Citrus Sinensis ID: 016195
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 393 | ||||||
| 255557425 | 491 | Carboxyl-terminal-processing protease pr | 0.944 | 0.755 | 0.727 | 1e-145 | |
| 297740636 | 500 | unnamed protein product [Vitis vinifera] | 0.882 | 0.694 | 0.723 | 1e-140 | |
| 225463392 | 462 | PREDICTED: carboxyl-terminal-processing | 0.882 | 0.751 | 0.723 | 1e-140 | |
| 356512566 | 442 | PREDICTED: carboxyl-terminal-processing | 0.872 | 0.776 | 0.678 | 1e-138 | |
| 255648018 | 358 | unknown [Glycine max] | 0.895 | 0.983 | 0.664 | 1e-138 | |
| 449459336 | 489 | PREDICTED: carboxyl-terminal-processing | 0.893 | 0.717 | 0.666 | 1e-135 | |
| 224114365 | 468 | predicted protein [Populus trichocarpa] | 0.933 | 0.784 | 0.714 | 1e-134 | |
| 357519225 | 465 | Carboxyl-terminal-processing protease [M | 0.916 | 0.774 | 0.646 | 1e-131 | |
| 388502616 | 465 | unknown [Medicago truncatula] | 0.916 | 0.774 | 0.643 | 1e-131 | |
| 19774137 | 467 | D1 protease-like protein precursor [Nico | 0.796 | 0.670 | 0.717 | 1e-129 |
| >gi|255557425|ref|XP_002519743.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus communis] gi|223541160|gb|EEF42716.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 521 bits (1343), Expect = e-145, Method: Compositional matrix adjust.
Identities = 278/382 (72%), Positives = 311/382 (81%), Gaps = 11/382 (2%)
Query: 6 LNCSSCTSSSLPRLSPHKHSEQKAP---------IIQSNTNWAKKAVINVLTGALSFNLL 56
+N C SS+ LS S KAP + T WA+K + LTG LSFNLL
Sbjct: 1 MNVLLCNSSATLPLSQSSLSSPKAPPTKFSFSLNLNNHTTTWARKTFLGALTGVLSFNLL 60
Query: 57 LSSPLALESSSSVQSVP-PSPSPSLTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDS 115
LSSP +L S S + PSP P+ + E E + + TNEGIVEEAWQIVNDS
Sbjct: 61 LSSPFSLASQSPYPQLQLPSP-PNNSSIEQCQEQEQVEQNQESVTNEGIVEEAWQIVNDS 119
Query: 116 FLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMA 175
FLD GRHRWTPQ+WQ+K+EDILS+SIQ+RSKAH +IKRMLASLGDPYTRFLSPAEFSKMA
Sbjct: 120 FLDAGRHRWTPQSWQQKKEDILSTSIQSRSKAHDLIKRMLASLGDPYTRFLSPAEFSKMA 179
Query: 176 RYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFE 235
RYDMSGIGINLREVP+ NG V LKVLGL+LDGPA++AGV+QGDE+LAVNG DVRGKSAFE
Sbjct: 180 RYDMSGIGINLREVPEENGEVKLKVLGLLLDGPAYTAGVKQGDEILAVNGEDVRGKSAFE 239
Query: 236 VSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLK 295
VSS LQGP+ETFVTI+VKHGNCGPI+S++VQRQLVARTPVFYRLE +D GTTSVGYMRLK
Sbjct: 240 VSSSLQGPNETFVTIKVKHGNCGPIQSLEVQRQLVARTPVFYRLEQVDKGTTSVGYMRLK 299
Query: 296 EFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGR 355
EFNALARKDLV AMKRL+DMGASYFILDLRDNLGGLVQAGIEI+KLFLNEGE + YTVGR
Sbjct: 300 EFNALARKDLVIAMKRLKDMGASYFILDLRDNLGGLVQAGIEISKLFLNEGEKVIYTVGR 359
Query: 356 DPQYQKTIVADNSPLVTAPVIV 377
DPQYQ TIVAD +PLVTAPVIV
Sbjct: 360 DPQYQNTIVADTAPLVTAPVIV 381
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297740636|emb|CBI30818.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225463392|ref|XP_002271932.1| PREDICTED: carboxyl-terminal-processing protease [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356512566|ref|XP_003524989.1| PREDICTED: carboxyl-terminal-processing protease-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255648018|gb|ACU24465.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449459336|ref|XP_004147402.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis sativus] gi|449529666|ref|XP_004171819.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224114365|ref|XP_002316739.1| predicted protein [Populus trichocarpa] gi|222859804|gb|EEE97351.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357519225|ref|XP_003629901.1| Carboxyl-terminal-processing protease [Medicago truncatula] gi|355523923|gb|AET04377.1| Carboxyl-terminal-processing protease [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388502616|gb|AFK39374.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|19774137|gb|AAL99045.1|AF487527_1 D1 protease-like protein precursor [Nicotiana plumbaginifolia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 393 | ||||||
| TAIR|locus:2170443 | 489 | AT5G46390 [Arabidopsis thalian | 0.720 | 0.578 | 0.709 | 9e-109 | |
| UNIPROTKB|P75023 | 462 | ctpB "Carboxyl-terminal protea | 0.715 | 0.608 | 0.311 | 9.5e-34 | |
| UNIPROTKB|P73458 | 423 | prc "Carboxyl-terminal proteas | 0.664 | 0.617 | 0.320 | 6e-32 | |
| TAIR|locus:2129411 | 515 | AT4G17740 [Arabidopsis thalian | 0.625 | 0.477 | 0.310 | 8.1e-28 | |
| TIGR_CMR|GSU_1772 | 443 | GSU_1772 "carboxy-terminal pro | 0.549 | 0.487 | 0.294 | 1.3e-18 | |
| TIGR_CMR|CHY_0170 | 377 | CHY_0170 "carboxyl-terminal pr | 0.575 | 0.599 | 0.297 | 2.1e-18 | |
| TIGR_CMR|SPO_3812 | 443 | SPO_3812 "carboxyl-terminal pr | 0.536 | 0.476 | 0.334 | 1.7e-16 | |
| TIGR_CMR|GSU_0969 | 450 | GSU_0969 "carboxy-terminal pro | 0.501 | 0.437 | 0.308 | 2.3e-15 | |
| TIGR_CMR|DET_0364 | 377 | DET_0364 "carboxyl-terminal pr | 0.595 | 0.620 | 0.268 | 2.4e-13 | |
| TIGR_CMR|BA_5414 | 469 | BA_5414 "carboxyl-terminal pro | 0.541 | 0.454 | 0.253 | 2.3e-12 |
| TAIR|locus:2170443 AT5G46390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1075 (383.5 bits), Expect = 9.0e-109, P = 9.0e-109
Identities = 203/286 (70%), Positives = 247/286 (86%)
Query: 92 EPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGII 151
EP+ V TNEGIVEEAW+IVN +FLDT H WTP+ WQ++++DIL+S I++RSKAH +I
Sbjct: 113 EPQLV---TNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDILASPIKSRSKAHEVI 169
Query: 152 KRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHS 211
K MLASLGD YTRFLSP EFS+M++YD++GIGINLREV D G V LKVLGL+LD A
Sbjct: 170 KNMLASLGDQYTRFLSPDEFSRMSKYDITGIGINLREVSDGGGNVKLKVLGLVLDSAADI 229
Query: 212 AGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVA 271
AGV+QGDE+LAVNG+DV GKS+FEVSSLLQGPS+TFV ++VKHG CGP++S+++QRQ+ A
Sbjct: 230 AGVKQGDEILAVNGMDVSGKSSFEVSSLLQGPSKTFVVLKVKHGKCGPVKSLKIQRQVNA 289
Query: 272 RTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGL 331
+TPV YRLE +DNGT SVGY+RLKEFNALARKDLV AMKRL D GASYF++DLRDNLGGL
Sbjct: 290 QTPVSYRLEKVDNGTVSVGYIRLKEFNALARKDLVIAMKRLLDKGASYFVMDLRDNLGGL 349
Query: 332 VQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIV 377
VQAGIE AKLFL+EG+T+ YT GRDP+ QKT+V+D PL+TAP+IV
Sbjct: 350 VQAGIETAKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPLIV 395
|
|
| UNIPROTKB|P75023 ctpB "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P73458 prc "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129411 AT4G17740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1772 GSU_1772 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0170 CHY_0170 "carboxyl-terminal protease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3812 SPO_3812 "carboxyl-terminal protease family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0969 GSU_0969 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0364 DET_0364 "carboxyl-terminal protease" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5414 BA_5414 "carboxyl-terminal protease" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 393 | |||
| PLN00049 | 389 | PLN00049, PLN00049, carboxyl-terminal processing p | 3e-51 | |
| TIGR00225 | 334 | TIGR00225, prc, C-terminal peptidase (prc) | 2e-43 | |
| COG0793 | 406 | COG0793, Prc, Periplasmic protease [Cell envelope | 1e-38 | |
| smart00245 | 192 | smart00245, TSPc, tail specific protease | 2e-22 | |
| TIGR03900 | 973 | TIGR03900, prc_long_Delta, putative carboxyl-termi | 2e-22 | |
| cd07560 | 211 | cd07560, Peptidase_S41_CPP, C-terminal processing | 9e-22 | |
| pfam03572 | 166 | pfam03572, Peptidase_S41, Peptidase family S41 | 2e-19 | |
| cd00988 | 85 | cd00988, PDZ_CTP_protease, PDZ domain of C-termina | 5e-18 | |
| cd06567 | 224 | cd06567, Peptidase_S41, C-terminal processing pept | 7e-16 | |
| smart00228 | 85 | smart00228, PDZ, Domain present in PSD-95, Dlg, an | 1e-11 | |
| cd00992 | 82 | cd00992, PDZ_signaling, PDZ domain found in a vari | 7e-11 | |
| cd00136 | 70 | cd00136, PDZ, PDZ domain, also called DHR (Dlg hom | 2e-10 | |
| cd07563 | 250 | cd07563, Peptidase_S41_IRBP, Interphotoreceptor re | 2e-07 | |
| cd07561 | 256 | cd07561, Peptidase_S41_CPP_like, C-terminal proces | 3e-07 | |
| pfam00595 | 80 | pfam00595, PDZ, PDZ domain (Also known as DHR or G | 3e-06 | |
| pfam13180 | 81 | pfam13180, PDZ_2, PDZ domain | 2e-05 | |
| cd06567 | 224 | cd06567, Peptidase_S41, C-terminal processing pept | 3e-05 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 3e-05 | |
| cd00990 | 80 | cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass | 5e-04 | |
| cd07021 | 178 | cd07021, Clp_protease_NfeD_like, Nodulation format | 8e-04 | |
| cd00989 | 79 | cd00989, PDZ_metalloprotease, PDZ domain of bacter | 0.002 |
| >gnl|CDD|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
Score = 175 bits (446), Expect = 3e-51
Identities = 89/253 (35%), Positives = 141/253 (55%), Gaps = 14/253 (5%)
Query: 107 EAWQIVNDSFLDTGRHRWTPQNWQRKREDIL-SSSIQTRSKAHGIIKRMLASLGDPYTRF 165
EAW+ V+ +++D + Q+W R RE+ L + + TR + + I++MLA+L DP+TRF
Sbjct: 11 EAWRTVDRAYVDKT---FNGQSWFRYRENALKNEPMNTREETYAAIRKMLATLDDPFTRF 67
Query: 166 LSPAEFSKMAR---YDMSGIGINLREVPDANGVVT-LKVLGLILDGPAHSAGVRQGDEVL 221
L P +F + ++G+G+ + ++G L V+ GPA AG+R GD +L
Sbjct: 68 LEPEKFKSLRSGTKGAVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGIRPGDVIL 127
Query: 222 AVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRL-- 279
A++G G S +E + LQGP + V + ++ G + + R+ V+ PV RL
Sbjct: 128 AIDGTSTEGLSLYEAADRLQGPEGSSVELTLRRG--PETRLVTLTREKVSLNPVKSRLCE 185
Query: 280 -EHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEI 338
G+ +GY++L FN A + A++ L+ G F+LDLRDN GGL AGIEI
Sbjct: 186 VPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNSGGLFPAGIEI 245
Query: 339 AKLFLNEGETITY 351
AKL+L++G I Y
Sbjct: 246 AKLWLDKG-VIVY 257
|
Length = 389 |
| >gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|214582 smart00245, TSPc, tail specific protease | Back alignment and domain information |
|---|
| >gnl|CDD|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial | Back alignment and domain information |
|---|
| >gnl|CDD|143476 cd07560, Peptidase_S41_CPP, C-terminal processing peptidase; serine protease family S41 | Back alignment and domain information |
|---|
| >gnl|CDD|217620 pfam03572, Peptidase_S41, Peptidase family S41 | Back alignment and domain information |
|---|
| >gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >gnl|CDD|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41 | Back alignment and domain information |
|---|
| >gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >gnl|CDD|143479 cd07563, Peptidase_S41_IRBP, Interphotoreceptor retinoid-binding protein; serine protease family S41 | Back alignment and domain information |
|---|
| >gnl|CDD|143477 cd07561, Peptidase_S41_CPP_like, C-terminal processing peptidase-like; serine protease family S41 | Back alignment and domain information |
|---|
| >gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) | Back alignment and domain information |
|---|
| >gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41 | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >gnl|CDD|132932 cd07021, Clp_protease_NfeD_like, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 393 | |||
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 100.0 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 100.0 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 100.0 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 100.0 | |
| cd06567 | 224 | Peptidase_S41 C-terminal processing peptidase fami | 99.92 | |
| cd07562 | 266 | Peptidase_S41_TRI Tricorn protease; serine proteas | 99.91 | |
| cd07563 | 250 | Peptidase_S41_IRBP Interphotoreceptor retinoid-bin | 99.87 | |
| smart00245 | 192 | TSPc tail specific protease. tail specific proteas | 99.84 | |
| cd07560 | 211 | Peptidase_S41_CPP C-terminal processing peptidase; | 99.82 | |
| cd07561 | 256 | Peptidase_S41_CPP_like C-terminal processing pepti | 99.8 | |
| PF03572 | 169 | Peptidase_S41: Peptidase family S41; InterPro: IPR | 99.62 | |
| PF14684 | 70 | Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_ | 99.39 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 99.32 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 99.2 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.98 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 98.93 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.8 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.8 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 98.73 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 98.67 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.67 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.66 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.63 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 98.51 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 98.3 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.27 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 98.24 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.23 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 98.19 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 98.19 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.19 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.19 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 98.18 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 98.16 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 98.13 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 98.11 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 98.05 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 97.92 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 97.9 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 97.9 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.87 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 97.83 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 97.81 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 97.67 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 97.63 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 97.56 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 97.45 | |
| KOG3549 | 505 | consensus Syntrophins (type gamma) [Extracellular | 97.4 | |
| KOG3551 | 506 | consensus Syntrophins (type beta) [Extracellular s | 97.35 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 97.32 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 97.08 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 96.85 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 96.8 | |
| KOG3651 | 429 | consensus Protein kinase C, alpha binding protein | 96.75 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 96.59 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 96.46 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 96.43 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 96.35 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 96.15 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 96.03 | |
| KOG0609 | 542 | consensus Calcium/calmodulin-dependent serine prot | 95.71 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 95.5 | |
| KOG3606 | 358 | consensus Cell polarity protein PAR6 [Signal trans | 95.36 | |
| KOG3571 | 626 | consensus Dishevelled 3 and related proteins [Gene | 95.05 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 94.9 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 94.47 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 94.45 | |
| KOG3834 | 462 | consensus Golgi reassembly stacking protein GRASP6 | 93.24 | |
| KOG3605 | 829 | consensus Beta amyloid precursor-binding protein [ | 91.72 | |
| KOG3834 | 462 | consensus Golgi reassembly stacking protein GRASP6 | 91.35 | |
| KOG3938 | 334 | consensus RGS-GAIP interacting protein GIPC, conta | 90.8 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 90.52 | |
| KOG1738 | 638 | consensus Membrane-associated guanylate kinase-int | 90.12 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 89.59 | |
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 83.81 |
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.6e-50 Score=403.02 Aligned_cols=287 Identities=33% Similarity=0.561 Sum_probs=242.0
Q ss_pred cChHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHhhh-cccChHHHHHHHHHHHHhcCCCceeecCHHHHhhhc--
Q 016195 99 KTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS-SIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMA-- 175 (393)
Q Consensus 99 ~~~~~~f~~~W~~v~~~y~d~~~~~~~~~dW~~v~~~y~~~-~i~t~~~~~~~i~~ml~~L~D~ht~~~~~~e~~~~~-- 175 (393)
+++.++|+++|++++++|||+. |+++||++++++|++. .+++.++++.+|++|+++|+|||++|++++++..+.
T Consensus 3 ~~~~~~f~e~w~~v~~~~~d~~---~~g~dW~~~~e~y~~~~~~~~~~~~~~~i~~ml~~L~D~hs~y~~~~~~~~~~~~ 79 (389)
T PLN00049 3 TEENLLFLEAWRTVDRAYVDKT---FNGQSWFRYRENALKNEPMNTREETYAAIRKMLATLDDPFTRFLEPEKFKSLRSG 79 (389)
T ss_pred ccHHHHHHHHHHHHHHHHcCcc---ccccCHHHHHHHHhhccCCCcHHHHHHHHHHHHhhCCCCcccCcCHHHHHHHHHh
Confidence 4789999999999999999994 8999999999999874 467888999999999999999999999999987543
Q ss_pred -cCceeeeEEEEEEeeCCCC-eeEEEEEEEcCCChhhhcCCCCCCEEEEECCEEcCCCCHHHHHHHhcCCCCCeEEEEEE
Q 016195 176 -RYDMSGIGINLREVPDANG-VVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVK 253 (393)
Q Consensus 176 -~~~~~glGi~~~~~~~~~G-~~~l~V~~V~~gsPA~~AGL~~GD~IlsVnG~~v~~~~~~~v~~~L~g~~G~~V~Ltv~ 253 (393)
++.+.|+|+.+...+..++ ...++|..|.++|||+++||++||+|++|||+++.+++..++..++++..|+.|.|++.
T Consensus 80 ~~~~~~GiG~~~~~~~~~~~~~~g~~V~~V~~~SPA~~aGl~~GD~Iv~InG~~v~~~~~~~~~~~l~g~~g~~v~ltv~ 159 (389)
T PLN00049 80 TKGAVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGIRPGDVILAIDGTSTEGLSLYEAADRLQGPEGSSVELTLR 159 (389)
T ss_pred ccCCceEEEEEEEEccCCCCccCcEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEE
Confidence 5778999999876432110 01378999999999999999999999999999999988888888999999999999999
Q ss_pred eCCCCceEEEEEEeeccccCceeeeeee---ecCCCceEEEEEeCccchhHHHHHHHHHHHHHHCCCCeEEEEccCCCCC
Q 016195 254 HGNCGPIESIQVQRQLVARTPVFYRLEH---LDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGG 330 (393)
Q Consensus 254 r~~~~~~~~v~l~r~~~~~~~v~~~~~~---l~~~~~~igYI~i~~F~~~~~~~l~~al~~l~~~g~~~lIlDLR~N~GG 330 (393)
|++ ...+++++|+.+..++|.+.... .+.++++||||+|++|...+.+++.++|++++++++++||||||+|+||
T Consensus 160 r~g--~~~~~~l~r~~v~~~~v~~~~~~~~~~~~~~~~IgYi~i~~F~~~~~~~~~~~l~~l~~~~~~glIlDLR~N~GG 237 (389)
T PLN00049 160 RGP--ETRLVTLTREKVSLNPVKSRLCEVPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNSGG 237 (389)
T ss_pred ECC--EEEEEEEEeeeEeccceeeEEEeeccccCCCCCEEEEEeccccchhHHHHHHHHHHHHHCCCCEEEEEcCCCCCC
Confidence 976 57888999988887888765432 1223568999999999999999999999999999999999999999999
Q ss_pred cHHHHHHHHhccccCCcEEEEEeccCcccceeeecCCC--CCCCCcEEEEEcCCCcccccceec
Q 016195 331 LVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNS--PLVTAPVIVCAPAFKMRQQLFFYI 392 (393)
Q Consensus 331 ~l~~a~~ia~lfl~~g~~v~~~~~r~~~~~~~~~~~~~--~~~~~PlvVLVN~~TaSaAE~fa~ 392 (393)
.+..++.++++|+++|. ++++..+.+.. ..+..++. ..+.+|++||||+.|+||||+|+.
T Consensus 238 ~~~~a~~ia~~f~~~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~~PvvVLvn~~TaSasEi~a~ 299 (389)
T PLN00049 238 LFPAGIEIAKLWLDKGV-IVYIADSRGVR-DIYDADGSSAIATSEPLAVLVNKGTASASEILAG 299 (389)
T ss_pred CHHHHHHHHHHhcCCCc-EEEEecCCCce-eEEecCCCccccCCCCEEEEECCCCccHHHHHHH
Confidence 99999999999999986 44655444332 22333332 247899999999999999999973
|
|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >cd06567 Peptidase_S41 C-terminal processing peptidase family S41 | Back alignment and domain information |
|---|
| >cd07562 Peptidase_S41_TRI Tricorn protease; serine protease family S41 | Back alignment and domain information |
|---|
| >cd07563 Peptidase_S41_IRBP Interphotoreceptor retinoid-binding protein; serine protease family S41 | Back alignment and domain information |
|---|
| >smart00245 TSPc tail specific protease | Back alignment and domain information |
|---|
| >cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41 | Back alignment and domain information |
|---|
| >cd07561 Peptidase_S41_CPP_like C-terminal processing peptidase-like; serine protease family S41 | Back alignment and domain information |
|---|
| >PF03572 Peptidase_S41: Peptidase family S41; InterPro: IPR005151 This group of putative serine peptidases belong to the MEROPS peptidase family S41 (C-terminal processing peptidase family, clan SM) | Back alignment and domain information |
|---|
| >PF14684 Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3551 consensus Syntrophins (type beta) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 393 | ||||
| 1fc7_A | 388 | Photosystem Ii D1 C-Terminal Processing Protease Le | 3e-27 | ||
| 1fc6_A | 388 | Photosystem Ii D1 C-Terminal Processing Protease Le | 2e-26 | ||
| 3k50_A | 403 | Crystal Structure Of Putative S41 Protease (Yp_2116 | 9e-05 | ||
| 2he2_A | 102 | Crystal Structure Of The 3rd Pdz Domain Of Human Di | 2e-04 |
| >pdb|1FC7|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 | Back alignment and structure |
|
| >pdb|1FC6|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 | Back alignment and structure |
| >pdb|3K50|A Chain A, Crystal Structure Of Putative S41 Protease (Yp_211611.1) From Bacteroides Fragilis Nctc 9343 At 2.00 A Resolution Length = 403 | Back alignment and structure |
| >pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 393 | |||
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 7e-60 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 2e-37 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 1e-24 | |
| 1j7x_A | 302 | IRBP, interphotoreceptor retinoid-binding protein; | 2e-17 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 3e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-13 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 2e-11 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 1e-10 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 1e-10 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 1e-10 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 2e-10 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 5e-10 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 6e-10 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 9e-10 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 9e-10 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 1e-09 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 1e-09 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 2e-09 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 2e-09 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 3e-09 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 5e-09 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 5e-09 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 5e-09 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 5e-09 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 6e-09 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 7e-09 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 7e-09 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 7e-09 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 1e-08 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 1e-08 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 1e-08 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 2e-08 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 2e-08 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 2e-08 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 2e-08 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 3e-08 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 3e-08 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 3e-08 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 4e-08 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 4e-08 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 4e-08 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 2e-06 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 5e-08 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 5e-08 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 6e-08 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 6e-08 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 6e-08 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 6e-08 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 7e-08 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 8e-08 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 9e-08 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 1e-07 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 1e-07 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 1e-07 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 1e-07 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 1e-07 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 1e-07 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 5e-07 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 1e-07 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 1e-07 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 2e-07 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 2e-07 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 2e-07 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 2e-07 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 3e-07 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 3e-07 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 3e-07 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 3e-07 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 6e-06 | |
| 3dor_A | 583 | Protein CT_858, CPAF; mature CPAF, dimer, transfer | 3e-07 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 4e-07 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 4e-07 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 4e-07 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 3e-05 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 4e-07 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 1e-06 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 4e-07 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 5e-07 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 5e-07 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 5e-07 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 5e-07 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 5e-07 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 6e-07 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 6e-07 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 6e-07 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 6e-07 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 7e-07 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 7e-07 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 9e-07 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 9e-07 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 9e-07 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 1e-06 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 1e-06 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 1e-06 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 1e-06 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 1e-06 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 1e-06 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 2e-06 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 2e-06 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 2e-06 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 2e-06 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 2e-06 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 3e-06 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 3e-06 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 3e-06 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 3e-06 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 3e-06 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 3e-06 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 3e-06 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 4e-06 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 4e-06 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 4e-06 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 4e-06 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 5e-06 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 5e-06 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 5e-06 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 5e-06 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 6e-06 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 6e-06 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 6e-06 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 7e-06 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 2e-05 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 7e-06 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 8e-06 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 8e-06 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 9e-06 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 9e-06 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 1e-05 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 1e-05 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 1e-05 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 1e-05 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 2e-05 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 2e-05 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 2e-05 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 2e-05 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 2e-05 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 2e-05 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 2e-05 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 2e-05 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 3e-05 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 3e-05 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 3e-05 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 4e-05 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 5e-05 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 5e-05 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 5e-05 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 5e-05 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 5e-05 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 6e-05 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 7e-05 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 7e-05 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 9e-05 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 1e-04 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 1e-04 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 2e-04 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 2e-04 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 2e-04 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 2e-04 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 2e-04 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 2e-04 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 2e-04 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 2e-04 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 3e-04 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 3e-04 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 3e-04 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 3e-04 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 5e-04 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 8e-04 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 9e-04 |
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 | Back alignment and structure |
|---|
Score = 197 bits (504), Expect = 7e-60
Identities = 81/290 (27%), Positives = 141/290 (48%), Gaps = 25/290 (8%)
Query: 104 IVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSS-IQTRSKAHGIIKRMLASLGDPY 162
+ EAW+ V+ +++D + Q+W + RE L + R++ + I++MLA L DP+
Sbjct: 8 LFLEAWRAVDRAYVDK---SFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPF 64
Query: 163 TRFLSPAEFSKMARYDMS----GIGINLREVPDANGVVT-LKVLGLILDGPAHSAGVRQG 217
TRFL P+ + + R + G+G+ E+ G + VL GPA AG R G
Sbjct: 65 TRFLEPSRLAAL-RRGTAGSVTGVGL---EITYDGGSGKDVVVLTPAPGGPAEKAGARAG 120
Query: 218 DEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKH-GNCGPIESIQVQRQLVARTPVF 276
D ++ V+G V+G S ++VS LLQG +++ V + + G ++Q+ RQ V PV
Sbjct: 121 DVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVT 180
Query: 277 YRL--------EHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNL 328
+ +GY+RL FN+ A L G + +LD+R+N
Sbjct: 181 FTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNG 240
Query: 329 GGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVT-APVIV 377
GGL AG+ +A++ ++ G+ + + AD + + + P++V
Sbjct: 241 GGLFPAGVNVARMLVDRGD-LVLIADSQGI-RDIYSADGNSIDSATPLVV 288
|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 | Back alignment and structure |
|---|
| >1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 Length = 302 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 | Back alignment and structure |
|---|
| >3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A Length = 583 | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 393 | |||
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 100.0 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 100.0 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 100.0 | |
| 3dor_A | 583 | Protein CT_858, CPAF; mature CPAF, dimer, transfer | 99.7 | |
| 1j7x_A | 302 | IRBP, interphotoreceptor retinoid-binding protein; | 99.7 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 99.43 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 99.37 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 99.36 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 99.35 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 99.3 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 99.24 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 99.23 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 99.22 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 99.21 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 99.2 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.19 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 99.19 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 99.19 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 99.19 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 99.19 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 99.17 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 99.17 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 99.16 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 99.15 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 99.15 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 99.14 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 99.14 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 99.13 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 99.13 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 99.12 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 99.12 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 99.12 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 99.11 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 99.11 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 99.09 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 99.09 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 99.09 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 99.08 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 99.07 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 99.07 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 99.06 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 99.06 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 99.06 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 99.06 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 99.06 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 99.06 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 99.06 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 99.06 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 99.05 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 99.05 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 99.05 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 99.05 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.05 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 99.05 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 99.04 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 99.04 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 99.04 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 99.04 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 99.04 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.03 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.03 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.02 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 99.02 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 99.02 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 99.02 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 99.01 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 99.01 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 99.01 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 99.01 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 99.01 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.0 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 99.0 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 99.0 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 99.0 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 98.99 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.99 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.99 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.99 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 98.99 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 98.98 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 98.98 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.98 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 98.98 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.98 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.98 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.98 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.98 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 98.98 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 98.98 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 98.97 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.97 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.96 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 98.96 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.96 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.95 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 98.95 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.94 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.94 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.94 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 98.94 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.94 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.94 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.94 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.94 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.93 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 98.93 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 98.93 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.93 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.93 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 98.92 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 98.92 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 98.91 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.9 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.9 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.9 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.9 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.9 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.9 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 98.89 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 98.89 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.89 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 98.89 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 98.89 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 98.89 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.88 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.88 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 98.88 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.88 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 98.87 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 98.87 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.86 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.86 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 98.86 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.86 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.86 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.85 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.84 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.84 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 98.84 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 98.84 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.84 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.84 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.84 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.84 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 98.83 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.83 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 98.83 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.82 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 98.32 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.82 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.81 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.81 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.8 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 98.8 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.8 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.79 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 98.78 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.76 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.76 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 98.76 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 98.75 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.75 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.75 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 98.75 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 98.74 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.74 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.73 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.73 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 98.73 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.73 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 98.72 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.71 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.7 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.68 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 98.67 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 98.67 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 98.67 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 98.64 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 98.63 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 98.63 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.61 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.6 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.57 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.52 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.51 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.5 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.46 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.44 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.44 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 98.42 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.41 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 98.41 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.24 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.16 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 98.14 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.11 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 98.08 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 97.88 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.83 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 97.76 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 97.7 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 97.49 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 96.37 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 83.26 |
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-48 Score=392.24 Aligned_cols=286 Identities=27% Similarity=0.499 Sum_probs=247.0
Q ss_pred cChHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHhh-hcccChHHHHHHHHHHHHhcCCCceeecCHHHHhhhc--
Q 016195 99 KTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILS-SSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMA-- 175 (393)
Q Consensus 99 ~~~~~~f~~~W~~v~~~y~d~~~~~~~~~dW~~v~~~y~~-~~i~t~~~~~~~i~~ml~~L~D~ht~~~~~~e~~~~~-- 175 (393)
++.+++|+++|+.++++|+++. |++.||++++++|++ ..++++.+++.+|++|+++|+|||++|+++++++.+.
T Consensus 3 ~~~~~~f~~~w~~i~~~y~~~~---~~~~dW~~~~~~y~~~~~~~~~~~~~~~i~~ml~~L~D~hs~~~~~~~~~~~~~~ 79 (388)
T 1fc6_A 3 TSEQLLFLEAWRAVDRAYVDKS---FNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRG 79 (388)
T ss_dssp CHHHHHHHHHHHHHHHHCSCTT---GGGCCHHHHHHHHHHHSCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHC
T ss_pred ccHHHHHHHHHHHHHHHHhccc---ccCccHHHHHHHhhhccCCCCHHHHHHHHHHHHHhcCCCcceecCHHHHHHHHHh
Confidence 4678999999999999999984 899999999999988 5677899999999999999999999999999987653
Q ss_pred -cCceeeeEEEEEEe-eCCCCeeEEEEEEEcCCChhhhcCCCCCCEEEEECCEEcCCCCHHHHHHHhcCCCCCeEEEEEE
Q 016195 176 -RYDMSGIGINLREV-PDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVK 253 (393)
Q Consensus 176 -~~~~~glGi~~~~~-~~~~G~~~l~V~~V~~gsPA~~AGL~~GD~IlsVnG~~v~~~~~~~v~~~L~g~~G~~V~Ltv~ 253 (393)
++.+.|+|+.+... +.. + .++|..|.++|||++|||++||+|++|||+++.++...++..++++..|++|+|+|.
T Consensus 80 ~~g~~~giG~~~~~~~~~~-~--~~~V~~v~~~spA~~aGl~~GD~I~~Ing~~v~~~~~~~~~~~l~~~~g~~v~l~v~ 156 (388)
T 1fc6_A 80 TAGSVTGVGLEITYDGGSG-K--DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLH 156 (388)
T ss_dssp SSSSCBBCSEEEEECTTCS-S--CEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHHHHHCBSTTCEEEEEEE
T ss_pred hcCceEEEEEEEEEeecCC-C--cEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEE
Confidence 57788999999764 212 2 378999999999999999999999999999999998888999999999999999999
Q ss_pred eCCCC-ceEEEEEEeeccccCceeeeeee--------ecCCCceEEEEEeCccchhHHHHHHHHHHHHHHCCCCeEEEEc
Q 016195 254 HGNCG-PIESIQVQRQLVARTPVFYRLEH--------LDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDL 324 (393)
Q Consensus 254 r~~~~-~~~~v~l~r~~~~~~~v~~~~~~--------l~~~~~~igYI~i~~F~~~~~~~l~~al~~l~~~g~~~lIlDL 324 (393)
|++.. +.++++++|+.+...++.+.... .+..+++||||+|++|...+.+++.++|.+|+++++++|||||
T Consensus 157 r~g~~~~~~~~~l~r~~i~~~~v~~~~~~~~~~~~~~~~~~~~~igYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIlDL 236 (388)
T 1fc6_A 157 APGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDI 236 (388)
T ss_dssp ETTEEEEEEEEEEECBCCCCCCEEEEEECSCCGGGSCTTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEEC
T ss_pred eCCCCcceEEEEEEEceeecCceeeeeeccccccccccccCCCCEEEEEeCccCcchHHHHHHHHHHHHhCCCCeEEEEc
Confidence 98732 27889999988887888765421 1233578999999999999999999999999999999999999
Q ss_pred cCCCCCcHHHHHHHHhccccCCcEEEEEeccCcccceeeecCCCCC-CCCcEEEEEcCCCcccccceec
Q 016195 325 RDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPL-VTAPVIVCAPAFKMRQQLFFYI 392 (393)
Q Consensus 325 R~N~GG~l~~a~~ia~lfl~~g~~v~~~~~r~~~~~~~~~~~~~~~-~~~PlvVLVN~~TaSaAE~fa~ 392 (393)
|+|+||.+..+..++++|+++|. ++++.+|.+... .+...+... +++|++||||+.|+||||+|+.
T Consensus 237 R~N~GG~~~~~~~~~~~f~~~~~-i~~~~~r~~~~~-~~~~~~~~~~~~~pv~VLvn~~taSasEi~a~ 303 (388)
T 1fc6_A 237 RNNGGGLFPAGVNVARMLVDRGD-LVLIADSQGIRD-IYSADGNSIDSATPLVVLVNRGTASASEVLAG 303 (388)
T ss_dssp TTCCCBCHHHHHHHHHHHCSSSE-EEEEEETTEEEE-EEECCSCCSCSSSCEEEEECTTCCTHHHHHHH
T ss_pred CCCCCCCHHHHHHHHHHHcCCCc-EEEEecCCCcee-EEecCCccccCCCCEEEEeCCCCccHHHHHHH
Confidence 99999999999999999999885 668888876542 344444444 8999999999999999999973
|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A | Back alignment and structure |
|---|
| >1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 393 | ||||
| d1fc6a4 | 294 | c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C- | 1e-17 | |
| d1fc6a4 | 294 | c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C- | 5e-09 | |
| d1fc6a3 | 92 | b.36.1.3 (A:157-248) Photosystem II D1 C-terminal | 1e-11 | |
| d1k32a4 | 291 | c.14.1.2 (A:680-762,A:854-1061) Tricorn protease { | 2e-11 | |
| d1g9oa_ | 91 | b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, | 5e-11 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 2e-10 | |
| d1ujda_ | 117 | b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human | 5e-10 | |
| d1w9ea1 | 85 | b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie | 2e-09 | |
| d1m5za_ | 91 | b.36.1.1 (A:) Glutamate receptor interacting prote | 3e-09 | |
| d1ueqa_ | 123 | b.36.1.1 (A:) Membrane associated guanylate kinase | 8e-09 | |
| d1x45a1 | 85 | b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei | 1e-08 | |
| d2csja1 | 104 | b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj | 1e-08 | |
| d1x5qa1 | 97 | b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom | 1e-08 | |
| d1q3oa_ | 104 | b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv | 2e-08 | |
| d1n7ea_ | 95 | b.36.1.1 (A:) Glutamate receptor-interacting prote | 2e-08 | |
| d1wi4a1 | 96 | b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou | 3e-08 | |
| d1vb7a_ | 94 | b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus | 3e-08 | |
| d1uita_ | 117 | b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma | 5e-08 | |
| d1x5na1 | 101 | b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) | 5e-08 | |
| d1j7xa_ | 302 | c.14.1.2 (A:) Interphotoreceptor retinoid-binding | 5e-08 | |
| d1x5ra1 | 99 | b.36.1.1 (A:8-106) Glutamate receptor interacting | 7e-08 | |
| d1kwaa_ | 88 | b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta | 7e-08 | |
| d1rgwa_ | 85 | b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo | 8e-08 | |
| d2z9ia1 | 88 | b.36.1.4 (A:227-314) Protease PepD {Mycobacterium | 1e-07 | |
| d1uepa_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 1e-07 | |
| d1y7na1 | 79 | b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote | 2e-07 | |
| d1qava_ | 90 | b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta | 2e-07 | |
| d1ueza_ | 101 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 2e-07 | |
| d2fcfa1 | 96 | b.36.1.1 (A:1148-1243) Multiple PDZ domain protein | 2e-07 | |
| d1p1da2 | 99 | b.36.1.1 (A:115-213) Glutamate receptor interactin | 3e-07 | |
| d1ufxa_ | 103 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 3e-07 | |
| d1wi2a_ | 104 | b.36.1.1 (A:) PDZ domain containing protein 11, Pd | 4e-07 | |
| d1wifa_ | 126 | b.36.1.1 (A:) hypothetical PDZ domain containing p | 5e-07 | |
| d1wg6a_ | 127 | b.36.1.1 (A:) Partitioning-defective 3-like protei | 7e-07 | |
| d1uf1a_ | 128 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 9e-07 | |
| d2fnea1 | 88 | b.36.1.1 (A:1955-2042) Multiple PDZ domain protein | 9e-07 | |
| d2fe5a1 | 92 | b.36.1.1 (A:223-314) Synapse-associated protein 10 | 2e-06 | |
| d2cs5a1 | 106 | b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no | 3e-06 | |
| d1i16a_ | 130 | b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) | 7e-06 | |
| d1wf7a_ | 103 | b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu | 7e-06 | |
| d1wh1a_ | 124 | b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human | 8e-06 | |
| d1vaea_ | 111 | b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T | 8e-06 | |
| d1ihja_ | 94 | b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga | 1e-05 | |
| d1v5la_ | 103 | b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote | 1e-05 | |
| d1wf8a1 | 94 | b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens | 1e-05 | |
| d1v5qa_ | 122 | b.36.1.1 (A:) Glutamate receptor interacting prote | 3e-05 | |
| d2cssa1 | 108 | b.36.1.1 (A:8-115) Regulating synaptic membrane ex | 3e-05 | |
| d1v6ba_ | 118 | b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI | 3e-05 | |
| d1rzxa_ | 98 | b.36.1.1 (A:) GTPase-binding domain of the cell po | 5e-05 | |
| d2f0aa1 | 92 | b.36.1.1 (A:251-342) Segment polarity protein dish | 7e-05 | |
| d1ky9b2 | 88 | b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t | 8e-05 | |
| d1r6ja_ | 82 | b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta | 2e-04 | |
| d1k32a1 | 91 | b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th | 0.002 | |
| d2i6va1 | 87 | b.36.1.5 (A:219-305) General secretion pathway pro | 0.003 |
| >d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Tail specific protease, catalytic domain domain: Photosystem II D1 C-terminal processing protease species: Algae (Scenedesmus obliquus) [TaxId: 3088]
Score = 80.2 bits (197), Expect = 1e-17
Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 4/100 (4%)
Query: 101 NEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILS-SSIQTRSKAHGIIKRMLASLG 159
+ + EAW+ V+ +++D + Q+W + RE L + R++ + I++MLA L
Sbjct: 4 EQLLFLEAWRAVDRAYVD---KSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLD 60
Query: 160 DPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLK 199
DP+TRFL P+ + + R I L
Sbjct: 61 DPFTRFLEPSRLAALRRGTKVTINPVTFTTCSNVAAAALP 100
|
| >d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294 | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 | Back information, alignment and structure |
|---|
| >d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 291 | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 302 | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 393 | |||
| d1fc6a4 | 294 | Photosystem II D1 C-terminal processing protease { | 100.0 | |
| d1k32a4 | 291 | Tricorn protease {Archaeon Thermoplasma acidophilu | 99.93 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 99.66 | |
| d1j7xa_ | 302 | Interphotoreceptor retinoid-binding protein IRBP { | 99.55 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 99.33 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.32 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 99.19 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 99.17 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 99.16 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 99.14 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 99.13 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 99.12 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 99.09 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.09 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 99.06 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.05 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.04 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 99.03 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 99.02 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.02 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 99.02 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 99.0 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 99.0 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 99.0 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.99 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 98.99 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 98.98 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.96 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 98.95 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 98.95 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.95 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 98.95 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 98.94 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.94 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.94 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 98.93 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 98.93 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.92 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 98.91 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 98.91 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.9 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.9 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 98.89 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 98.89 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 98.89 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 98.88 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.88 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 98.86 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.85 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 98.84 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.84 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 98.84 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 98.82 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 98.81 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.79 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 98.79 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.79 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 98.78 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 98.76 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 98.74 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.73 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.73 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 98.72 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 98.68 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 98.67 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.67 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.63 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.57 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 98.56 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.48 |
| >d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Tail specific protease, catalytic domain domain: Photosystem II D1 C-terminal processing protease species: Algae (Scenedesmus obliquus) [TaxId: 3088]
Probab=100.00 E-value=4.5e-34 Score=274.74 Aligned_cols=207 Identities=26% Similarity=0.436 Sum_probs=158.5
Q ss_pred ChHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHhhh-cccChHHHHHHHHHHHHhcCCCceeecCHHHHhhhccCc
Q 016195 100 TNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS-SIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYD 178 (393)
Q Consensus 100 ~~~~~f~~~W~~v~~~y~d~~~~~~~~~dW~~v~~~y~~~-~i~t~~~~~~~i~~ml~~L~D~ht~~~~~~e~~~~~~~~ 178 (393)
+.+++|+++|+.++++|||+. |+++||++++++|++. .+.++++++.+|++|+++|+|+|++|+++++++.+.++.
T Consensus 3 ~~~~if~e~W~~~~~~y~~~~---~~gvDW~a~~~~y~~~~~~~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~g~ 79 (294)
T d1fc6a4 3 SEQLLFLEAWRAVDRAYVDKS---FNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGT 79 (294)
T ss_dssp HHHHHHHHHHHHHHHHCSCTT---GGGCCHHHHHHHHHHHSCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHCS
T ss_pred cHHHHHHHHHHHhhccccCCC---CCccCHHHHHHHHhccccCCCHHHHHHHHHHHHHHhCCCceEEeChHHhhhhccCc
Confidence 456799999999999999994 8999999999999875 357889999999999999999999999999988765322
Q ss_pred eeeeEEEEEEeeCCCCeeEEEEEEEcCCChhhhcCCCCCCEEEEECCEEcCCCCHHHHHHHhcCCCCCeEEEEEEeCCCC
Q 016195 179 MSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCG 258 (393)
Q Consensus 179 ~~glGi~~~~~~~~~G~~~l~V~~V~~gsPA~~AGL~~GD~IlsVnG~~v~~~~~~~v~~~L~g~~G~~V~Ltv~r~~~~ 258 (393)
...+. .+..+....
T Consensus 80 ~~~~~---------------------------------------------------------------~~~~~~~~~--- 93 (294)
T d1fc6a4 80 KVTIN---------------------------------------------------------------PVTFTTCSN--- 93 (294)
T ss_dssp CCCCC---------------------------------------------------------------CEEEEEECS---
T ss_pred eEEec---------------------------------------------------------------ccCCCcccc---
Confidence 11000 000000000
Q ss_pred ceEEEEEEeeccccCceeeeeeeecCCCceEEEEEeCccchhHHHHHHHHHHHHHHCCCCeEEEEccCCCCCcHHHHHHH
Q 016195 259 PIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEI 338 (393)
Q Consensus 259 ~~~~v~l~r~~~~~~~v~~~~~~l~~~~~~igYI~i~~F~~~~~~~l~~al~~l~~~g~~~lIlDLR~N~GG~l~~a~~i 338 (393)
+....+. ....+++||||+|.+|...+.+++++++.+|++++++++|||||+|+||.+..|..+
T Consensus 94 -----------~~~~~~~-----~~~~~~~IGYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIiDLR~N~GG~~~~a~~~ 157 (294)
T d1fc6a4 94 -----------VAAAALP-----PGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNV 157 (294)
T ss_dssp -----------CCGGGSC-----TTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEECTTCCCBCHHHHHHH
T ss_pred -----------ccccccc-----CCCCCCcEEEEEEcccCchhHHHHHHHHHHHHHCCCcEEEEEeecCcccchhhhHHH
Confidence 0000000 012357899999999999999999999999999999999999999999999999999
Q ss_pred HhccccCCcEEEEEeccCcccceeeecCCCCCCCCcEEEEEcCCCcccccceec
Q 016195 339 AKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYI 392 (393)
Q Consensus 339 a~lfl~~g~~v~~~~~r~~~~~~~~~~~~~~~~~~PlvVLVN~~TaSaAE~fa~ 392 (393)
+++|++++..+ ++..+++.........+...+.+|++||||+.|+||||+|+.
T Consensus 158 ~~~f~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~pv~VL~~~~TaSaaE~~a~ 210 (294)
T d1fc6a4 158 ARMLVDRGDLV-LIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAG 210 (294)
T ss_dssp HHHHCSSSEEE-EEEETTEEEEEEECCSCCSCSSSCEEEEECTTCCTHHHHHHH
T ss_pred HHhhcccccce-EEEEeccccceeccccccccccceEEEEecCCccchHHHHHH
Confidence 99999998755 444444332222223445678899999999999999999974
|
| >d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|