07
 Identities = 13/77 (16%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 14 PLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIG 73
          P L A L ++  +   L +Y++++ + ++ + +     G+       +L  +A++  ++G
Sbjct: 2  PDLAAALNNLALVLRRLGDYDEALELLEKALELAR-ELGEDHPETARALNNLARLYLALG 60

Query: 74 RAKKAVEIYHRVITILE 90
             +A+E   + + + E
Sbjct: 61 DYDEALEYLEKALALRE 77


Length = 78

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 395
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.98
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.95
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.94
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.93
KOG0547606 consensus Translocase of outer mitochondrial membr 99.93
KOG1126638 consensus DNA-binding cell division cycle control 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.89
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
KOG2076 895 consensus RNA polymerase III transcription factor 99.85
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.85
PLN03218 1060 maturation of RBCL 1; Provisional 99.85
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.85
PLN03218 1060 maturation of RBCL 1; Provisional 99.85
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.84
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.84
KOG2003 840 consensus TPR repeat-containing protein [General f 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.83
PRK04841 903 transcriptional regulator MalT; Provisional 99.83
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.83
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.83
PRK12370553 invasion protein regulator; Provisional 99.83
KOG1129478 consensus TPR repeat-containing protein [General f 99.83
KOG2003 840 consensus TPR repeat-containing protein [General f 99.83
KOG1129478 consensus TPR repeat-containing protein [General f 99.82
KOG0547606 consensus Translocase of outer mitochondrial membr 99.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.82
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.82
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.82
PRK12370553 invasion protein regulator; Provisional 99.82
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.81
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.8
PRK11189296 lipoprotein NlpI; Provisional 99.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.79
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.79
KOG2076 895 consensus RNA polymerase III transcription factor 99.79
PRK04841903 transcriptional regulator MalT; Provisional 99.79
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.78
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.77
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.74
KOG1125579 consensus TPR repeat-containing protein [General f 99.74
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.74
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.73
PLN03077 857 Protein ECB2; Provisional 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
KOG1125579 consensus TPR repeat-containing protein [General f 99.71
PLN03077 857 Protein ECB2; Provisional 99.71
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.7
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.68
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.67
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.65
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.64
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.63
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.61
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.6
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.59
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.55
PLN02789320 farnesyltranstransferase 99.54
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.53
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.51
PLN02789320 farnesyltranstransferase 99.5
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.47
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.47
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.46
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.46
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.46
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.42
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.38
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.38
PRK15359144 type III secretion system chaperone protein SscB; 99.37
PRK15359144 type III secretion system chaperone protein SscB; 99.37
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.36
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.34
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.34
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.33
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.32
PRK10370198 formate-dependent nitrite reductase complex subuni 99.32
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.31
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.3
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.29
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.29
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.28
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.28
PRK10370198 formate-dependent nitrite reductase complex subuni 99.27
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.27
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.27
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.26
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.26
KOG1128777 consensus Uncharacterized conserved protein, conta 99.25
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.24
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.24
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.24
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.22
KOG1585308 consensus Protein required for fusion of vesicles 99.22
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.2
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.19
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.18
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.17
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.17
KOG1585308 consensus Protein required for fusion of vesicles 99.16
KOG2300 629 consensus Uncharacterized conserved protein [Funct 99.16
KOG0553304 consensus TPR repeat-containing protein [General f 99.16
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.15
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.15
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.14
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.1
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.1
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.09
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.09
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.08
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.08
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.06
KOG0553304 consensus TPR repeat-containing protein [General f 99.06
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.04
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.02
PF12688120 TPR_5: Tetratrico peptide repeat 99.02
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.99
PF12688120 TPR_5: Tetratrico peptide repeat 98.96
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.94
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.93
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.93
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.92
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.9
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.89
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.89
KOG1586288 consensus Protein required for fusion of vesicles 98.86
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.85
PRK10803263 tol-pal system protein YbgF; Provisional 98.84
PRK10803263 tol-pal system protein YbgF; Provisional 98.84
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.83
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.82
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.8
KOG1586288 consensus Protein required for fusion of vesicles 98.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.79
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.77
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.77
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.77
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.76
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.76
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.75
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.75
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.74
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.72
KOG4555175 consensus TPR repeat-containing protein [Function 98.68
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.67
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.66
PRK15331165 chaperone protein SicA; Provisional 98.65
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.63
KOG4555175 consensus TPR repeat-containing protein [Function 98.63
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.63
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.61
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.59
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.56
PRK15331165 chaperone protein SicA; Provisional 98.54
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.48
COG4700251 Uncharacterized protein conserved in bacteria cont 98.47
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.46
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.45
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.45
PRK11906458 transcriptional regulator; Provisional 98.45
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.45
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.45
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.43
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.41
COG4700251 Uncharacterized protein conserved in bacteria cont 98.38
PF13512142 TPR_18: Tetratricopeptide repeat 98.38
PF13512142 TPR_18: Tetratricopeptide repeat 98.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.37
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.37
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.37
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.33
KOG4234271 consensus TPR repeat-containing protein [General f 98.33
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.33
KOG2471 696 consensus TPR repeat-containing protein [General f 98.33
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.32
KOG4234271 consensus TPR repeat-containing protein [General f 98.29
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.26
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.23
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.22
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.2
PRK11906458 transcriptional regulator; Provisional 98.19
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.19
PF1337173 TPR_9: Tetratricopeptide repeat 98.19
PF1337173 TPR_9: Tetratricopeptide repeat 98.18
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.17
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.13
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.08
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 98.08
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.04
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.04
COG3898531 Uncharacterized membrane-bound protein [Function u 98.03
KOG2471 696 consensus TPR repeat-containing protein [General f 97.99
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.99
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.96
KOG4648536 consensus Uncharacterized conserved protein, conta 97.96
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.95
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.92
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.84
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.83
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.83
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.82
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.81
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.8
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.77
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.77
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.76
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.75
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.74
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.72
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.7
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.68
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.66
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.64
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.61
KOG1463411 consensus 26S proteasome regulatory complex, subun 97.61
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.59
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.57
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.57
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.57
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.5
KOG1550552 consensus Extracellular protein SEL-1 and related 97.49
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.49
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.49
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.43
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.42
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.39
PF1342844 TPR_14: Tetratricopeptide repeat 97.38
PF1342844 TPR_14: Tetratricopeptide repeat 97.37
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.35
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.32
PF1343134 TPR_17: Tetratricopeptide repeat 97.3
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.25
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.22
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.22
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.22
PF1343134 TPR_17: Tetratricopeptide repeat 97.2
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.13
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.09
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.08
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.08
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.97
KOG1550552 consensus Extracellular protein SEL-1 and related 96.73
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.73
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.64
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.62
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.61
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.53
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.42
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.38
PRK14707 2710 hypothetical protein; Provisional 96.38
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.32
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.3
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.22
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.2
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.07
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.05
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.03
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 96.01
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.01
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 95.96
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 95.95
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.79
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.78
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.67
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.65
PRK14707 2710 hypothetical protein; Provisional 95.62
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 95.58
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.45
KOG0687393 consensus 26S proteasome regulatory complex, subun 95.29
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.24
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.14
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.01
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.93
KOG4507886 consensus Uncharacterized conserved protein, conta 94.91
COG5187412 RPN7 26S proteasome regulatory complex component, 94.86
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.83
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 94.71
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.71
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.53
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.46
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.46
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.45
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.45
KOG3364149 consensus Membrane protein involved in organellar 94.35
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.3
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 93.94
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.73
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.65
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 93.6
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.55
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 93.5
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 93.46
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 93.31
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 93.29
KOG0508 615 consensus Ankyrin repeat protein [General function 93.19
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 93.19
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 93.11
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.99
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.89
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 92.87
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 92.86
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.6
PRK10941269 hypothetical protein; Provisional 92.51
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 92.5
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.49
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 92.44
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 92.43
COG3629280 DnrI DNA-binding transcriptional activator of the 92.33
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.2
KOG0508 615 consensus Ankyrin repeat protein [General function 92.04
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 91.88
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 91.82
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.8
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 91.52
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 91.37
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.31
PRK10941269 hypothetical protein; Provisional 91.09
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 90.85
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 90.81
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.56
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.32
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.28
COG3629280 DnrI DNA-binding transcriptional activator of the 90.19
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 90.11
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.01
KOG4814 872 consensus Uncharacterized conserved protein [Funct 89.83
COG5187412 RPN7 26S proteasome regulatory complex component, 89.66
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 89.66
PF1285434 PPR_1: PPR repeat 89.62
KOG4563400 consensus Cell cycle-regulated histone H1-binding 89.38
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 89.3
KOG3364149 consensus Membrane protein involved in organellar 89.17
KOG0687393 consensus 26S proteasome regulatory complex, subun 88.99
PF1285434 PPR_1: PPR repeat 88.91
PF1304150 PPR_2: PPR repeat family 88.9
COG3947361 Response regulator containing CheY-like receiver a 88.87
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 88.69
COG3947361 Response regulator containing CheY-like receiver a 87.88
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 87.78
KOG4014248 consensus Uncharacterized conserved protein (conta 87.5
COG4976287 Predicted methyltransferase (contains TPR repeat) 87.38
KOG1258577 consensus mRNA processing protein [RNA processing 86.97
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 86.83
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 86.81
PF1304150 PPR_2: PPR repeat family 86.62
cd0267979 MIT_spastin MIT: domain contained within Microtubu 86.62
KOG4563400 consensus Cell cycle-regulated histone H1-binding 86.41
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 86.41
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 86.16
PHA02537230 M terminase endonuclease subunit; Provisional 85.88
COG4976287 Predicted methyltransferase (contains TPR repeat) 85.74
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.49
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 85.13
PRK09169 2316 hypothetical protein; Validated 83.69
PRK09169 2316 hypothetical protein; Validated 83.23
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 82.99
KOG2908380 consensus 26S proteasome regulatory complex, subun 82.79
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 82.24
KOG1310758 consensus WD40 repeat protein [General function pr 81.96
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 81.9
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 80.99
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.49
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 80.29
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
Probab=100.00  E-value=1.3e-36  Score=255.24  Aligned_cols=313  Identities=28%  Similarity=0.385  Sum_probs=295.2

Q ss_pred             hhhhcCCCcHHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHhcCcChHHHHHHHHHHHHHHHhhCchhHHHHHHHH
Q 016114            5 IVDSLKDDEPLLDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHR   84 (395)
Q Consensus         5 ~~~~l~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~   84 (395)
                      ..+.++..+|....+...++..|..+|+|++|+..+++++++..+..+..++.....+..+|.+|..++++.+|+..|++
T Consensus       187 ~~~~~~~~~P~~~~~~~~La~~y~~~g~~e~A~~l~k~Al~~l~k~~G~~hl~va~~l~~~a~~y~~~~k~~eAv~ly~~  266 (508)
T KOG1840|consen  187 QAKGLGDEDPERLRTLRNLAEMYAVQGRLEKAEPLCKQALRILEKTSGLKHLVVASMLNILALVYRSLGKYDEAVNLYEE  266 (508)
T ss_pred             HHHhcccCCchHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHHccCccCHHHHHHHHHHHHHHHHhccHHHHHHHHHH
Confidence            45677888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCChhhhhhHHhHHHHHHHcCChHHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHCCCHHHHHH
Q 016114           85 VITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGNAEEAVE  164 (395)
Q Consensus        85 al~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~  164 (395)
                      |+.+.+...|+++|.++.++.+||.+|...|++++|..++++|+++.++..+..++.+...+.+++.++...+++++|..
T Consensus       267 AL~i~e~~~G~~h~~va~~l~nLa~ly~~~GKf~EA~~~~e~Al~I~~~~~~~~~~~v~~~l~~~~~~~~~~~~~Eea~~  346 (508)
T KOG1840|consen  267 ALTIREEVFGEDHPAVAATLNNLAVLYYKQGKFAEAEEYCERALEIYEKLLGASHPEVAAQLSELAAILQSMNEYEEAKK  346 (508)
T ss_pred             HHHHHHHhcCCCCHHHHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHhhccChHHHHHHHHHHHHHHHHhcchhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcccCCCCchHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhhhCCCChhHHHHHHHHHHHHHhhhc
Q 016114          165 LYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKN  244 (395)
Q Consensus       165 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~  244 (395)
                      ++++++++....  ++++++.+..++.++|.+|..+|++++|.+++++|+.+.++..+..++.....++++|..|.+.++
T Consensus       347 l~q~al~i~~~~--~g~~~~~~a~~~~nl~~l~~~~gk~~ea~~~~k~ai~~~~~~~~~~~~~~~~~l~~la~~~~~~k~  424 (508)
T KOG1840|consen  347 LLQKALKIYLDA--PGEDNVNLAKIYANLAELYLKMGKYKEAEELYKKAIQILRELLGKKDYGVGKPLNQLAEAYEELKK  424 (508)
T ss_pred             HHHHHHHHHHhh--ccccchHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHhcccCcChhhhHHHHHHHHHHHHhcc
Confidence            999999999865  788888999999999999999999999999999999999999888888889999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhhCCCCcchHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHH
Q 016114          245 FVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLV  320 (395)
Q Consensus       245 ~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~  320 (395)
                      +.+|...|.++..+. +..|+++|++...+.+|+.+|..+|+++.|+++.+.++...+..++..++.....-..++
T Consensus       425 ~~~a~~l~~~~~~i~-~~~g~~~~~~~~~~~nL~~~Y~~~g~~e~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  499 (508)
T KOG1840|consen  425 YEEAEQLFEEAKDIM-KLCGPDHPDVTYTYLNLAALYRAQGNYEAAEELEEKVLNAREQRLGTASPTVEDEKLRLA  499 (508)
T ss_pred             cchHHHHHHHHHHHH-HHhCCCCCchHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcCCCCCcchhHHHHhhh
Confidence            999999999999999 889999999999999999999999999999999999999999988887776654443333



>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 3e-09
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 2e-07
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 3e-07
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 4e-05
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 44/142 (30%), Positives = 67/142 (47%), Gaps = 6/142 (4%) Query: 216 ITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPML 275 I EK GK+HP+ L NLA Y + + EAE L + L+I K +G D ++ + Sbjct: 98 IREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLN 157 Query: 276 HLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSI---QTRLGEDDTK 332 +L + + + +E E AL I + G D V + + L S Q + + +T Sbjct: 158 NLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETL 217 Query: 333 LLELLKRVLRIQEREFGSESEE 354 E+L R EREFGS +E Sbjct: 218 YKEILTRA---HEREFGSVDDE 236
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-28
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-23
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 2e-11
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 2e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-22
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-17
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-19
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-15
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-05
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 2e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-19
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-16
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-11
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 4e-15
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 2e-13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-09
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-09
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 4e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-11
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 9e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 6e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3qww_A433 SET and MYND domain-containing protein 2; methyltr 8e-09
3qww_A433 SET and MYND domain-containing protein 2; methyltr 9e-06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 9e-06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 3e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 1e-08
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 1e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 2e-07
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 2e-06
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 8e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 2e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 8e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 7e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-04
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
 Score =  127 bits (321), Expect = 4e-34
 Identities = 59/290 (20%), Positives = 100/290 (34%), Gaps = 17/290 (5%)

Query: 20  LLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAV 79
             H     S L     ++ + ++ +  LE   G     + T L  +A V     + K+A 
Sbjct: 4   SHHHHHHSSGLVPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAA 63

Query: 80  EIYHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGEND 139
            + +  + I E   G +   +   L +L  L+ K GK  +AE +  R L+I  KV G+  
Sbjct: 64  HLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFH 123

Query: 140 GRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDD------SIMENMRIDL 193
             V   + +LA      G AEE    Y++AL +        L            N    L
Sbjct: 124 PDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYAT----RLGPDDPNVAKTKNN----L 175

Query: 194 AELLHIVGRGQEGRELLEECL-LITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLL 252
           A      G+ Q+   L +E L    EK  G  +       ++            ++    
Sbjct: 176 ASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSAPYG 235

Query: 253 RICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIRE 302
                   K    D  +++  +  LG       + + A  L   A   R+
Sbjct: 236 EYGSWY--KACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRK 283


>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 100.0
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 100.0
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 100.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 100.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.98
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.97
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.97
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.96
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.95
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.9
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.89
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.89
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.88
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.88
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.88
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.87
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.87
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.87
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.87
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.87
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.87
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.87
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.83
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.83
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.82
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.82
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.81
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.8
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.79
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.78
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.77
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.77
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.77
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.76
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.76
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.75
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.75
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.74
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.73
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.73
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.7
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.66
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.65
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.64
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.63
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.63
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.63
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.63
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.62
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.62
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.61
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.61
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.6
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.58
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.58
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.55
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.52
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.52
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.5
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.49
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.48
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.46
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.45
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.45
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.45
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.45
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.44
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.43
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.42
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.42
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.42
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.41
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.41
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.4
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.39
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.39
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.39
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.37
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.37
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.37
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.37
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.37
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.37
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.36
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.34
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.34
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.32
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.31
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.3
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.3
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.29
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.28
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.28
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.27
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.23
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.2
3k9i_A117 BH0479 protein; putative protein binding protein, 99.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.19
3k9i_A117 BH0479 protein; putative protein binding protein, 99.17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.15
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.12
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.11
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.06
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.02
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.98
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.97
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.93
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.92
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.88
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.85
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.83
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.81
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.7
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.67
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.65
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.64
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.56
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.55
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.53
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.5
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.46
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.46
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.27
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.24
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.22
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.2
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.18
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.17
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.07
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 97.79
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.71
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.44
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.42
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.34
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.86
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.78
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.49
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.46
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.4
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.39
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.27
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.8
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.68
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.62
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.54
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 95.26
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 95.09
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.9
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.53
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.5
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.48
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.65
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.44
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.13
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.99
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.33
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.13
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 92.0
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 90.54
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 88.78
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.59
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 88.27
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 85.83
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 85.46
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 84.89
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 84.46
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 82.66
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 82.12
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=9.1e-34  Score=244.93  Aligned_cols=349  Identities=17%  Similarity=0.140  Sum_probs=296.1

Q ss_pred             HHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHhcCcChHHHHHHHHHHHHHHHhhCchhHHHHHHHHHHHHHHHhcCC
Q 016114           16 LDAILLHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGT   95 (395)
Q Consensus        16 ~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~   95 (395)
                      .+..+..+|..+...|++++|+.+|++++...    +.+.+..+.++..+|.++...|++++|+.++++++.+.....  
T Consensus         8 ~~~~l~~~g~~~~~~g~~~~A~~~~~~al~~~----~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~--   81 (406)
T 3sf4_A            8 SCLELALEGERLCKSGDCRAGVSFFEAAVQVG----TEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIG--   81 (406)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC----CSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTT--
T ss_pred             HHHHHHHHHHHHHHhccHHHHHHHHHHHHhcC----cccHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhcc--
Confidence            45567899999999999999999999999872    233445678899999999999999999999999999987753  


Q ss_pred             CChhhhhhHHhHHHHHHHcCChHHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHCCC-----------------
Q 016114           96 ESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGRVGMAMCSLAHAKCANGN-----------------  158 (395)
Q Consensus        96 ~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~-----------------  158 (395)
                      +.+....++..+|.++...|++++|+.++++++.+.+...  +.+....++..+|.++...|+                 
T Consensus        82 ~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~--~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~a  159 (406)
T 3sf4_A           82 DQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELN--DKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEV  159 (406)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHT--CHHHHHHHHHHHHHHHHHHHHTCC-------CCCCHHH
T ss_pred             ccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcc--cccchHHHHHHHHHHHHHcCCcccccccchhhhhhhhH
Confidence            5677888999999999999999999999999999988752  445677899999999999999                 


Q ss_pred             ---HHHHHHHHHHHHHHHHhcccCCCCchHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhhhCCCChhHHHHHHHH
Q 016114          159 ---AEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVGRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNL  235 (395)
Q Consensus       159 ---~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l  235 (395)
                         +++|+.++++++.+....    ++.+....++.++|.++...|++++|+.++++++.+.....  +.+....++.++
T Consensus       160 ~~~~~~A~~~~~~al~~~~~~----~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~--~~~~~~~~~~~l  233 (406)
T 3sf4_A          160 RDALQAAVDFYEENLSLVTAL----GDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFG--DKAAERRAYSNL  233 (406)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHT----TCHHHHHHHHHHHHHHHHHHTBHHHHHHHHHHHHHHHHHTT--CHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhc----cCcHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHhcC--CcHHHHHHHHHH
Confidence               999999999999998764    46677788899999999999999999999999999987643  445667789999


Q ss_pred             HHHHHhhhcHHHHHHHHHHHHHHHHHhhCCCCcchHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHHcCCCChHHHHH
Q 016114          236 AASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGITLYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEA  315 (395)
Q Consensus       236 a~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~  315 (395)
                      |.++...|++++|+.++++++.+....  .+.+....++..+|.++...|++++|..++++++.+....  .+.+....+
T Consensus       234 a~~~~~~g~~~~A~~~~~~al~~~~~~--~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~--~~~~~~~~~  309 (406)
T 3sf4_A          234 GNAYIFLGEFETASEYYKKTLLLARQL--KDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQEL--NDRIGEGRA  309 (406)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHHHHHHHT--TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHT--TCHHHHHHH
T ss_pred             HHHHHHcCChHHHHHHHHHHHHHHHhC--cCchHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhc--CCcHHHHHH
Confidence            999999999999999999999987665  3445567889999999999999999999999999988765  345667788


Q ss_pred             HHHHHHHHHHcCCchhHHHHHHHHHHHHHHhccCCCCHHHHHHHHHHHHHHHHhcchhhhc-hhhHHHHHH
Q 016114          316 LDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLKKVVSYLDKLGRKEEKF-PLKKRLSNL  385 (395)
Q Consensus       316 ~~~l~~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~-~~~~~a~~~  385 (395)
                      +..+|.++...|+++ +|+.++++++++..+.  ...+....++..++.++...|+...+. ...+....+
T Consensus       310 ~~~la~~~~~~g~~~-~A~~~~~~al~~~~~~--~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~  377 (406)
T 3sf4_A          310 CWSLGNAYTALGNHD-QAMHFAEKHLEISREV--GDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEI  377 (406)
T ss_dssp             HHHHHHHHHHHTCHH-HHHHHHHHHHHHHHHT--TCHHHHHHHHHHHHHHHHHHHTTSCC-----------
T ss_pred             HHHHHHHHHHcCCHH-HHHHHHHHHHHHHHHh--cCCcchhHHHHHHHHHHHHhhHhHHHHHHHHHHHHHH
Confidence            999999999999999 9999999999998874  345778889999999999999885544 333333333



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 395
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-07
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-05
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-05
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 9e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.002
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.3 bits (142), Expect = 2e-10
 Identities = 41/264 (15%), Positives = 92/264 (34%), Gaps = 50/264 (18%)

Query: 22  HMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEI 81
           ++G +++       ++  +++ + +  +         + + + +  VL       +AV  
Sbjct: 174 NLGCVFNAQGEIWLAIHHFEKAVTLDPN--------FLDAYINLGNVLKEARIFDRAVAA 225

Query: 82  YHRVITILELNRGTESADLVLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKVYGENDGR 141
           Y R +++        S +  +   +L  ++ ++G    A   + R +++           
Sbjct: 226 YLRALSL--------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--------QPH 269

Query: 142 VGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIVG 201
              A C+LA+A    G+  EA + Y  ALR                +   +LA +    G
Sbjct: 270 FPDAYCNLANALKEKGSVAEAEDCYNTALR----------LCPTHADSLNNLANIKREQG 319

Query: 202 RGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTK 261
             +E   L  + L +         P F     NLA+   +     EA    +  + I   
Sbjct: 320 NIEEAVRLYRKALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--- 368

Query: 262 TVGPDDQSISFPMLHLGITLYHLN 285
                  + +    ++G TL  + 
Sbjct: 369 -----SPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.98
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.96
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.84
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.81
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.8
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.56
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.52
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.51
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.51
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.5
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.46
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.44
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.42
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.42
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.37
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.36
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.35
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.26
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.22
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.19
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.11
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.0
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.9
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.83
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.63
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.6
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.14
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.06
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.84
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.73
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 93.32
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 91.53
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 91.47
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 91.13
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.54
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 88.17
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.1
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 87.26
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 86.22
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 82.38
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-31  Score=228.46  Aligned_cols=312  Identities=16%  Similarity=0.142  Sum_probs=260.3

Q ss_pred             HHHHHHHHhhhcHHHHHHHHHHHHHHHHHhcCcChHHHHHHHHHHHHHHHhhCchhHHHHHHHHHHHHHHHhcCCCChhh
Q 016114           21 LHMGSMYSTLENYEKSMLVYQRVINVLESRYGKTSILLVTSLLGMAKVLGSIGRAKKAVEIYHRVITILELNRGTESADL  100 (395)
Q Consensus        21 ~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~  100 (395)
                      +.+|..++..|++++|+..|+++++..        |....++..+|.++...|++++|+..++++++.        .|..
T Consensus         3 l~la~~~~~~G~~~~A~~~~~~~l~~~--------p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~--------~p~~   66 (388)
T d1w3ba_           3 MELAHREYQAGDFEAAERHCMQLWRQE--------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ--------NPLL   66 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--------CTTC
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhC--------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--------CCCC
Confidence            357899999999999999999998752        334567889999999999999999999999987        5667


Q ss_pred             hhhHHhHHHHHHHcCChHHHHHHHHHHHHHHHHH----------------------------------------------
Q 016114          101 VLPLFSLGSLFIKEGKAVDAESVFSRILKIYTKV----------------------------------------------  134 (395)
Q Consensus       101 ~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~----------------------------------------------  134 (395)
                      ..++..+|.++...|++++|+..+..+.......                                              
T Consensus        67 ~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  146 (388)
T d1w3ba_          67 AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLK  146 (388)
T ss_dssp             HHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhhhhcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            7899999999999999999999998876541100                                              


Q ss_pred             --------------hCCCChhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHhcccCCCCchHHHHHHHHHHHHHHHc
Q 016114          135 --------------YGENDGRVGMAMCSLAHAKCANGNAEEAVELYKKALRVIKDSNYMSLDDSIMENMRIDLAELLHIV  200 (395)
Q Consensus       135 --------------~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~  200 (395)
                                    .....|....++..+|..+...|++++|...++++++..       |+.   ..++..+|.++...
T Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-------p~~---~~~~~~l~~~~~~~  216 (388)
T d1w3ba_         147 ALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-------PNF---LDAYINLGNVLKEA  216 (388)
T ss_dssp             TTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-------TTC---HHHHHHHHHHHHTT
T ss_pred             ccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-------ccc---HHHHHHHhhhhhcc
Confidence                          000122334667888999999999999999999998852       232   45678899999999


Q ss_pred             CChHHHHHHHHHHHHHHHhhhCCCChhHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHhhCCCCcchHHHHHHHHHH
Q 016114          201 GRGQEGRELLEECLLITEKYKGKEHPSFVTHLLNLAASYSRSKNFVEAERLLRICLDIMTKTVGPDDQSISFPMLHLGIT  280 (395)
Q Consensus       201 g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~  280 (395)
                      |++++|+..++++...        .+.....+..+|.++...|++++|+..|++++++        +|....++..+|.+
T Consensus       217 ~~~~~A~~~~~~~~~~--------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~  280 (388)
T d1w3ba_         217 RIFDRAVAAYLRALSL--------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--------QPHFPDAYCNLANA  280 (388)
T ss_dssp             TCTTHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--------CSSCHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHhHHH--------hhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--------CCCCHHHHHHHHHH
Confidence            9999999999998775        2334567888999999999999999999999873        56777889999999


Q ss_pred             HHhcCChHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHHcCCchhHHHHHHHHHHHHHHhccCCCCHHHHHHHH
Q 016114          281 LYHLNRDKEAEKLVLEALYIREIAFGKDSLPVGEALDCLVSIQTRLGEDDTKLLELLKRVLRIQEREFGSESEEVMLTLK  360 (395)
Q Consensus       281 ~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~  360 (395)
                      +...|++++|+..+++++...        |.....+..++.++...|+++ +|+..|++++++        +|+...++.
T Consensus       281 ~~~~~~~~~A~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~~~~~-~A~~~~~~al~~--------~p~~~~~~~  343 (388)
T d1w3ba_         281 LKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIE-EAVRLYRKALEV--------FPEFAAAHS  343 (388)
T ss_dssp             HHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHH-HHHHHHHHHTTS--------CTTCHHHHH
T ss_pred             HHHcCCHHHHHHHHHhhhccC--------CccchhhhHHHHHHHHCCCHH-HHHHHHHHHHHh--------CCCCHHHHH
Confidence            999999999999999887643        334456789999999999999 999999999863        345567899


Q ss_pred             HHHHHHHHhcchhhhchhhHHHHHHHHHHHh
Q 016114          361 KVVSYLDKLGRKEEKFPLKKRLSNLRMKYKQ  391 (395)
Q Consensus       361 ~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~  391 (395)
                      .+|.+|..+|++++|+..|++++++.|+...
T Consensus       344 ~la~~~~~~g~~~~A~~~~~~al~l~P~~~~  374 (388)
T d1w3ba_         344 NLASVLQQQGKLQEALMHYKEAIRISPTFAD  374 (388)
T ss_dssp             HHHHHHHTTTCCHHHHHHHHHHHTTCTTCHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhCCCCHH
Confidence            9999999999999999999999998776543



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure