Citrus Sinensis ID: 016182

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQGSHAHNHGVPTSPAAVTPLNTEAPTKSSGNADRGLAKKLKGLDGLAMSIGNASAESAEGGAEQRPSQSEADGSTDGSDGNTVRAGQSRKKRSREGTPIAGGDGKTDIQSTPVPVGVNATPDKVLATAVAPTSVSGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG
cccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcccccccccccccHHHHHHHccccccccccccccccEcccccccHHHHHHHHcccccccEEEcc
mgnnedgksfksekpsspppsdqgnihmytDWAAMQayygprvaippyynspiasghapqpymwgpaqgshahnhgvptspaavtplnteaptkssgnadRGLAKKLKGLDGLAMSIGnasaesaeggaeqrpsqseadgstdgsdgntvragqsrkkrsregtpiaggdgktdiqstpvpvgvnatpdKVLATAvaptsvsgkpvgpvlspgmptklelrnapgmnvkasptsvpqpcavlppetwiQNERELKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAqlgnkqeivlnedkrvtpvsteNLLSRvnnsgtvdrnmeegghlfeknsnsgaklhqlldasprtdavaag
mgnnedgksfksekpsspppsdQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQGSHAHNHGVPTSPAAVTPLNTeaptkssgnadrGLAKKLKGLDGLAMSIGNASAESAEGGAEQRPSqseadgstdgsdgntvragqsrkkrsregtpiaggdgktdiqstpvPVGVNATPDKVLATAVAptsvsgkpvgpvlspgMPTKLELRNAPGMNVKASptsvpqpcavlppetwiqnerelkrerrkqsnresarrsrlrkqaeaeelsrkvdslidENASLKSEINQLSENSEKLRQENAALLEKLKsaqlgnkqeivlnedkrvtpvstenllsrvnnsgtvDRNMEEGGHLFEKNSNSGAKLhqlldasprtdavaag
MGNNEDGksfksekpsspppsDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQGSHAHNHGVPTSPAAVTPLNTEAPTKSSGNadrglakklkgldglaMsignasaesaeggaeQRPSQSEADGSTDGSDGNTVRAGQSRKKRSREGTPIAGGDGKTDIQSTPVPVGVNATPDKVLATAVAPTSVSGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG
*************************IHMYTDWAAMQAYYGPRVAIPPYYNSPIASG**************************************************************************************************************************************************************************************************************************************************************************************************************************************************
*****************************TDWAAMQAYYGPRVAIP**********HAPQPYMWGPAQGSHA**************************************************************************************************************************************************************************************************************EELSRKVDSLIDENASLKSEINQLSENSEKLRQENAA*********************************************************************SPR***V***
**********************QGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQGSHAHNHGVPTSPAAVTPLNTE*********DRGLAKKLKGLDGLAMSIGNA*********************************************IAGGDGKTDIQSTPVPVGVNATPDKVLATAVAPTSVSGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNER*******************************KVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDAS*********
************************NIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQGSHAHNHGVPTSPAAVTPLNTE********************************************************************************************************************GPVLSPGMP*********************************************************RKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSA****************************************************A*****LDASPRTD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQGSHAHNHGVPTSPAAVTPLNTEAPTKSSGNADRGLAKKLKGLDGLAMSIGNASAESAEGGAEQRPSQSEADGSTDGSDGNTVRAGQSRKKRSREGTPIAGGDGKTDIQSTPVPVGVNATPDKVLATAVAPTSVSGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query394 2.2.26 [Sep-21-2011]
Q99089411 Common plant regulatory f N/A no 0.994 0.953 0.506 1e-100
P42776382 G-box-binding factor 3 OS yes no 0.865 0.892 0.496 4e-87
P42775360 G-box-binding factor 2 OS no no 0.824 0.902 0.433 3e-65
Q99142265 Transcriptional activator N/A no 0.616 0.916 0.536 5e-59
P42774315 G-box-binding factor 1 OS no no 0.690 0.863 0.333 1e-25
P25032354 DNA-binding protein EMBP- N/A no 0.185 0.206 0.589 2e-16
Q99091296 Light-inducible protein C N/A no 0.241 0.320 0.44 1e-15
P23922349 Transcription factor HBP- N/A no 0.233 0.263 0.457 1e-14
P24068151 Ocs element-binding facto N/A no 0.210 0.549 0.395 9e-07
Q54Y73 834 Probable basic-leucine zi yes no 0.167 0.079 0.417 4e-06
>sp|Q99089|CPRF1_PETCR Common plant regulatory factor 1 OS=Petroselinum crispum GN=CPRF1 PE=2 SV=1 Back     alignment and function desciption
 Score =  367 bits (941), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 209/413 (50%), Positives = 277/413 (67%), Gaps = 21/413 (5%)

Query: 1   MGNNEDGKSFKSEK---PSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGH 57
           MGN +D K+ K EK   P  P   DQ N H+Y DWAAMQAYYGPRVA+PPY+N  +ASG 
Sbjct: 1   MGNTDDVKAVKPEKLSSPPPPAAPDQSNSHVYPDWAAMQAYYGPRVALPPYFNPAVASGQ 60

Query: 58  APQPYMWGPAQ-------------GSHAHNHGVPTSPAAVTPLNTEAPTKSSGNADRGLA 104
           +P PYMWGP Q              +H   +  P  P A +P++ +   KSSG  + GL 
Sbjct: 61  SPHPYMWGPPQPVMPPYGVPYAALYAHGGVYAHPGVPLAASPMSMDTHAKSSGTNEHGLI 120

Query: 105 KKLKGLDGLAMSIGNASAESAEGGAEQRPSQS-EADGSTDGSDGNTVRAGQSRKKRSREG 163
           KKLKG D LAMSIGN  A+S+EG  E+  SQS E +GS+DGS+ N+ RA  + +KR R+ 
Sbjct: 121 KKLKGHDDLAMSIGNGKADSSEGEMERTLSQSKETEGSSDGSNENSKRAAVNGRKRGRDE 180

Query: 164 TPIAGGDGKTDIQSTPVPVGVNATPDKVLATAVAPTSVSGKPVGPVLSPGMPTKLELRNA 223
            P   G+ K + QS+ +P    A  +K+L   VA   V+GK VG V+SP M + LEL+++
Sbjct: 181 APNMIGEVKIETQSSVIP-SPRAKSEKLLGITVATPMVAGKVVGTVVSPSMTSSLELKDS 239

Query: 224 PGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNRESARRSRLRKQAEAEELSR 283
           P  +   SP    QP  ++P ++W+ N+R+LKRERRKQSNRESARRSRLRKQAEAEEL+ 
Sbjct: 240 PKEHAVNSPAGGQQPSTMMPNDSWLHNDRDLKRERRKQSNRESARRSRLRKQAEAEELAI 299

Query: 284 KVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVL--NEDKRVTP 341
           KVDSL  EN +LK+EIN+L+  +EKL  +N+ LLE +K+AQ     ++ L  N +K+ + 
Sbjct: 300 KVDSLTAENMALKAEINRLTLTAEKLTNDNSRLLEVMKNAQAERAADVGLGNNNEKKAST 359

Query: 342 VSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG 394
           +ST NLLSRV+N+G+ DR+  E   ++EK + SGAKLHQLLDA+PRTDAVAAG
Sbjct: 360 LSTANLLSRVDNAGSGDRDEGE-SDVYEKTTKSGAKLHQLLDANPRTDAVAAG 411
Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Petroselinum crispum (taxid: 4043)
>sp|P42776|GBF3_ARATH G-box-binding factor 3 OS=Arabidopsis thaliana GN=GBF3 PE=1 SV=2 Back     alignment and function description
>sp|P42775|GBF2_ARATH G-box-binding factor 2 OS=Arabidopsis thaliana GN=GBF2 PE=1 SV=1 Back     alignment and function description
>sp|Q99142|TAF1_TOBAC Transcriptional activator TAF-1 (Fragment) OS=Nicotiana tabacum GN=TAF1 PE=2 SV=1 Back     alignment and function description
>sp|P42774|GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana GN=GBF1 PE=2 SV=2 Back     alignment and function description
>sp|P25032|EMBP1_WHEAT DNA-binding protein EMBP-1 OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|Q99091|CPRF3_PETCR Light-inducible protein CPRF3 OS=Petroselinum crispum GN=CPRF3 PE=2 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description
>sp|Q54Y73|BZPD_DICDI Probable basic-leucine zipper transcription factor D OS=Dictyostelium discoideum GN=bzpD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
359489695430 PREDICTED: common plant regulatory facto 1.0 0.916 0.646 1e-139
357512481425 G-box binding factor [Medicago truncatul 0.992 0.92 0.619 1e-135
388501482425 unknown [Medicago truncatula] 0.992 0.92 0.616 1e-134
255541782401 Common plant regulatory factor CPRF-1, p 0.934 0.917 0.618 1e-131
356573189425 PREDICTED: common plant regulatory facto 0.984 0.912 0.610 1e-129
364521140421 bZIP protein [Medicago sativa] 0.982 0.919 0.609 1e-129
51870705424 bZip transcription factor [Psophocarpus 0.989 0.919 0.595 1e-127
1155054424 regulator of MAT2 [Phaseolus vulgaris] 0.989 0.919 0.586 1e-127
356560615424 PREDICTED: common plant regulatory facto 0.989 0.919 0.586 1e-125
147867254429 hypothetical protein VITISV_022855 [Viti 0.992 0.911 0.613 1e-124
>gi|359489695|ref|XP_002279966.2| PREDICTED: common plant regulatory factor 1-like [Vitis vinifera] gi|297745388|emb|CBI40468.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 278/430 (64%), Positives = 319/430 (74%), Gaps = 36/430 (8%)

Query: 1   MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQ 60
           MGN E+GKS K EKP+SPPP DQ NIH+Y DWAAMQAYYGPRV +PPYYNS +ASGHAP 
Sbjct: 1   MGNEEEGKSPKPEKPTSPPPPDQANIHVYPDWAAMQAYYGPRVTLPPYYNSAMASGHAPH 60

Query: 61  PYMWG-------------------------PA--QGSHAHNHGVPTSPA-----AVTPLN 88
           PY+WG                         PA   GSH+H HGV +SP      A  PL+
Sbjct: 61  PYIWGPPQPMMPPYGPPYAAIYSPGGVYPHPAVPLGSHSHGHGVQSSPVVSEALAAPPLS 120

Query: 89  TEAPTKSSGNADRGLAKKLKGLDGLAMSIGNASAESAEGGAEQRPSQS-EADGSTDGSDG 147
            E P KSSGN DRGL KKLKG DGLAMSIGN + ES EGG++   SQS E +GS+DGSDG
Sbjct: 121 IETPAKSSGNTDRGLMKKLKGFDGLAMSIGNGNGESTEGGSDHGLSQSGETEGSSDGSDG 180

Query: 148 NTVRAGQSRKKRSREGTPIAGGDGKTDIQSTPVPVG-VNATPDKVLATAVAPTSVSGKPV 206
           NT  A Q+R+KRSREGTP  GGDGKT+ Q+T  P   VNA  DKVL  AV PTSV+GK  
Sbjct: 181 NTAGADQTRRKRSREGTPPIGGDGKTETQATSAPSAEVNAGSDKVLGVAVPPTSVTGKLA 240

Query: 207 GPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNRES 266
           G VLSP M T LELRN P +N K SP+S+PQP A++P +TWI NERE+KRERRKQSNRES
Sbjct: 241 GAVLSPRMSTALELRNPPSVNAKTSPSSIPQPGAMVPSDTWILNEREIKRERRKQSNRES 300

Query: 267 ARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLG 326
           ARRSRLRKQAE EEL+ KV+SL  EN+ LKSEIN+L ENSEKL+ ENA L+EKLKSAQL 
Sbjct: 301 ARRSRLRKQAETEELALKVESLNTENSVLKSEINRLRENSEKLKLENATLMEKLKSAQLE 360

Query: 327 NKQEIVLN--EDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDA 384
             ++  LN  +DKRV PVSTENLLSRVNNSG+VDR+ EE G ++EKN+N+GAKLHQLLD 
Sbjct: 361 QAEDTHLNKVDDKRVLPVSTENLLSRVNNSGSVDRSTEEEGDMYEKNTNTGAKLHQLLDT 420

Query: 385 SPRTDAVAAG 394
           SPR DAVAAG
Sbjct: 421 SPRADAVAAG 430

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357512481|ref|XP_003626529.1| G-box binding factor [Medicago truncatula] gi|355501544|gb|AES82747.1| G-box binding factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|388501482|gb|AFK38807.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255541782|ref|XP_002511955.1| Common plant regulatory factor CPRF-1, putative [Ricinus communis] gi|223549135|gb|EEF50624.1| Common plant regulatory factor CPRF-1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356573189|ref|XP_003554746.1| PREDICTED: common plant regulatory factor 1-like [Glycine max] Back     alignment and taxonomy information
>gi|364521140|gb|AEW66884.1| bZIP protein [Medicago sativa] Back     alignment and taxonomy information
>gi|51870705|dbj|BAD42432.1| bZip transcription factor [Psophocarpus tetragonolobus] Back     alignment and taxonomy information
>gi|1155054|gb|AAC49474.1| regulator of MAT2 [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|356560615|ref|XP_003548586.1| PREDICTED: common plant regulatory factor 1 [Glycine max] Back     alignment and taxonomy information
>gi|147867254|emb|CAN81196.1| hypothetical protein VITISV_022855 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
TAIR|locus:2063020382 GBF3 "G-box binding factor 3" 0.550 0.568 0.435 4.8e-56
TAIR|locus:2124938360 GBF2 "G-box binding factor 2" 0.350 0.383 0.448 2.9e-46
TAIR|locus:2062455409 bZIP16 "basic region/leucine z 0.459 0.442 0.378 4.8e-31
TAIR|locus:2115250315 GBF1 "G-box binding factor 1" 0.464 0.580 0.357 4.2e-30
TAIR|locus:2031705389 bZIP68 "basic region/leucine z 0.459 0.465 0.383 6.8e-30
TAIR|locus:2143191186 bZIP3 "AT5G15830" [Arabidopsis 0.253 0.537 0.396 1.5e-10
TAIR|locus:2012413138 bZIP "AT1G68880" [Arabidopsis 0.205 0.586 0.494 6.8e-10
TAIR|locus:2092595173 bZIP42 "AT3G30530" [Arabidopsi 0.175 0.398 0.513 1.1e-09
TAIR|locus:2166650165 bZIP43 "AT5G38800" [Arabidopsi 0.180 0.430 0.445 1.1e-09
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.197 0.456 0.337 1.6e-09
TAIR|locus:2063020 GBF3 "G-box binding factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 4.8e-56, Sum P(2) = 4.8e-56
 Identities = 108/248 (43%), Positives = 138/248 (55%)

Query:   137 EADGSTDGSDGNTVRAGQSRKKRSREGTPIAGG----DGKTDIQSTP-VPVGVNATPDK- 190
             E DG            G    KRSR  +   G     DG T     P +      TP K 
Sbjct:   138 EFDGLAMSLGNGNPENGADEHKRSRNSSETDGSTDGSDGNTTGADEPKLKRSREGTPTKD 197

Query:   191 ----VLATAVAPTSVSGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPET 246
                 V A++    S S    G  L  G    L    +PG++  ++P  + Q  A++PPET
Sbjct:   198 GKQLVQASSFHSVSPSSGDTGVKLIQGSGAIL----SPGVSANSNPF-MSQSLAMVPPET 252

Query:   247 WIQNERELKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENS 306
             W+QNERELKRERRKQSNRESARRSRLRKQAE EEL+RKV++L  EN +L+SE+NQL+E S
Sbjct:   253 WLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKS 312

Query:   307 EKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGH 366
             +KLR  NA LL+KLK ++           +KRV P    N+LSRV NSG  D+N  +G +
Sbjct:   313 DKLRGANATLLDKLKCSE----------PEKRV-PA---NMLSRVKNSGAGDKNKNQGDN 358

Query:   367 LFEKNSNS 374
               + NS S
Sbjct:   359 --DSNSTS 364
GO:0003677 "DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0000303 "response to superoxide" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009743 "response to carbohydrate stimulus" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2124938 GBF2 "G-box binding factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062455 bZIP16 "basic region/leucine zipper transcription factor 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115250 GBF1 "G-box binding factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031705 bZIP68 "basic region/leucine zipper transcription factor 68" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143191 bZIP3 "AT5G15830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012413 bZIP "AT1G68880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092595 bZIP42 "AT3G30530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166650 bZIP43 "AT5G38800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P42776GBF3_ARATHNo assigned EC number0.49630.86540.8926yesno
Q99089CPRF1_PETCRNo assigned EC number0.50600.99490.9537N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
pfam07777189 pfam07777, MFMR, G-box binding protein MFMR 3e-39
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-22
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 3e-22
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 2e-10
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 2e-08
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 2e-05
pfam11559149 pfam11559, ADIP, Afadin- and alpha -actinin-Bindin 2e-04
pfam03962188 pfam03962, Mnd1, Mnd1 family 2e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 3e-04
COG1340294 COG1340, COG1340, Uncharacterized archaeal coiled- 6e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-04
pfam0600572 pfam06005, DUF904, Protein of unknown function (DU 7e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1340 294 COG1340, COG1340, Uncharacterized archaeal coiled- 0.003
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
pfam11559149 pfam11559, ADIP, Afadin- and alpha -actinin-Bindin 0.004
PRK00106 535 PRK00106, PRK00106, hypothetical protein; Provisio 0.004
>gnl|CDD|219569 pfam07777, MFMR, G-box binding protein MFMR Back     alignment and domain information 
 Score =  138 bits (349), Expect = 3e-39
 Identities = 75/187 (40%), Positives = 91/187 (48%), Gaps = 40/187 (21%)

Query: 1   MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQ 60
           MG++E+GK  KS  P +    D     +Y DW+AMQAYYGPR   PPY+NS +AS   P 
Sbjct: 1   MGSSEEGKPSKS-SPKTSVQEDTPTPTVYPDWSAMQAYYGPRPP-PPYFNSSVASSPQPH 58

Query: 61  PYMWGPAQ-----------------------------GSHAHNHGVPTSPAA--VTPLNT 89
           PYMWGP Q                             GSH  +     S      TPL+ 
Sbjct: 59  PYMWGPQQPMMPPYGTPPPYAAMYPPGGVYAHPSMPPGSHPFSPYAMPSAEVPGSTPLSM 118

Query: 90  EAPTKSSGNADRGLAKKLKGLD---GLAMSIGNASAESAEGG-AEQRPSQSE---ADGST 142
           E   KSS N D+G  KK KG D   GLAMS  N  +  A G  A    SQS    +DGS+
Sbjct: 119 ETDAKSSDNKDKGSIKKSKGSDGSLGLAMSGKNGESGKASGSSANGGSSQSSESGSDGSS 178

Query: 143 DGSDGNT 149
           +GSDGN+
Sbjct: 179 EGSDGNS 185

This region is found to the N-terminus of the pfam00170 transcription factor domain. It is between 150 and 200 amino acids in length. The N-terminal half is rather rich in proline residues and has been termed the PRD (proline rich domain), whereas the C-terminal half is more polar and has been called the MFMR (multifunctional mosaic region). It has been suggested that this family is composed of three sub-families called A, B and C, classified according to motif composition. It has been suggested that some of these motifs may be involved in mediating protein-protein interactions. The MFMR region contains a nuclear localisation signal in bZIP opaque and GBF-2. The MFMR also contains a transregulatory activity in TAF-1. The MFMR in CPRF-2 contains cytoplasmic retention signals. Length = 189
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|192773 pfam11559, ADIP, Afadin- and alpha -actinin-Binding Back     alignment and domain information
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|203371 pfam06005, DUF904, Protein of unknown function (DUF904) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|192773 pfam11559, ADIP, Afadin- and alpha -actinin-Binding Back     alignment and domain information
>gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 394
PF07777189 MFMR: G-box binding protein MFMR; InterPro: IPR012 100.0
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.43
smart0033865 BRLZ basic region leucin zipper. 99.39
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 99.25
KOG3584348 consensus cAMP response element binding protein an 99.22
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.22
KOG0709472 consensus CREB/ATF family transcription factor [Tr 99.14
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.08
KOG0837279 consensus Transcriptional activator of the JUN fam 98.38
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.3
KOG3119269 consensus Basic region leucine zipper transcriptio 97.95
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.63
KOG4571294 consensus Activating transcription factor 4 [Trans 97.53
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.89
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.66
PRK13169110 DNA replication intiation control protein YabA; Re 96.38
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 96.24
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.02
PRK10884206 SH3 domain-containing protein; Provisional 95.64
COG4467114 Regulator of replication initiation timing [Replic 95.58
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.2
TIGR0244965 conserved hypothetical protein TIGR02449. Members 95.11
TIGR0244965 conserved hypothetical protein TIGR02449. Members 95.04
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.89
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.46
PRK10884206 SH3 domain-containing protein; Provisional 94.41
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 94.28
PF1374789 DUF4164: Domain of unknown function (DUF4164) 94.24
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.1
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 93.76
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 93.5
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 93.34
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 93.34
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 93.25
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.19
PRK1542279 septal ring assembly protein ZapB; Provisional 93.0
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 92.85
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 92.64
PRK0211973 hypothetical protein; Provisional 92.63
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 92.56
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 92.39
PRK0029568 hypothetical protein; Provisional 92.39
PRK0073668 hypothetical protein; Provisional 92.36
PRK0432574 hypothetical protein; Provisional 92.33
PRK0279372 phi X174 lysis protein; Provisional 92.31
PRK0440675 hypothetical protein; Provisional 91.98
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.98
KOG3650120 consensus Predicted coiled-coil protein [General f 91.35
PRK0084677 hypothetical protein; Provisional 91.13
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 91.1
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 91.04
PRK13922276 rod shape-determining protein MreC; Provisional 91.0
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 90.95
KOG1962216 consensus B-cell receptor-associated protein and r 90.73
PRK11637 428 AmiB activator; Provisional 90.53
PRK13169110 DNA replication intiation control protein YabA; Re 90.53
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.52
PF10186 302 Atg14: UV radiation resistance protein and autopha 90.42
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.28
COG307479 Uncharacterized protein conserved in bacteria [Fun 89.97
PRK11637 428 AmiB activator; Provisional 89.93
PRK00888105 ftsB cell division protein FtsB; Reviewed 89.64
smart0033865 BRLZ basic region leucin zipper. 89.62
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 89.09
KOG3335181 consensus Predicted coiled-coil protein [General f 89.09
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 88.8
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 88.73
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 88.73
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 88.69
PRK1542279 septal ring assembly protein ZapB; Provisional 88.44
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 88.38
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 88.18
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 88.14
KOG4196135 consensus bZIP transcription factor MafK [Transcri 88.1
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 87.85
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 87.81
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 87.73
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 87.73
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 87.6
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 87.31
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 87.22
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 87.12
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 87.11
PRK10803263 tol-pal system protein YbgF; Provisional 86.98
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 86.72
PRK00888105 ftsB cell division protein FtsB; Reviewed 86.55
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 86.49
COG4942 420 Membrane-bound metallopeptidase [Cell division and 86.2
COG4467114 Regulator of replication initiation timing [Replic 86.18
PF15294278 Leu_zip: Leucine zipper 86.16
COG2433 652 Uncharacterized conserved protein [Function unknow 86.16
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 85.83
PF13851201 GAS: Growth-arrest specific micro-tubule binding 85.59
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 84.91
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 84.9
PF14662193 CCDC155: Coiled-coil region of CCDC155 84.86
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 84.86
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 84.7
PHA02562 562 46 endonuclease subunit; Provisional 84.58
PF14662193 CCDC155: Coiled-coil region of CCDC155 84.58
PRK0211973 hypothetical protein; Provisional 84.37
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 84.24
COG4026290 Uncharacterized protein containing TOPRIM domain, 84.08
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 84.01
PRK0440675 hypothetical protein; Provisional 84.01
KOG3119269 consensus Basic region leucine zipper transcriptio 83.91
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 83.85
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 83.63
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 83.41
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 83.22
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 83.09
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 83.08
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 83.07
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 83.06
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 83.02
KOG4797123 consensus Transcriptional regulator [Transcription 82.76
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 82.56
PF10186 302 Atg14: UV radiation resistance protein and autopha 82.35
PRK09039343 hypothetical protein; Validated 82.25
COG290072 SlyX Uncharacterized protein conserved in bacteria 82.13
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 82.11
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 82.0
KOG1962216 consensus B-cell receptor-associated protein and r 81.79
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 81.63
PF13815118 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro 81.61
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 81.46
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 81.36
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 81.09
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 80.78
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 80.61
PRK0279372 phi X174 lysis protein; Provisional 80.52
PF01486100 K-box: K-box region; InterPro: IPR002487 MADS gene 80.39
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 80.1
PF07412200 Geminin: Geminin; InterPro: IPR022786 This family 80.1
>PF07777 MFMR: G-box binding protein MFMR; InterPro: IPR012900 This region is found to the N terminus of IPR011616 from INTERPRO, which is a transcription factor domain Back     alignment and domain information 
Probab=100.00  E-value=1.3e-51  Score=379.47  Aligned_cols=152  Identities=57%  Similarity=0.942  Sum_probs=131.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCChhhhhhhcCCCCCCCCCCCCCCCCCCCCCCcccCCCC-CCC--------
Q 016182            1 MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQ-GSH--------   71 (394)
Q Consensus         1 MG~~e~~~~~K~~K~ss~~~~~q~~~~~yPDWs~mQAYygp~v~~Pp~f~s~vas~~~phPYmWG~q~-g~~--------   71 (394)
                      ||++|++|++|++|++++++++|+++|+||||++|||||||| ++|+||+++||++|+|||||||+|| .++        
T Consensus         1 MG~~E~~~~~k~~k~~s~~~~~~~~~~~ypDWs~mQAYyg~~-~~p~~f~s~va~sp~phPYMWG~~q~mmPPYGtP~pY   79 (189)
T PF07777_consen    1 MGSSEEGKPSKSSKPSSPPPEDQPTPHVYPDWSAMQAYYGPG-APPPYFNSAVASSPQPHPYMWGPQQPMMPPYGTPVPY   79 (189)
T ss_pred             CCCccCCcCCCCCCCCCCCcCCCCCCccCCccHhhhhccCCC-CCCcccCcccCCCCCCCCcccCCCccccCCCCCCCCC
Confidence            999999999999999887655899999999999999999999 8889999999999999999999776 333        


Q ss_pred             ----CCCCCC--CCCCC----------------CCCCCCccC-CCCCCCCcchhhhhhhccCC-CcccccCCCCCCCCCC
Q 016182           72 ----AHNHGV--PTSPA----------------AVTPLNTEA-PTKSSGNADRGLAKKLKGLD-GLAMSIGNASAESAEG  127 (394)
Q Consensus        72 ----p~g~~~--~~~P~----------------~~tp~s~e~-~~Kss~~kd~~~~Kk~Kg~~-Gl~ms~g~g~~~~~~g  127 (394)
                          |||..+  +..|.                .++|+++|+ ++|++++|||+++||||||| ||+|++|||+.+|+++
T Consensus        80 ~A~YphGgvYAHP~mp~~s~p~~~~~~~s~~~~~~tp~s~E~~p~Kss~~kd~~~~KksKg~~g~~a~s~~n~~~gk~~~  159 (189)
T PF07777_consen   80 PAMYPHGGVYAHPSMPPGSHPFSPYAMPSPETPAATPLSTETDPGKSSGNKDKGSMKKSKGFDGGLAMSIKNGESGKTSG  159 (189)
T ss_pred             ccccCCCccccCCCCCcccccCCCcccccccccCCCCcccccccccCcCccccccccccccccccceeeccCCccCcccc
Confidence                343311  11121                268999999 69999999999999999999 6999999999999998


Q ss_pred             C-CCCCCCCC---CCCCCCCCCCCCccccc
Q 016182          128 G-AEQRPSQS---EADGSTDGSDGNTVRAG  153 (394)
Q Consensus       128 ~-s~~~~SqS---~segsSdgsd~Ns~~~s  153 (394)
                      + +|++.|||   .+||||||||+|+++++
T Consensus       160 ~s~n~~~Sqs~eSgsegSSdgSD~Nt~~~~  189 (189)
T PF07777_consen  160 SSANDGSSQSSESGSEGSSDGSDGNTNNDS  189 (189)
T ss_pred             CCCCCccCccccccccccccCcCccccCCC
Confidence            4 58899997   47999999999999864

It is between 150 and 200 amino acids in length. The N-terminal half is rather rich in proline residues and has been termed the PRD (proline rich domain) [], whereas the C-terminal half is more polar and has been called the MFMR (multifunctional mosaic region). It has been suggested that this family is composed of three sub-families called A, B and C [], classified according to motif composition. It has been suggested that some of these motifs may be involved in mediating protein-protein interactions []. The MFMR region contains a nuclear localisation signal in bZIP opaque and GBF-2 []. The MFMR also contains a transregulatory activity in TAF-1. The MFMR in CPRF-2 contains cytoplasmic retention signals []. ; GO: 0003677 DNA binding, 0006351 transcription, DNA-dependent, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG3335 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>KOG4797 consensus Transcriptional regulator [Transcription] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF01486 K-box: K-box region; InterPro: IPR002487 MADS genes in plants encode key developmental regulators of vegetative and reproductive development Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF07412 Geminin: Geminin; InterPro: IPR022786 This family contains the eukaryotic protein geminin (approximately 200 residues long) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-15
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 2e-15
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 1e-14
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 2e-14
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 3e-14
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 3e-14
2wt7_B90 Transcription factor MAFB; transcription, transcri 2e-12
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 6e-11
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 3e-10
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 6e-10
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 7e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 6e-05
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 7e-04
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
 Score = 69.7 bits (171), Expect = 2e-15
 Identities = 16/58 (27%), Positives = 34/58 (58%)

Query: 254 LKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQ 311
           +K+ ++ + N+ +A R R +K+AE E L+ +   L  +N +LK   + L++  + L+ 
Sbjct: 1   MKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKD 58
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Length = 152 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.5
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.38
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.33
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.28
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.28
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.0
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.85
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.84
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.69
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.42
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.21
1deb_A54 APC protein, adenomatous polyposis coli protein; c 96.7
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.4
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 95.46
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.87
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 94.86
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.84
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 94.49
3m48_A33 General control protein GCN4; leucine zipper, synt 94.27
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 94.04
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 94.01
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 93.77
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 93.62
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.49
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 93.24
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.97
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.87
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 92.84
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 92.77
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 92.74
2bni_A34 General control protein GCN4; four helix bundle, a 92.22
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.2
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.97
1uo4_A34 General control protein GCN4; four helix bundle, c 91.85
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 91.56
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 91.54
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.48
2hy6_A34 General control protein GCN4; protein design, para 91.34
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 91.28
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 90.95
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 90.86
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.84
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 90.56
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.46
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 90.32
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 90.25
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 89.98
4h22_A103 Leucine-rich repeat flightless-interacting protei; 89.86
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 89.85
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 89.7
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 89.19
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 89.02
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 89.02
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 88.85
3cve_A72 Homer protein homolog 1; coiled coil, alternative 88.81
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 88.79
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 88.63
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 88.33
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 88.33
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 88.09
1fmh_A33 General control protein GCN4; coiled coil, leucine 87.62
2wt7_B90 Transcription factor MAFB; transcription, transcri 87.39
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 87.21
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 86.86
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 86.37
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 86.27
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 86.21
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 86.16
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 85.96
2wvr_A209 Geminin; DNA replication license, DNA replication 85.78
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 85.55
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 85.09
1jcd_A52 Major outer membrane lipoprotein; protein folding, 84.99
3u06_A 412 Protein claret segregational; motor domain, stalk 84.83
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 84.26
3htk_A60 Structural maintenance of chromosomes protein 5; S 84.19
2v4h_A110 NF-kappa-B essential modulator; transcription, met 84.08
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 84.06
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 83.02
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 82.64
3bas_A89 Myosin heavy chain, striated muscle/general contro 82.6
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 82.51
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 82.13
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 82.05
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 81.97
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 81.92
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 81.85
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 81.79
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 81.61
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 81.26
4h22_A103 Leucine-rich repeat flightless-interacting protei; 80.82
1gmj_A84 ATPase inhibitor; coiled-coil structure, P depende 80.66
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 80.6
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 80.54
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 80.51
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 80.49
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 80.44
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 80.23
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 80.02
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 80.02
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.50  E-value=2.1e-14  Score=108.42  Aligned_cols=52  Identities=37%  Similarity=0.470  Sum_probs=49.2

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 016182          255 KRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENS  306 (394)
Q Consensus       255 KR~RRk~sNRESARRSR~RKq~~leeLe~rV~~L~~EN~~L~~ei~~L~ee~  306 (394)
                      ||++|+++||+||++||.||++|+++|+.+|..|+.||..|..++..|++++
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5889999999999999999999999999999999999999999999987755
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 93.44
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 80.79
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=93.44  E-value=0.017  Score=44.19  Aligned_cols=28  Identities=25%  Similarity=0.547  Sum_probs=23.7

Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 016182          254 LKRERRKQSNRESARRSRLRKQAEAEEL  281 (394)
Q Consensus       254 ~KR~RRk~sNRESARRSR~RKq~~leeL  281 (394)
                      .+-.||+=+||.+|++||+||....++|
T Consensus        47 irDIRRRGKNKvAAqnCRKRKld~~d~l   74 (74)
T d1sknp_          47 IRKIRRRGKNKVAARTCRQRRTDRHDKM   74 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHhcccHHHHHHHHHhhhhhhccC
Confidence            4567799999999999999999876653
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure