Citrus Sinensis ID: 016195


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MSSLILNCSSCTSSSLPRLSPHKHSEQKAPIIQSNTNWAKKAVINVLTGALSFNLLLSSPLALESSSSVQSVPPSPSPSLTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYIS
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHcHHHccccEEEEEEEEEEcccccEEEEEEEEEccccHHHccccccccEEEEEccEEcccccHHHHHHHcccccccEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEccccccccEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHcccccEEEEccccccccEEEEccccccccccEEEEEcccccccccEEEcc
ccccEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccHHccccccccccccccHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccHHHHHHHccccEcEEEEEEEEccccccccEEEEEEcccccHHHHcccccccEEEEEcccccccccHHHHHHHHccccccEEEEEEEEcccccEEEEEEEEEEEEEccEEEEEEEcccccccEEEEEEHHccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEcccccEEEEEEccccccccccEEEEEcccccccEEEEEEc
msslilncssctssslprlsphkhseqkapiiqsNTNWAKKAVINVLTGALSFNLllssplalessssvqsvppspspsltchegedaaeseprqvVAKTNEGIVEEAWQIVNDSFldtgrhrwtpqnwqrKREDILSSSIQTRSKAHGIIKRMLAslgdpytrflspaefSKMARYDMsgiginlrevpdangvVTLKVLGLIldgpahsagvrqgdevlavngvdvrgkSAFEVSsllqgpsetFVTIEVkhgncgpieSIQVQRQLVARTPVFYrlehldngttsvGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGEtitytvgrdpqyqktivadnsplvtapvivcapafKMRQQLFFYIS
msslilncssctssslprlsphkhsEQKAPIIQSNTNWAKKAVINVLTGALSFNLLLSSPLALESSSSVQSVPPSPSPSLTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSfldtgrhrwtpqnwqrkredilsssiqtrsKAHGIIKRMlaslgdpytRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPahsagvrqgdEVLAVNGVDVRGKSAFEvssllqgpseTFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHldngttsvgymrLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITytvgrdpqyqktivadnsplvTAPVIVCAPAFKMRQQLFFYIS
MsslilncssctssslprlsPHKHSEQKAPIIQSNTNWAKKAVINVLTGAlsfnlllssplalessssvqsvppspspslTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYIS
*******************************IQSNTNWAKKAVINVLTGALSFNLLL*******************************************NEGIVEEAWQIVNDSFLDTGRHRWTPQNWQR**************KAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYI*
****************************************KAVINVLTGALSFNLLLSSPLALESSSSVQ*****************************TNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVG***************LVTAPVIVCAPAFKMRQQLFFYIS
****************************APIIQSNTNWAKKAVINVLTGALSFNLLLSSPLA***********************************AKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYIS
**********CTSSSLPRLSPHKHSEQKAPIIQSNTNWAKKAVINVLTGALSFNLLLSSPLALESSSSV**************************VVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLILNCSSCTSSSLPRLSPHKHSEQKAPIIQSNTNWAKKAVINVLTGALSFNLLLSSPLALESSSSVQSVPPSPSPSLTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query393 2.2.26 [Sep-21-2011]
P42784414 Carboxyl-terminal-process yes no 0.699 0.664 0.329 2e-41
Q55669 427 Carboxyl-terminal-process N/A no 0.704 0.648 0.328 2e-40
O04073464 C-terminal processing pep N/A no 0.608 0.515 0.301 1e-26
O34666 466 Carboxy-terminal processi yes no 0.554 0.467 0.278 3e-19
Q8CSK8 491 Probable CtpA-like serine yes no 0.506 0.405 0.273 4e-16
Q5HPB7 491 Probable CtpA-like serine yes no 0.506 0.405 0.273 4e-16
Q44879 434 Carboxy-terminal-processi yes no 0.486 0.440 0.314 3e-15
Q6GGY8 496 Probable CtpA-like serine yes no 0.536 0.425 0.241 7e-15
Q2YXZ9 496 Probable CtpA-like serine yes no 0.536 0.425 0.241 1e-14
Q5HG01 496 Probable CtpA-like serine yes no 0.473 0.375 0.267 1e-14
>sp|P42784|CTPA_SYNP2 Carboxyl-terminal-processing protease OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ctpA PE=3 SV=2 Back     alignment and function desciption
 Score =  170 bits (431), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 170/288 (59%), Gaps = 13/288 (4%)

Query: 94  RQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKR 153
           R +     + ++ +AW+ V+ +++D     +  QNW   R+  L   ++TR +A+  +  
Sbjct: 26  RAIAFTDEQDLLLQAWRYVSQAYVD---ETFNHQNWWLIRQKFLKRPLKTRDEAYEAVGE 82

Query: 154 MLASLGDPYTRFLSPAEFSKM---ARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAH 210
           MLA L DPYTR L P ++  +      ++SG+G+ +   P+ +    L+V+  +   PA 
Sbjct: 83  MLALLDDPYTRLLRPEQYRSLKVSTSGELSGVGLQINVNPEVD---VLEVILPLPGSPAE 139

Query: 211 SAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLV 270
           +AG+   D++LA++G+D R     E ++ ++G   + V++ VK      + +++V R  +
Sbjct: 140 AAGIEAKDQILAIDGIDTRNIGLEEAAARMRGKKGSTVSLTVKSPKTDTVRTVKVTRDTI 199

Query: 271 ARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGG 330
           A  PV+ +L+   NG   VGY+RL +F+A A+ +++ ++ +LQ  GA  ++LDLR+N GG
Sbjct: 200 ALNPVYDKLDE-KNGE-KVGYIRLNQFSANAKTEIIKSLNQLQKQGADRYVLDLRNNPGG 257

Query: 331 LVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVC 378
           L+QAGIEIA+L+L++ ETI YTV R   ++ +  A   PL  AP++V 
Sbjct: 258 LLQAGIEIARLWLDQ-ETIVYTVNRQGIFE-SYSAVGQPLTDAPLVVL 303




Cleavage of the 16 C-terminal residues from the D1 precursor of photosystem II. May be involved in protection of the bacterium from thermal and osmotic stresses.
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (taxid: 32049)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 1EC: 0EC: 2
>sp|Q55669|CTPA_SYNY3 Carboxyl-terminal-processing protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ctpA PE=3 SV=1 Back     alignment and function description
>sp|O04073|CTPA_SCEOB C-terminal processing peptidase, chloroplastic OS=Scenedesmus obliquus GN=ctpA PE=1 SV=1 Back     alignment and function description
>sp|O34666|CTPA_BACSU Carboxy-terminal processing protease CtpA OS=Bacillus subtilis (strain 168) GN=ctpA PE=2 SV=1 Back     alignment and function description
>sp|Q8CSK8|CTPAL_STAES Probable CtpA-like serine protease OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1113 PE=3 SV=1 Back     alignment and function description
>sp|Q5HPB7|CTPAL_STAEQ Probable CtpA-like serine protease OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0996 PE=3 SV=1 Back     alignment and function description
>sp|Q44879|CTPA_BARBK Carboxy-terminal-processing protease OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ctpA PE=3 SV=1 Back     alignment and function description
>sp|Q6GGY8|CTPAL_STAAR Probable CtpA-like serine protease OS=Staphylococcus aureus (strain MRSA252) GN=SAR1432 PE=3 SV=1 Back     alignment and function description
>sp|Q2YXZ9|CTPAL_STAAB Probable CtpA-like serine protease OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1275c PE=3 SV=1 Back     alignment and function description
>sp|Q5HG01|CTPAL_STAAC Probable CtpA-like serine protease OS=Staphylococcus aureus (strain COL) GN=SACOL1455 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query393
255557425491 Carboxyl-terminal-processing protease pr 0.944 0.755 0.727 1e-145
297740636 500 unnamed protein product [Vitis vinifera] 0.882 0.694 0.723 1e-140
225463392462 PREDICTED: carboxyl-terminal-processing 0.882 0.751 0.723 1e-140
356512566442 PREDICTED: carboxyl-terminal-processing 0.872 0.776 0.678 1e-138
255648018358 unknown [Glycine max] 0.895 0.983 0.664 1e-138
449459336489 PREDICTED: carboxyl-terminal-processing 0.893 0.717 0.666 1e-135
224114365468 predicted protein [Populus trichocarpa] 0.933 0.784 0.714 1e-134
357519225465 Carboxyl-terminal-processing protease [M 0.916 0.774 0.646 1e-131
388502616465 unknown [Medicago truncatula] 0.916 0.774 0.643 1e-131
19774137467 D1 protease-like protein precursor [Nico 0.796 0.670 0.717 1e-129
>gi|255557425|ref|XP_002519743.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus communis] gi|223541160|gb|EEF42716.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 278/382 (72%), Positives = 311/382 (81%), Gaps = 11/382 (2%)

Query: 6   LNCSSCTSSSLPRLSPHKHSEQKAP---------IIQSNTNWAKKAVINVLTGALSFNLL 56
           +N   C SS+   LS    S  KAP         +    T WA+K  +  LTG LSFNLL
Sbjct: 1   MNVLLCNSSATLPLSQSSLSSPKAPPTKFSFSLNLNNHTTTWARKTFLGALTGVLSFNLL 60

Query: 57  LSSPLALESSSSVQSVP-PSPSPSLTCHEGEDAAESEPRQVVAKTNEGIVEEAWQIVNDS 115
           LSSP +L S S    +  PSP P+ +  E     E   +   + TNEGIVEEAWQIVNDS
Sbjct: 61  LSSPFSLASQSPYPQLQLPSP-PNNSSIEQCQEQEQVEQNQESVTNEGIVEEAWQIVNDS 119

Query: 116 FLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMA 175
           FLD GRHRWTPQ+WQ+K+EDILS+SIQ+RSKAH +IKRMLASLGDPYTRFLSPAEFSKMA
Sbjct: 120 FLDAGRHRWTPQSWQQKKEDILSTSIQSRSKAHDLIKRMLASLGDPYTRFLSPAEFSKMA 179

Query: 176 RYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFE 235
           RYDMSGIGINLREVP+ NG V LKVLGL+LDGPA++AGV+QGDE+LAVNG DVRGKSAFE
Sbjct: 180 RYDMSGIGINLREVPEENGEVKLKVLGLLLDGPAYTAGVKQGDEILAVNGEDVRGKSAFE 239

Query: 236 VSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLK 295
           VSS LQGP+ETFVTI+VKHGNCGPI+S++VQRQLVARTPVFYRLE +D GTTSVGYMRLK
Sbjct: 240 VSSSLQGPNETFVTIKVKHGNCGPIQSLEVQRQLVARTPVFYRLEQVDKGTTSVGYMRLK 299

Query: 296 EFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEIAKLFLNEGETITYTVGR 355
           EFNALARKDLV AMKRL+DMGASYFILDLRDNLGGLVQAGIEI+KLFLNEGE + YTVGR
Sbjct: 300 EFNALARKDLVIAMKRLKDMGASYFILDLRDNLGGLVQAGIEISKLFLNEGEKVIYTVGR 359

Query: 356 DPQYQKTIVADNSPLVTAPVIV 377
           DPQYQ TIVAD +PLVTAPVIV
Sbjct: 360 DPQYQNTIVADTAPLVTAPVIV 381




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297740636|emb|CBI30818.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225463392|ref|XP_002271932.1| PREDICTED: carboxyl-terminal-processing protease [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512566|ref|XP_003524989.1| PREDICTED: carboxyl-terminal-processing protease-like [Glycine max] Back     alignment and taxonomy information
>gi|255648018|gb|ACU24465.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449459336|ref|XP_004147402.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis sativus] gi|449529666|ref|XP_004171819.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224114365|ref|XP_002316739.1| predicted protein [Populus trichocarpa] gi|222859804|gb|EEE97351.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357519225|ref|XP_003629901.1| Carboxyl-terminal-processing protease [Medicago truncatula] gi|355523923|gb|AET04377.1| Carboxyl-terminal-processing protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|388502616|gb|AFK39374.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|19774137|gb|AAL99045.1|AF487527_1 D1 protease-like protein precursor [Nicotiana plumbaginifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query393
TAIR|locus:2170443489 AT5G46390 [Arabidopsis thalian 0.720 0.578 0.709 9e-109
UNIPROTKB|P75023 462 ctpB "Carboxyl-terminal protea 0.715 0.608 0.311 9.5e-34
UNIPROTKB|P73458423 prc "Carboxyl-terminal proteas 0.664 0.617 0.320 6e-32
TAIR|locus:2129411515 AT4G17740 [Arabidopsis thalian 0.625 0.477 0.310 8.1e-28
TIGR_CMR|GSU_1772 443 GSU_1772 "carboxy-terminal pro 0.549 0.487 0.294 1.3e-18
TIGR_CMR|CHY_0170377 CHY_0170 "carboxyl-terminal pr 0.575 0.599 0.297 2.1e-18
TIGR_CMR|SPO_3812 443 SPO_3812 "carboxyl-terminal pr 0.536 0.476 0.334 1.7e-16
TIGR_CMR|GSU_0969 450 GSU_0969 "carboxy-terminal pro 0.501 0.437 0.308 2.3e-15
TIGR_CMR|DET_0364377 DET_0364 "carboxyl-terminal pr 0.595 0.620 0.268 2.4e-13
TIGR_CMR|BA_5414 469 BA_5414 "carboxyl-terminal pro 0.541 0.454 0.253 2.3e-12
TAIR|locus:2170443 AT5G46390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1075 (383.5 bits), Expect = 9.0e-109, P = 9.0e-109
 Identities = 203/286 (70%), Positives = 247/286 (86%)

Query:    92 EPRQVVAKTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSSIQTRSKAHGII 151
             EP+ V   TNEGIVEEAW+IVN +FLDT  H WTP+ WQ++++DIL+S I++RSKAH +I
Sbjct:   113 EPQLV---TNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDILASPIKSRSKAHEVI 169

Query:   152 KRMLASLGDPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLKVLGLILDGPAHS 211
             K MLASLGD YTRFLSP EFS+M++YD++GIGINLREV D  G V LKVLGL+LD  A  
Sbjct:   170 KNMLASLGDQYTRFLSPDEFSRMSKYDITGIGINLREVSDGGGNVKLKVLGLVLDSAADI 229

Query:   212 AGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVA 271
             AGV+QGDE+LAVNG+DV GKS+FEVSSLLQGPS+TFV ++VKHG CGP++S+++QRQ+ A
Sbjct:   230 AGVKQGDEILAVNGMDVSGKSSFEVSSLLQGPSKTFVVLKVKHGKCGPVKSLKIQRQVNA 289

Query:   272 RTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGL 331
             +TPV YRLE +DNGT SVGY+RLKEFNALARKDLV AMKRL D GASYF++DLRDNLGGL
Sbjct:   290 QTPVSYRLEKVDNGTVSVGYIRLKEFNALARKDLVIAMKRLLDKGASYFVMDLRDNLGGL 349

Query:   332 VQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIV 377
             VQAGIE AKLFL+EG+T+ YT GRDP+ QKT+V+D  PL+TAP+IV
Sbjct:   350 VQAGIETAKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPLIV 395




GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA
GO:0008236 "serine-type peptidase activity" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=ISS
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0016556 "mRNA modification" evidence=RCA
UNIPROTKB|P75023 ctpB "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|P73458 prc "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
TAIR|locus:2129411 AT4G17740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1772 GSU_1772 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0170 CHY_0170 "carboxyl-terminal protease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3812 SPO_3812 "carboxyl-terminal protease family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0969 GSU_0969 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0364 DET_0364 "carboxyl-terminal protease" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5414 BA_5414 "carboxyl-terminal protease" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
PLN00049389 PLN00049, PLN00049, carboxyl-terminal processing p 3e-51
TIGR00225334 TIGR00225, prc, C-terminal peptidase (prc) 2e-43
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 1e-38
smart00245192 smart00245, TSPc, tail specific protease 2e-22
TIGR03900 973 TIGR03900, prc_long_Delta, putative carboxyl-termi 2e-22
cd07560211 cd07560, Peptidase_S41_CPP, C-terminal processing 9e-22
pfam03572166 pfam03572, Peptidase_S41, Peptidase family S41 2e-19
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 5e-18
cd06567224 cd06567, Peptidase_S41, C-terminal processing pept 7e-16
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-11
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 7e-11
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-10
cd07563250 cd07563, Peptidase_S41_IRBP, Interphotoreceptor re 2e-07
cd07561256 cd07561, Peptidase_S41_CPP_like, C-terminal proces 3e-07
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 3e-06
pfam1318081 pfam13180, PDZ_2, PDZ domain 2e-05
cd06567224 cd06567, Peptidase_S41, C-terminal processing pept 3e-05
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 3e-05
cd0099080 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass 5e-04
cd07021178 cd07021, Clp_protease_NfeD_like, Nodulation format 8e-04
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.002
>gnl|CDD|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional Back     alignment and domain information
 Score =  175 bits (446), Expect = 3e-51
 Identities = 89/253 (35%), Positives = 141/253 (55%), Gaps = 14/253 (5%)

Query: 107 EAWQIVNDSFLDTGRHRWTPQNWQRKREDIL-SSSIQTRSKAHGIIKRMLASLGDPYTRF 165
           EAW+ V+ +++D     +  Q+W R RE+ L +  + TR + +  I++MLA+L DP+TRF
Sbjct: 11  EAWRTVDRAYVDKT---FNGQSWFRYRENALKNEPMNTREETYAAIRKMLATLDDPFTRF 67

Query: 166 LSPAEFSKMAR---YDMSGIGINLREVPDANGVVT-LKVLGLILDGPAHSAGVRQGDEVL 221
           L P +F  +       ++G+G+ +     ++G    L V+     GPA  AG+R GD +L
Sbjct: 68  LEPEKFKSLRSGTKGAVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGIRPGDVIL 127

Query: 222 AVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGPIESIQVQRQLVARTPVFYRL-- 279
           A++G    G S +E +  LQGP  + V + ++ G       + + R+ V+  PV  RL  
Sbjct: 128 AIDGTSTEGLSLYEAADRLQGPEGSSVELTLRRG--PETRLVTLTREKVSLNPVKSRLCE 185

Query: 280 -EHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEI 338
                 G+  +GY++L  FN  A   +  A++ L+  G   F+LDLRDN GGL  AGIEI
Sbjct: 186 VPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNSGGLFPAGIEI 245

Query: 339 AKLFLNEGETITY 351
           AKL+L++G  I Y
Sbjct: 246 AKLWLDKG-VIVY 257


Length = 389

>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|214582 smart00245, TSPc, tail specific protease Back     alignment and domain information
>gnl|CDD|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial Back     alignment and domain information
>gnl|CDD|143476 cd07560, Peptidase_S41_CPP, C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information
>gnl|CDD|217620 pfam03572, Peptidase_S41, Peptidase family S41 Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41 Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|143479 cd07563, Peptidase_S41_IRBP, Interphotoreceptor retinoid-binding protein; serine protease family S41 Back     alignment and domain information
>gnl|CDD|143477 cd07561, Peptidase_S41_CPP_like, C-terminal processing peptidase-like; serine protease family S41 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41 Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>gnl|CDD|132932 cd07021, Clp_protease_NfeD_like, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 393
PLN00049389 carboxyl-terminal processing protease; Provisional 100.0
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 100.0
PRK11186 667 carboxy-terminal protease; Provisional 100.0
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 100.0
cd06567224 Peptidase_S41 C-terminal processing peptidase fami 99.92
cd07562266 Peptidase_S41_TRI Tricorn protease; serine proteas 99.91
cd07563250 Peptidase_S41_IRBP Interphotoreceptor retinoid-bin 99.87
smart00245192 TSPc tail specific protease. tail specific proteas 99.84
cd07560211 Peptidase_S41_CPP C-terminal processing peptidase; 99.82
cd07561256 Peptidase_S41_CPP_like C-terminal processing pepti 99.8
PF03572169 Peptidase_S41: Peptidase family S41; InterPro: IPR 99.62
PF1468470 Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_ 99.39
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.32
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.2
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.98
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.93
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.8
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.8
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.73
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 98.67
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.67
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.66
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.63
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.51
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.3
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.27
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 98.24
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.23
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.19
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.19
PRK10779449 zinc metallopeptidase RseP; Provisional 98.19
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.19
PRK10139455 serine endoprotease; Provisional 98.18
PRK10898353 serine endoprotease; Provisional 98.16
PRK10942473 serine endoprotease; Provisional 98.13
COG3975558 Predicted protease with the C-terminal PDZ domain 98.11
KOG3209984 consensus WW domain-containing protein [General fu 98.05
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.92
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.9
KOG3605829 consensus Beta amyloid precursor-binding protein [ 97.9
PRK10139455 serine endoprotease; Provisional 97.87
PRK10942473 serine endoprotease; Provisional 97.83
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.81
KOG3209 984 consensus WW domain-containing protein [General fu 97.67
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 97.63
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.56
KOG3129231 consensus 26S proteasome regulatory complex, subun 97.45
KOG3549 505 consensus Syntrophins (type gamma) [Extracellular 97.4
KOG3551 506 consensus Syntrophins (type beta) [Extracellular s 97.35
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.32
KOG3580 1027 consensus Tight junction proteins [Signal transduc 97.08
PRK09681276 putative type II secretion protein GspC; Provision 96.85
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 96.8
KOG3651 429 consensus Protein kinase C, alpha binding protein 96.75
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 96.59
KOG3580 1027 consensus Tight junction proteins [Signal transduc 96.46
COG3480342 SdrC Predicted secreted protein containing a PDZ d 96.43
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 96.35
KOG1421 955 consensus Predicted signaling-associated protein ( 96.15
KOG3532 1051 consensus Predicted protein kinase [General functi 96.03
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 95.71
COG3031275 PulC Type II secretory pathway, component PulC [In 95.5
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 95.36
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 95.05
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 94.9
KOG0606 1205 consensus Microtubule-associated serine/threonine 94.47
KOG1320473 consensus Serine protease [Posttranslational modif 94.45
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 93.24
KOG3605829 consensus Beta amyloid precursor-binding protein [ 91.72
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 91.35
KOG3938334 consensus RGS-GAIP interacting protein GIPC, conta 90.8
PF1281278 PDZ_1: PDZ-like domain 90.52
KOG1738 638 consensus Membrane-associated guanylate kinase-int 90.12
COG0750375 Predicted membrane-associated Zn-dependent proteas 89.59
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 83.81
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.6e-50  Score=403.02  Aligned_cols=287  Identities=33%  Similarity=0.561  Sum_probs=242.0

Q ss_pred             cChHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHhhh-cccChHHHHHHHHHHHHhcCCCceeecCHHHHhhhc--
Q 016195           99 KTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS-SIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMA--  175 (393)
Q Consensus        99 ~~~~~~f~~~W~~v~~~y~d~~~~~~~~~dW~~v~~~y~~~-~i~t~~~~~~~i~~ml~~L~D~ht~~~~~~e~~~~~--  175 (393)
                      +++.++|+++|++++++|||+.   |+++||++++++|++. .+++.++++.+|++|+++|+|||++|++++++..+.  
T Consensus         3 ~~~~~~f~e~w~~v~~~~~d~~---~~g~dW~~~~e~y~~~~~~~~~~~~~~~i~~ml~~L~D~hs~y~~~~~~~~~~~~   79 (389)
T PLN00049          3 TEENLLFLEAWRTVDRAYVDKT---FNGQSWFRYRENALKNEPMNTREETYAAIRKMLATLDDPFTRFLEPEKFKSLRSG   79 (389)
T ss_pred             ccHHHHHHHHHHHHHHHHcCcc---ccccCHHHHHHHHhhccCCCcHHHHHHHHHHHHhhCCCCcccCcCHHHHHHHHHh
Confidence            4789999999999999999994   8999999999999874 467888999999999999999999999999987543  


Q ss_pred             -cCceeeeEEEEEEeeCCCC-eeEEEEEEEcCCChhhhcCCCCCCEEEEECCEEcCCCCHHHHHHHhcCCCCCeEEEEEE
Q 016195          176 -RYDMSGIGINLREVPDANG-VVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVK  253 (393)
Q Consensus       176 -~~~~~glGi~~~~~~~~~G-~~~l~V~~V~~gsPA~~AGL~~GD~IlsVnG~~v~~~~~~~v~~~L~g~~G~~V~Ltv~  253 (393)
                       ++.+.|+|+.+...+..++ ...++|..|.++|||+++||++||+|++|||+++.+++..++..++++..|+.|.|++.
T Consensus        80 ~~~~~~GiG~~~~~~~~~~~~~~g~~V~~V~~~SPA~~aGl~~GD~Iv~InG~~v~~~~~~~~~~~l~g~~g~~v~ltv~  159 (389)
T PLN00049         80 TKGAVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGIRPGDVILAIDGTSTEGLSLYEAADRLQGPEGSSVELTLR  159 (389)
T ss_pred             ccCCceEEEEEEEEccCCCCccCcEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEE
Confidence             5778999999876432110 01378999999999999999999999999999999988888888999999999999999


Q ss_pred             eCCCCceEEEEEEeeccccCceeeeeee---ecCCCceEEEEEeCccchhHHHHHHHHHHHHHHCCCCeEEEEccCCCCC
Q 016195          254 HGNCGPIESIQVQRQLVARTPVFYRLEH---LDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGG  330 (393)
Q Consensus       254 r~~~~~~~~v~l~r~~~~~~~v~~~~~~---l~~~~~~igYI~i~~F~~~~~~~l~~al~~l~~~g~~~lIlDLR~N~GG  330 (393)
                      |++  ...+++++|+.+..++|.+....   .+.++++||||+|++|...+.+++.++|++++++++++||||||+|+||
T Consensus       160 r~g--~~~~~~l~r~~v~~~~v~~~~~~~~~~~~~~~~IgYi~i~~F~~~~~~~~~~~l~~l~~~~~~glIlDLR~N~GG  237 (389)
T PLN00049        160 RGP--ETRLVTLTREKVSLNPVKSRLCEVPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNSGG  237 (389)
T ss_pred             ECC--EEEEEEEEeeeEeccceeeEEEeeccccCCCCCEEEEEeccccchhHHHHHHHHHHHHHCCCCEEEEEcCCCCCC
Confidence            976  57888999988887888765432   1223568999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHhccccCCcEEEEEeccCcccceeeecCCC--CCCCCcEEEEEcCCCcccccceec
Q 016195          331 LVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNS--PLVTAPVIVCAPAFKMRQQLFFYI  392 (393)
Q Consensus       331 ~l~~a~~ia~lfl~~g~~v~~~~~r~~~~~~~~~~~~~--~~~~~PlvVLVN~~TaSaAE~fa~  392 (393)
                      .+..++.++++|+++|. ++++..+.+.. ..+..++.  ..+.+|++||||+.|+||||+|+.
T Consensus       238 ~~~~a~~ia~~f~~~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~~PvvVLvn~~TaSasEi~a~  299 (389)
T PLN00049        238 LFPAGIEIAKLWLDKGV-IVYIADSRGVR-DIYDADGSSAIATSEPLAVLVNKGTASASEILAG  299 (389)
T ss_pred             CHHHHHHHHHHhcCCCc-EEEEecCCCce-eEEecCCCccccCCCCEEEEECCCCccHHHHHHH
Confidence            99999999999999986 44655444332 22333332  247899999999999999999973



>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd06567 Peptidase_S41 C-terminal processing peptidase family S41 Back     alignment and domain information
>cd07562 Peptidase_S41_TRI Tricorn protease; serine protease family S41 Back     alignment and domain information
>cd07563 Peptidase_S41_IRBP Interphotoreceptor retinoid-binding protein; serine protease family S41 Back     alignment and domain information
>smart00245 TSPc tail specific protease Back     alignment and domain information
>cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information
>cd07561 Peptidase_S41_CPP_like C-terminal processing peptidase-like; serine protease family S41 Back     alignment and domain information
>PF03572 Peptidase_S41: Peptidase family S41; InterPro: IPR005151 This group of putative serine peptidases belong to the MEROPS peptidase family S41 (C-terminal processing peptidase family, clan SM) Back     alignment and domain information
>PF14684 Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
1fc7_A388 Photosystem Ii D1 C-Terminal Processing Protease Le 3e-27
1fc6_A388 Photosystem Ii D1 C-Terminal Processing Protease Le 2e-26
3k50_A 403 Crystal Structure Of Putative S41 Protease (Yp_2116 9e-05
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 2e-04
>pdb|1FC7|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 Back     alignment and structure

Iteration: 1

Score = 119 bits (298), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 78/255 (30%), Positives = 130/255 (50%), Gaps = 16/255 (6%) Query: 107 EAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSS-IQTRSKAHGIIKRMLASLGDPYTRF 165 EAW+ V+ +++D + Q+W + RE L + R++ + I+++LA L DP+TRF Sbjct: 11 EAWRAVDRAYVD---KSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKLLAVLDDPFTRF 67 Query: 166 LSPAEFSKMARYDMSGI-GINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVN 224 L P+ + + R + G+ L D + VL GPA AG R GD ++ V+ Sbjct: 68 LEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVD 127 Query: 225 GVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCGP--IESIQVQRQLVARTPV-FYRLEH 281 G V+G S ++VS LLQG +++ V + V H P ++Q+ RQ V PV F + Sbjct: 128 GTAVKGLSLYDVSDLLQGEADSQVEV-VLHAPGAPSNTRTLQLTRQKVTINPVTFTTCSN 186 Query: 282 LDNGTTS-------VGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQA 334 + +GY+RL FN+ A L G + +LD+R+N GGL A Sbjct: 187 VAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPA 246 Query: 335 GIEIAKLFLNEGETI 349 G+ +A++ ++ G+ + Sbjct: 247 GVNVARMLVDRGDLV 261
>pdb|1FC6|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 Back     alignment and structure
>pdb|3K50|A Chain A, Crystal Structure Of Putative S41 Protease (Yp_211611.1) From Bacteroides Fragilis Nctc 9343 At 2.00 A Resolution Length = 403 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 7e-60
3k50_A403 Putative S41 protease; structural genomics, joint 2e-37
1k32_A1045 Tricorn protease; protein degradation, substrate g 1e-24
1j7x_A302 IRBP, interphotoreceptor retinoid-binding protein; 2e-17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-11
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-10
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-10
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-10
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-10
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 5e-10
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 6e-10
2d90_A102 PDZ domain containing protein 1; structural genomi 9e-10
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 9e-10
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-09
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-09
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-09
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-09
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 3e-09
2ego_A96 General receptor for phosphoinositides 1- associat 5e-09
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 5e-09
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 5e-09
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 5e-09
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 6e-09
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 7e-09
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 7e-09
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 7e-09
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-08
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-08
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-08
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-08
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-08
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-08
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-08
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 3e-08
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 3e-08
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-08
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 4e-08
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-06
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-08
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-08
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 6e-08
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-08
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 6e-08
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 6e-08
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 7e-08
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 8e-08
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 9e-08
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-07
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-07
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-07
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-07
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-07
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-07
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-07
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 1e-07
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 1e-07
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-07
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-07
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-07
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-07
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-07
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 3e-07
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 3e-07
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-07
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 6e-06
3dor_A 583 Protein CT_858, CPAF; mature CPAF, dimer, transfer 3e-07
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-07
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 4e-07
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-07
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-05
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 4e-07
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-06
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 4e-07
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 5e-07
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 5e-07
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-07
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 5e-07
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 5e-07
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 6e-07
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 6e-07
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 6e-07
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 6e-07
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 7e-07
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 7e-07
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 9e-07
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 9e-07
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 9e-07
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 1e-06
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 1e-06
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-06
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-06
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-06
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-06
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-06
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-06
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-06
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-06
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-06
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 3e-06
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-06
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 3e-06
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-06
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-06
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-06
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 4e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-06
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 4e-06
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 4e-06
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 5e-06
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-06
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-06
2fne_A117 Multiple PDZ domain protein; structural protein, s 5e-06
2awx_A105 Synapse associated protein 97; membrane protein, s 6e-06
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 6e-06
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 6e-06
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 7e-06
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-05
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 7e-06
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 8e-06
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 8e-06
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 9e-06
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 9e-06
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-05
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 1e-05
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-05
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-05
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-05
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-05
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-05
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-05
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-05
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-05
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-05
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 2e-05
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-05
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 3e-05
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 4e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 5e-05
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 5e-05
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 5e-05
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 5e-05
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-05
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 6e-05
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 7e-05
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 7e-05
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 9e-05
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-04
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-04
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-04
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-04
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-04
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-04
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-04
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-04
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-04
4fgm_A597 Aminopeptidase N family protein; structural genomi 2e-04
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-04
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 3e-04
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-04
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-04
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 5e-04
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 8e-04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 9e-04
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
 Score =  197 bits (504), Expect = 7e-60
 Identities = 81/290 (27%), Positives = 141/290 (48%), Gaps = 25/290 (8%)

Query: 104 IVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSSS-IQTRSKAHGIIKRMLASLGDPY 162
           +  EAW+ V+ +++D     +  Q+W + RE  L    +  R++ +  I++MLA L DP+
Sbjct: 8   LFLEAWRAVDRAYVDK---SFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPF 64

Query: 163 TRFLSPAEFSKMARYDMS----GIGINLREVPDANGVVT-LKVLGLILDGPAHSAGVRQG 217
           TRFL P+  + + R   +    G+G+   E+    G    + VL     GPA  AG R G
Sbjct: 65  TRFLEPSRLAAL-RRGTAGSVTGVGL---EITYDGGSGKDVVVLTPAPGGPAEKAGARAG 120

Query: 218 DEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKH-GNCGPIESIQVQRQLVARTPVF 276
           D ++ V+G  V+G S ++VS LLQG +++ V + +   G      ++Q+ RQ V   PV 
Sbjct: 121 DVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPGAPSNTRTLQLTRQKVTINPVT 180

Query: 277 YRL--------EHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNL 328
           +                   +GY+RL  FN+        A   L   G +  +LD+R+N 
Sbjct: 181 FTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNG 240

Query: 329 GGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPLVT-APVIV 377
           GGL  AG+ +A++ ++ G+ +          +    AD + + +  P++V
Sbjct: 241 GGLFPAGVNVARMLVDRGD-LVLIADSQGI-RDIYSADGNSIDSATPLVV 288


>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 Length = 302 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A Length = 583 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query393
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 100.0
1k32_A1045 Tricorn protease; protein degradation, substrate g 100.0
3k50_A403 Putative S41 protease; structural genomics, joint 100.0
3dor_A 583 Protein CT_858, CPAF; mature CPAF, dimer, transfer 99.7
1j7x_A302 IRBP, interphotoreceptor retinoid-binding protein; 99.7
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.43
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.37
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.36
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.35
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.3
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.24
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.23
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.22
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.21
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.2
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.19
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.19
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.19
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.19
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.19
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.17
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.17
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.16
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.15
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.15
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.14
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.14
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.13
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.13
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.12
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.12
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.12
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.11
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.09
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.09
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.09
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.07
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.07
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.06
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.06
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.06
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.06
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.06
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.06
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.06
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.06
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.05
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.05
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.05
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.05
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.05
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.05
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.04
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.04
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.04
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.04
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.03
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.03
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.02
2d90_A102 PDZ domain containing protein 1; structural genomi 99.02
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.02
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.02
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.01
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.01
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.01
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.01
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.01
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.0
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.0
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.0
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.0
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.99
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.99
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.99
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.99
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.99
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.98
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.98
2awx_A105 Synapse associated protein 97; membrane protein, s 98.98
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.98
2ego_A96 General receptor for phosphoinositides 1- associat 98.98
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.98
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.98
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.98
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.98
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.98
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.97
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.97
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.96
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.96
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.96
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.95
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.95
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.94
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.94
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.94
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.94
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.94
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.94
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.94
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.94
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.93
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.93
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.93
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.93
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.93
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.92
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.92
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.91
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.9
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.9
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.9
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.9
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.9
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.9
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.89
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.89
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.89
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.89
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.89
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.89
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.88
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.88
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.88
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.88
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.87
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.87
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.86
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.86
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.86
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.86
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.86
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.85
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.84
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.84
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.84
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.84
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.84
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.84
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.84
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.84
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.83
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.83
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.83
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.82
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.32
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.82
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.81
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.81
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.8
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.8
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.8
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.79
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.78
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.76
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.76
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.76
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.75
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.75
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.75
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.75
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.74
2kl1_A94 YLBL protein; structure genomics, structural genom 98.74
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.73
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.73
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.73
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.73
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.72
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.71
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.7
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.68
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.67
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.67
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.67
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.64
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.63
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.63
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.61
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.6
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.57
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.52
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.51
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.5
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.46
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.44
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.44
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.42
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.41
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.41
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.24
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.16
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.14
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.11
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.08
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.88
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.83
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.76
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.7
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.49
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.37
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 83.26
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
Probab=100.00  E-value=1.6e-48  Score=392.24  Aligned_cols=286  Identities=27%  Similarity=0.499  Sum_probs=247.0

Q ss_pred             cChHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHhh-hcccChHHHHHHHHHHHHhcCCCceeecCHHHHhhhc--
Q 016195           99 KTNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILS-SSIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMA--  175 (393)
Q Consensus        99 ~~~~~~f~~~W~~v~~~y~d~~~~~~~~~dW~~v~~~y~~-~~i~t~~~~~~~i~~ml~~L~D~ht~~~~~~e~~~~~--  175 (393)
                      ++.+++|+++|+.++++|+++.   |++.||++++++|++ ..++++.+++.+|++|+++|+|||++|+++++++.+.  
T Consensus         3 ~~~~~~f~~~w~~i~~~y~~~~---~~~~dW~~~~~~y~~~~~~~~~~~~~~~i~~ml~~L~D~hs~~~~~~~~~~~~~~   79 (388)
T 1fc6_A            3 TSEQLLFLEAWRAVDRAYVDKS---FNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRG   79 (388)
T ss_dssp             CHHHHHHHHHHHHHHHHCSCTT---GGGCCHHHHHHHHHHHSCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHC
T ss_pred             ccHHHHHHHHHHHHHHHHhccc---ccCccHHHHHHHhhhccCCCCHHHHHHHHHHHHHhcCCCcceecCHHHHHHHHHh
Confidence            4678999999999999999984   899999999999988 5677899999999999999999999999999987653  


Q ss_pred             -cCceeeeEEEEEEe-eCCCCeeEEEEEEEcCCChhhhcCCCCCCEEEEECCEEcCCCCHHHHHHHhcCCCCCeEEEEEE
Q 016195          176 -RYDMSGIGINLREV-PDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVK  253 (393)
Q Consensus       176 -~~~~~glGi~~~~~-~~~~G~~~l~V~~V~~gsPA~~AGL~~GD~IlsVnG~~v~~~~~~~v~~~L~g~~G~~V~Ltv~  253 (393)
                       ++.+.|+|+.+... +.. +  .++|..|.++|||++|||++||+|++|||+++.++...++..++++..|++|+|+|.
T Consensus        80 ~~g~~~giG~~~~~~~~~~-~--~~~V~~v~~~spA~~aGl~~GD~I~~Ing~~v~~~~~~~~~~~l~~~~g~~v~l~v~  156 (388)
T 1fc6_A           80 TAGSVTGVGLEITYDGGSG-K--DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLH  156 (388)
T ss_dssp             SSSSCBBCSEEEEECTTCS-S--CEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHHHHHCBSTTCEEEEEEE
T ss_pred             hcCceEEEEEEEEEeecCC-C--cEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEE
Confidence             57788999999764 212 2  378999999999999999999999999999999998888999999999999999999


Q ss_pred             eCCCC-ceEEEEEEeeccccCceeeeeee--------ecCCCceEEEEEeCccchhHHHHHHHHHHHHHHCCCCeEEEEc
Q 016195          254 HGNCG-PIESIQVQRQLVARTPVFYRLEH--------LDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDL  324 (393)
Q Consensus       254 r~~~~-~~~~v~l~r~~~~~~~v~~~~~~--------l~~~~~~igYI~i~~F~~~~~~~l~~al~~l~~~g~~~lIlDL  324 (393)
                      |++.. +.++++++|+.+...++.+....        .+..+++||||+|++|...+.+++.++|.+|+++++++|||||
T Consensus       157 r~g~~~~~~~~~l~r~~i~~~~v~~~~~~~~~~~~~~~~~~~~~igYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIlDL  236 (388)
T 1fc6_A          157 APGAPSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDI  236 (388)
T ss_dssp             ETTEEEEEEEEEEECBCCCCCCEEEEEECSCCGGGSCTTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEEC
T ss_pred             eCCCCcceEEEEEEEceeecCceeeeeeccccccccccccCCCCEEEEEeCccCcchHHHHHHHHHHHHhCCCCeEEEEc
Confidence            98732 27889999988887888765421        1233578999999999999999999999999999999999999


Q ss_pred             cCCCCCcHHHHHHHHhccccCCcEEEEEeccCcccceeeecCCCCC-CCCcEEEEEcCCCcccccceec
Q 016195          325 RDNLGGLVQAGIEIAKLFLNEGETITYTVGRDPQYQKTIVADNSPL-VTAPVIVCAPAFKMRQQLFFYI  392 (393)
Q Consensus       325 R~N~GG~l~~a~~ia~lfl~~g~~v~~~~~r~~~~~~~~~~~~~~~-~~~PlvVLVN~~TaSaAE~fa~  392 (393)
                      |+|+||.+..+..++++|+++|. ++++.+|.+... .+...+... +++|++||||+.|+||||+|+.
T Consensus       237 R~N~GG~~~~~~~~~~~f~~~~~-i~~~~~r~~~~~-~~~~~~~~~~~~~pv~VLvn~~taSasEi~a~  303 (388)
T 1fc6_A          237 RNNGGGLFPAGVNVARMLVDRGD-LVLIADSQGIRD-IYSADGNSIDSATPLVVLVNRGTASASEVLAG  303 (388)
T ss_dssp             TTCCCBCHHHHHHHHHHHCSSSE-EEEEEETTEEEE-EEECCSCCSCSSSCEEEEECTTCCTHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHcCCCc-EEEEecCCCcee-EEecCCccccCCCCEEEEeCCCCccHHHHHHH
Confidence            99999999999999999999885 668888876542 344444444 8999999999999999999973



>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A Back     alignment and structure
>1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 393
d1fc6a4294 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C- 1e-17
d1fc6a4294 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C- 5e-09
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 1e-11
d1k32a4291 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease { 2e-11
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-11
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-10
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 5e-10
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-09
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-09
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-09
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-08
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-08
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 1e-08
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-08
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 3e-08
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-08
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 5e-08
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 5e-08
d1j7xa_302 c.14.1.2 (A:) Interphotoreceptor retinoid-binding 5e-08
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 7e-08
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 7e-08
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 8e-08
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-07
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-07
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-07
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-07
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-07
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-07
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 3e-07
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-07
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 4e-07
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 5e-07
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 7e-07
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 9e-07
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 9e-07
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-06
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 3e-06
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 7e-06
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 7e-06
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 8e-06
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 8e-06
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-05
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 1e-05
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 1e-05
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-05
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-05
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 3e-05
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 5e-05
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 7e-05
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 8e-05
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 2e-04
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 0.002
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 0.003
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Tail specific protease, catalytic domain
domain: Photosystem II D1 C-terminal processing protease
species: Algae (Scenedesmus obliquus) [TaxId: 3088]
 Score = 80.2 bits (197), Expect = 1e-17
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 4/100 (4%)

Query: 101 NEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILS-SSIQTRSKAHGIIKRMLASLG 159
            + +  EAW+ V+ +++D     +  Q+W + RE  L    +  R++ +  I++MLA L 
Sbjct: 4   EQLLFLEAWRAVDRAYVD---KSFNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLD 60

Query: 160 DPYTRFLSPAEFSKMARYDMSGIGINLREVPDANGVVTLK 199
           DP+TRFL P+  + + R     I               L 
Sbjct: 61  DPFTRFLEPSRLAALRRGTKVTINPVTFTTCSNVAAAALP 100


>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 291 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 302 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query393
d1fc6a4294 Photosystem II D1 C-terminal processing protease { 100.0
d1k32a4291 Tricorn protease {Archaeon Thermoplasma acidophilu 99.93
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.66
d1j7xa_302 Interphotoreceptor retinoid-binding protein IRBP { 99.55
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.33
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.32
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.19
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.17
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.16
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.14
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.13
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.12
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.09
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.06
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.05
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.04
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.03
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.02
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.02
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.02
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.0
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.0
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.0
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.99
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.98
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.96
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.95
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.95
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.95
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.95
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.94
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.94
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.94
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.93
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.93
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.92
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.91
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.91
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.9
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.9
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.89
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.89
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.89
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.88
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.88
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.86
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.85
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.84
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.84
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.84
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.82
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.79
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.79
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.79
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.78
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.74
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.73
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.73
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.72
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.68
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.67
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.67
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.63
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.57
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.56
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.48
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Tail specific protease, catalytic domain
domain: Photosystem II D1 C-terminal processing protease
species: Algae (Scenedesmus obliquus) [TaxId: 3088]
Probab=100.00  E-value=4.5e-34  Score=274.74  Aligned_cols=207  Identities=26%  Similarity=0.436  Sum_probs=158.5

Q ss_pred             ChHHHHHHHHHHHHHhcCCCCCCCCChhhHHHHHHHHhhh-cccChHHHHHHHHHHHHhcCCCceeecCHHHHhhhccCc
Q 016195          100 TNEGIVEEAWQIVNDSFLDTGRHRWTPQNWQRKREDILSS-SIQTRSKAHGIIKRMLASLGDPYTRFLSPAEFSKMARYD  178 (393)
Q Consensus       100 ~~~~~f~~~W~~v~~~y~d~~~~~~~~~dW~~v~~~y~~~-~i~t~~~~~~~i~~ml~~L~D~ht~~~~~~e~~~~~~~~  178 (393)
                      +.+++|+++|+.++++|||+.   |+++||++++++|++. .+.++++++.+|++|+++|+|+|++|+++++++.+.++.
T Consensus         3 ~~~~if~e~W~~~~~~y~~~~---~~gvDW~a~~~~y~~~~~~~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~g~   79 (294)
T d1fc6a4           3 SEQLLFLEAWRAVDRAYVDKS---FNGQSWFKLRETYLKKEPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGT   79 (294)
T ss_dssp             HHHHHHHHHHHHHHHHCSCTT---GGGCCHHHHHHHHHHHSCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHCS
T ss_pred             cHHHHHHHHHHHhhccccCCC---CCccCHHHHHHHHhccccCCCHHHHHHHHHHHHHHhCCCceEEeChHHhhhhccCc
Confidence            456799999999999999994   8999999999999875 357889999999999999999999999999988765322


Q ss_pred             eeeeEEEEEEeeCCCCeeEEEEEEEcCCChhhhcCCCCCCEEEEECCEEcCCCCHHHHHHHhcCCCCCeEEEEEEeCCCC
Q 016195          179 MSGIGINLREVPDANGVVTLKVLGLILDGPAHSAGVRQGDEVLAVNGVDVRGKSAFEVSSLLQGPSETFVTIEVKHGNCG  258 (393)
Q Consensus       179 ~~glGi~~~~~~~~~G~~~l~V~~V~~gsPA~~AGL~~GD~IlsVnG~~v~~~~~~~v~~~L~g~~G~~V~Ltv~r~~~~  258 (393)
                      ...+.                                                               .+..+....   
T Consensus        80 ~~~~~---------------------------------------------------------------~~~~~~~~~---   93 (294)
T d1fc6a4          80 KVTIN---------------------------------------------------------------PVTFTTCSN---   93 (294)
T ss_dssp             CCCCC---------------------------------------------------------------CEEEEEECS---
T ss_pred             eEEec---------------------------------------------------------------ccCCCcccc---
Confidence            11000                                                               000000000   


Q ss_pred             ceEEEEEEeeccccCceeeeeeeecCCCceEEEEEeCccchhHHHHHHHHHHHHHHCCCCeEEEEccCCCCCcHHHHHHH
Q 016195          259 PIESIQVQRQLVARTPVFYRLEHLDNGTTSVGYMRLKEFNALARKDLVTAMKRLQDMGASYFILDLRDNLGGLVQAGIEI  338 (393)
Q Consensus       259 ~~~~v~l~r~~~~~~~v~~~~~~l~~~~~~igYI~i~~F~~~~~~~l~~al~~l~~~g~~~lIlDLR~N~GG~l~~a~~i  338 (393)
                                 +....+.     ....+++||||+|.+|...+.+++++++.+|++++++++|||||+|+||.+..|..+
T Consensus        94 -----------~~~~~~~-----~~~~~~~IGYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIiDLR~N~GG~~~~a~~~  157 (294)
T d1fc6a4          94 -----------VAAAALP-----PGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLFPAGVNV  157 (294)
T ss_dssp             -----------CCGGGSC-----TTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEECTTCCCBCHHHHHHH
T ss_pred             -----------ccccccc-----CCCCCCcEEEEEEcccCchhHHHHHHHHHHHHHCCCcEEEEEeecCcccchhhhHHH
Confidence                       0000000     012357899999999999999999999999999999999999999999999999999


Q ss_pred             HhccccCCcEEEEEeccCcccceeeecCCCCCCCCcEEEEEcCCCcccccceec
Q 016195          339 AKLFLNEGETITYTVGRDPQYQKTIVADNSPLVTAPVIVCAPAFKMRQQLFFYI  392 (393)
Q Consensus       339 a~lfl~~g~~v~~~~~r~~~~~~~~~~~~~~~~~~PlvVLVN~~TaSaAE~fa~  392 (393)
                      +++|++++..+ ++..+++.........+...+.+|++||||+.|+||||+|+.
T Consensus       158 ~~~f~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~pv~VL~~~~TaSaaE~~a~  210 (294)
T d1fc6a4         158 ARMLVDRGDLV-LIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAG  210 (294)
T ss_dssp             HHHHCSSSEEE-EEEETTEEEEEEECCSCCSCSSSCEEEEECTTCCTHHHHHHH
T ss_pred             HHhhcccccce-EEEEeccccceeccccccccccceEEEEecCCccchHHHHHH
Confidence            99999998755 444444332222223445678899999999999999999974



>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure