Citrus Sinensis ID: 016201

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLPSLQSRFWGSHAS
cccccccccEEEEEEEEEEEEHHHHHHHHHccccEEEEcccccccccEEEccccccEEccccccccccccccccccccEEEEEEEccccccccccEEEEEEccccccccEEcccccccccccEEEEEccEEEEEEccccccccccEEEEEEcccccEEccccccccccccEEEEEEEccEEEEEccccccccccccccEEEEEcccccEEccccccccccccEEEEEccEEEEEcccccccccccEEEEEcEEEccccccccEEEccccccccccEEEEEEccEEEEEccccccccccccccccccccccEEEEEEEEEccccccEEEccccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEccccccccccccccccc
ccccccccccccccHEEEEHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccEEEccccccccccccEEEEEEccccccccccEcHHHcccccccccccccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccccccccccccccccccEEEEEcccEEEEEEccccccccccccEEEEEccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEEEEccccccccccccccccccccccEEEEEEccEEEEEEcccccccccccccEEEEcccccEEcccEEEcccccccEEcccccccccccEEEEEEEccEEEEEEccccccccccEEEEEEEEEEEcccccccccHHccccccc
marfdhhnkhtytktgCWFLCVLGLLGAALIADFmwasssssfssssahLSVASNWALEKSGVvviphvnatkidrqrESVAVIDKKGQDAERFLSAtfadlpapdleweqmpsapvprldgaAIQIKNLFYVFAGygsldyvhshvdvynftdnkwvdrfdmpkdmahshlgvvsDGRYIYIVsgqygpqcrgptsrtfvldsetrkwdsipplpspryspatqlwrgrlhvmggskenrhtpglehwsiAVKDGKALEKAWrteipiprggphracfvfndrlfvvggqegdfmakpgspifkcsrrhevvygdvymlddemkwkvlppmpkpnshieCAWVIVNNSIiitggttekhpmtkRMILVGEVFQFHLdslpslqsrfwgshas
marfdhhnkhtytktgCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHvnatkidrqresvAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGqygpqcrgptSRTFVLDsetrkwdsipplpspryspATQLWRGRLHVMGGSkenrhtpglehwsiAVKDGKALEKAWRTeipiprggphRACFVFNDRLFVVGGQEGDFMAkpgspifkcsrrhEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDslpslqsrfwgshas
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWasssssfssssahlsvasNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLPSLQSRFWGSHAS
*********HTYTKTGCWFLCVLGLLGAALIADFMWA************LSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDK*****ERFLSATFADLPAPDLEWE*****PVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLD********************TQLWRGRLHVM*********PGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLPSLQ*RF******
*********HTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEK***************RQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDS**************
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWAS*************VASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLPSLQSRFWGSHAS
************TKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLPSL**********
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARFDHHNKHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSLPSLQSRFWGSHAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query393 2.2.26 [Sep-21-2011]
Q9LK31426 Kelch repeat-containing p no no 0.893 0.823 0.653 1e-138
Q6DFF6604 Kelch-like protein 20 OS= N/A no 0.440 0.286 0.254 9e-10
Q5ZKD9610 Kelch-like protein 20 OS= yes no 0.440 0.283 0.254 9e-10
Q8VCK5604 Kelch-like protein 20 OS= yes no 0.440 0.286 0.248 2e-09
D3Z8N4609 Kelch-like protein 20 OS= yes no 0.440 0.284 0.248 3e-09
Q9Y2M5609 Kelch-like protein 20 OS= yes no 0.440 0.284 0.248 3e-09
Q08DK3609 Kelch-like protein 20 OS= yes no 0.440 0.284 0.248 3e-09
Q5R7B8609 Kelch-like protein 20 OS= yes no 0.440 0.284 0.248 3e-09
Q91XA8350 Kelch domain-containing p no no 0.603 0.677 0.211 3e-09
B4J045624 Kelch-like protein diablo N/A no 0.440 0.277 0.232 8e-09
>sp|Q9LK31|Y3272_ARATH Kelch repeat-containing protein At3g27220 OS=Arabidopsis thaliana GN=At3g27220 PE=1 SV=1 Back     alignment and function desciption
 Score =  490 bits (1262), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/361 (65%), Positives = 285/361 (78%), Gaps = 10/361 (2%)

Query: 20  LCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRE 79
           L    +LG   IA F+    SSS  S SA  S+   W       + IP +++  +  Q+ 
Sbjct: 22  LYFTSVLGIGFIAAFL--CLSSSIPSVSAVFSI---WVPVNRPEIQIPIIDSKIV--QKR 74

Query: 80  SVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGS 139
           S    D K  D  RFLSA FAD+PAP+L+WE+M SAPVPRLDG ++QI NL YVF+GYGS
Sbjct: 75  SKQSNDTK--DHVRFLSAIFADIPAPELKWEEMESAPVPRLDGYSVQINNLLYVFSGYGS 132

Query: 140 LDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRT 199
           LDYVHSHVDV+NFTDNKW DRF  PK+MA+SHLG+V+DGRY+Y+VSGQ GPQCRGPTSR+
Sbjct: 133 LDYVHSHVDVFNFTDNKWCDRFHTPKEMANSHLGIVTDGRYVYVVSGQLGPQCRGPTSRS 192

Query: 200 FVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKAL 259
           FVLDS T+ W   P LP+PRY+PATQ+WRGRLHVMGGSKENR+    +HWSIAVKDGKAL
Sbjct: 193 FVLDSFTKTWLEFPSLPAPRYAPATQIWRGRLHVMGGSKENRNAVAFDHWSIAVKDGKAL 252

Query: 260 EKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYM 319
           ++ WR E+PIPRGGPHRAC V ND+L V+GGQEGDFMAKP SPIFKCSRR E+  G+VYM
Sbjct: 253 DE-WREEVPIPRGGPHRACVVANDKLLVIGGQEGDFMAKPNSPIFKCSRRREIFNGEVYM 311

Query: 320 LDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDS 379
           +D+EMKWK+LPPMPK NSHIE AW+IVNNSI+I GGTT+ HP+TKR++LVGE+F+F LD+
Sbjct: 312 MDEEMKWKMLPPMPKNNSHIESAWIIVNNSIVIVGGTTDWHPVTKRLVLVGEIFRFQLDT 371

Query: 380 L 380
           L
Sbjct: 372 L 372

Arabidopsis thaliana (taxid: 3702)
>sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 Back     alignment and function description
>sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 Back     alignment and function description
>sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q91XA8|KLD8A_MOUSE Kelch domain-containing protein 8A OS=Mus musculus GN=Klhdc8a PE=2 SV=1 Back     alignment and function description
>sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query393
296090252431 unnamed protein product [Vitis vinifera] 0.921 0.839 0.750 1e-165
225452169423 PREDICTED: kelch repeat-containing prote 0.921 0.855 0.750 1e-165
255536987430 conserved hypothetical protein [Ricinus 0.954 0.872 0.740 1e-159
449449581418 PREDICTED: kelch repeat-containing prote 0.918 0.863 0.707 1e-159
449479719418 PREDICTED: LOW QUALITY PROTEIN: kelch re 0.918 0.863 0.704 1e-158
225443351426 PREDICTED: kelch repeat-containing prote 0.918 0.847 0.727 1e-156
255561818425 conserved hypothetical protein [Ricinus 0.882 0.816 0.719 1e-151
363814328436 uncharacterized protein LOC100777575 [Gl 0.944 0.850 0.667 1e-150
356560517434 PREDICTED: kelch repeat-containing prote 0.898 0.813 0.684 1e-150
147774647357 hypothetical protein VITISV_033894 [Viti 0.768 0.845 0.814 1e-149
>gi|296090252|emb|CBI40071.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/373 (75%), Positives = 317/373 (84%), Gaps = 11/373 (2%)

Query: 9   KHTYTKTGCWFLCVLGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPH 68
           KH  +K        +G LGA L+AD++WAS+S       A+LS+ASNWAL KS  VVIP 
Sbjct: 7   KHYTSKKLVLLASFVGFLGAILVADYLWASASF------AYLSIASNWALTKSSTVVIP- 59

Query: 69  VNATKIDRQ-RESVAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQI 127
              T  D + ++ V V DKK + + R LSATFADLPAP+L+WE+M  APVPRLDGA+IQI
Sbjct: 60  ---TNFDEKLQQRVDVKDKKNRTSGRILSATFADLPAPELKWEEMQPAPVPRLDGASIQI 116

Query: 128 KNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQ 187
           KNL YVFAGYG+L+YVHSHVD+YN TDN W  RFDMPK+MAHSHLG+ +DGRYIYIVSGQ
Sbjct: 117 KNLLYVFAGYGTLNYVHSHVDIYNITDNAWGGRFDMPKEMAHSHLGMATDGRYIYIVSGQ 176

Query: 188 YGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLE 247
           YGPQCRGPT+R FVLD+ET+KW  +P LP+PRY+PATQLWRGRLHVMGG KENRHTPGLE
Sbjct: 177 YGPQCRGPTARCFVLDTETKKWQDLPTLPAPRYAPATQLWRGRLHVMGGGKENRHTPGLE 236

Query: 248 HWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCS 307
           HWS+AVK+GKALEK WR+EIPIPRGGPHRAC V +DRLFV+GGQEGDFMAKPGSPIFKCS
Sbjct: 237 HWSLAVKNGKALEKEWRSEIPIPRGGPHRACVVVDDRLFVIGGQEGDFMAKPGSPIFKCS 296

Query: 308 RRHEVVYGDVYMLDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMI 367
           RRHEVVY DVYMLDDEMKWKVLPPMPKP+SHIE AWV+VNNSIII GGTTEKHP+TKRMI
Sbjct: 297 RRHEVVYEDVYMLDDEMKWKVLPPMPKPDSHIEFAWVVVNNSIIIVGGTTEKHPVTKRMI 356

Query: 368 LVGEVFQFHLDSL 380
           LVGEVFQFHLDSL
Sbjct: 357 LVGEVFQFHLDSL 369

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225452169|ref|XP_002270625.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255536987|ref|XP_002509560.1| conserved hypothetical protein [Ricinus communis] gi|223549459|gb|EEF50947.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449449581|ref|XP_004142543.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449479719|ref|XP_004155687.1| PREDICTED: LOW QUALITY PROTEIN: kelch repeat-containing protein At3g27220-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225443351|ref|XP_002265018.1| PREDICTED: kelch repeat-containing protein At3g27220 [Vitis vinifera] gi|297735771|emb|CBI18458.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561818|ref|XP_002521918.1| conserved hypothetical protein [Ricinus communis] gi|223538843|gb|EEF40442.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|363814328|ref|NP_001242294.1| uncharacterized protein LOC100777575 [Glycine max] gi|255635360|gb|ACU18033.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356560517|ref|XP_003548538.1| PREDICTED: kelch repeat-containing protein At3g27220-like [Glycine max] Back     alignment and taxonomy information
>gi|147774647|emb|CAN72147.1| hypothetical protein VITISV_033894 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query393
TAIR|locus:2033944415 AT1G51540 [Arabidopsis thalian 0.877 0.831 0.675 1.8e-133
TAIR|locus:2086528426 AT3G27220 "AT3G27220" [Arabido 0.928 0.856 0.618 3.6e-128
UNIPROTKB|B4L0G9617 dbo "Kelch-like protein diablo 0.430 0.273 0.275 2e-09
UNIPROTKB|B4J045624 dbo "Kelch-like protein diablo 0.430 0.270 0.275 2e-09
UNIPROTKB|B4LIG6624 dbo "Kelch-like protein diablo 0.430 0.270 0.275 2e-09
UNIPROTKB|Q6DFF6604 klhl20 "Kelch-like protein 20" 0.440 0.286 0.254 3.2e-09
UNIPROTKB|F1NMM8609 KLHL20 "Kelch-like protein 20" 0.440 0.284 0.254 3.2e-09
UNIPROTKB|Q5ZKD9610 KLHL20 "Kelch-like protein 20" 0.440 0.283 0.254 3.2e-09
UNIPROTKB|F1NGH0617 KLHL20 "Kelch-like protein 20" 0.440 0.280 0.254 3.3e-09
UNIPROTKB|B0WWP2582 dbo "Kelch-like protein diablo 0.430 0.290 0.275 3.9e-09
TAIR|locus:2033944 AT1G51540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1308 (465.5 bits), Expect = 1.8e-133, P = 1.8e-133
 Identities = 243/360 (67%), Positives = 285/360 (79%)

Query:    21 CVLGLLGAALIADFMWXXXXXXXXXXXXXXXXXXNWALEKSGVVVIPHVNATKIDRQRES 80
             C+  LL   LIADF+W                    +L  S   VI  V   + D ++  
Sbjct:    15 CI-ALLATGLIADFLWATSHRFSSAAISAGL-----SLPSSLTTVI--VPGQEKDTKK-- 64

Query:    81 VAVIDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSL 140
                  KK    ER LS TF DLPAP+L+WE+M ++PVPRLDGAAIQI++L YVFAGYG++
Sbjct:    65 -----KKDSVKERKLSNTFQDLPAPELKWEKMAASPVPRLDGAAIQIRDLLYVFAGYGTI 119

Query:   141 DYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIVSGQYGPQCRGPTSRTF 200
             D VHSHVD+YNFTDN W  RF+MPKDMAHSHLG+V+DGRYIYIV+GQ+GPQCRGPT++TF
Sbjct:   120 DLVHSHVDIYNFTDNSWGGRFNMPKDMAHSHLGMVTDGRYIYIVTGQFGPQCRGPTAKTF 179

Query:   201 VLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALE 260
             VLD++T  W    PLP PRY+PATQLWRGRLHVMGGSKENR TPGLEHWSIAVKDGK+LE
Sbjct:   180 VLDTDTNTWKDFVPLPVPRYAPATQLWRGRLHVMGGSKENRFTPGLEHWSIAVKDGKSLE 239

Query:   261 KAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYML 320
               WR+EIPIPRGGPHRAC V +DRLFV+GGQEGDFMAKPGSPIFKCSRR EVV+ DVYML
Sbjct:   240 NEWRSEIPIPRGGPHRACVVVDDRLFVIGGQEGDFMAKPGSPIFKCSRRMEVVFSDVYML 299

Query:   321 DDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVFQFHLDSL 380
             D+EMKWKV+PPMPKP+SHIE AW +VNNSI+I GGTTEKHP TK+M+LVGE+FQF+L++L
Sbjct:   300 DEEMKWKVMPPMPKPDSHIEFAWKVVNNSIVIVGGTTEKHPETKKMVLVGEIFQFNLNTL 359
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2086528 AT3G27220 "AT3G27220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B4L0G9 dbo "Kelch-like protein diablo" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4J045 dbo "Kelch-like protein diablo" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4LIG6 dbo "Kelch-like protein diablo" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DFF6 klhl20 "Kelch-like protein 20" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMM8 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKD9 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGH0 KLHL20 "Kelch-like protein 20" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B0WWP2 dbo "Kelch-like protein diablo" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.n1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 8e-10
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-08
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 8e-08
pfam1396450 pfam13964, Kelch_6, Kelch motif 4e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 2e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 7e-04
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 61.7 bits (150), Expect = 2e-10
 Identities = 50/237 (21%), Positives = 84/237 (35%), Gaps = 34/237 (14%)

Query: 123 AAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIY 182
            ++ + N+ Y   G    +   + V  Y+     W    ++       + GV      IY
Sbjct: 289 GSVVLNNVIYFIGGMNKNNLSVNSVVSYDTKTKSWNKVPEL--IYPRKNPGVTVFNNRIY 346

Query: 183 IVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKEN-R 241
           ++ G Y        +          KW   PPL  PRY+P        ++V+GG  +N  
Sbjct: 347 VIGGIYN---SISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGISKNDE 403

Query: 242 HTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGS 301
               +E +S+           W    P+P           + +++V+GG          S
Sbjct: 404 LLKTVECFSL-------NTNKWSKGSPLPISHYGGCAIYHDGKIYVIGGI---------S 447

Query: 302 PIFKCSRRHEVVYGDVYMLDDEM-KWKVLPPM--PKPNSHIECAWVIVNNSIIITGG 355
            I      +  VY  V   +    KW  L  +  P+ N+ + C   I NN I + GG
Sbjct: 448 YI-----DNIKVYNIVESYNPVTNKWTELSSLNFPRINASL-C---IFNNKIYVVGG 495

Length = 534
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 393
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PLN02153341 epithiospecifier protein 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.94
KOG1230 521 consensus Protein containing repeated kelch motifs 99.92
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.91
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.86
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.76
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.36
PF1396450 Kelch_6: Kelch motif 99.35
PF1396450 Kelch_6: Kelch motif 99.3
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.21
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.17
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.03
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.03
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.99
PF1341549 Kelch_3: Galactose oxidase, central domain 98.98
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.93
PF1341549 Kelch_3: Galactose oxidase, central domain 98.87
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.81
smart0061247 Kelch Kelch domain. 98.81
smart0061247 Kelch Kelch domain. 98.72
PF1385442 Kelch_5: Kelch motif 98.58
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.56
PLN02772 398 guanylate kinase 98.45
PLN02772 398 guanylate kinase 98.37
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.3
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.24
PF1385442 Kelch_5: Kelch motif 98.23
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.14
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.82
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.63
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.6
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.57
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.52
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.03
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.78
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.41
PF12768281 Rax2: Cortical protein marker for cell polarity 96.03
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.0
KOG2055514 consensus WD40 repeat protein [General function pr 95.79
PRK13684334 Ycf48-like protein; Provisional 95.76
PF12768281 Rax2: Cortical protein marker for cell polarity 95.68
PRK13684334 Ycf48-like protein; Provisional 95.52
smart00284255 OLF Olfactomedin-like domains. 95.51
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.36
KOG0310 487 consensus Conserved WD40 repeat-containing protein 93.99
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 93.9
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.62
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.4
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.3
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.4
KOG2055514 consensus WD40 repeat protein [General function pr 92.39
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.03
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.92
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.39
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.44
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 88.02
PRK04792448 tolB translocation protein TolB; Provisional 87.53
PLN00033398 photosystem II stability/assembly factor; Provisio 87.3
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 87.17
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 87.1
smart00284255 OLF Olfactomedin-like domains. 87.02
KOG0289506 consensus mRNA splicing factor [General function p 86.83
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 86.17
PLN00033398 photosystem II stability/assembly factor; Provisio 85.58
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 85.51
PF12217367 End_beta_propel: Catalytic beta propeller domain o 85.29
KOG2048 691 consensus WD40 repeat protein [General function pr 84.84
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 83.98
KOG0310487 consensus Conserved WD40 repeat-containing protein 83.87
PF12217367 End_beta_propel: Catalytic beta propeller domain o 83.76
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 83.72
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 83.32
COG1520370 FOG: WD40-like repeat [Function unknown] 82.79
KOG0649325 consensus WD40 repeat protein [General function pr 82.14
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 81.96
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 81.28
PF13859310 BNR_3: BNR repeat-like domain; PDB: 3B69_A. 80.52
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=4.3e-45  Score=359.66  Aligned_cols=277  Identities=19%  Similarity=0.303  Sum_probs=243.4

Q ss_pred             hhccEEEEecCCCCCCCCcccceeeeeecCCCceEEecCCCCCccccccceeEEecCC-----cchhhHHhhcceeeccC
Q 016201           30 LIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKK-----GQDAERFLSATFADLPA  104 (393)
Q Consensus        30 ~~~~~ly~~GG~~~g~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~r~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~  104 (393)
                      ...+.||++||....  ...++.+++|||.++.|..++.|+.+   |..++++++++.     |...+....+.+++||+
T Consensus       282 ~~~~~l~~vGG~~~~--~~~~~~ve~yd~~~~~w~~~a~m~~~---r~~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~  356 (571)
T KOG4441|consen  282 SVSGKLVAVGGYNRQ--GQSLRSVECYDPKTNEWSSLAPMPSP---RCRVGVAVLNGKLYVVGGYDSGSDRLSSVERYDP  356 (571)
T ss_pred             CCCCeEEEECCCCCC--CcccceeEEecCCcCcEeecCCCCcc---cccccEEEECCEEEEEccccCCCcccceEEEecC
Confidence            567889999999332  57788999999999999999999988   999999999877     33312334449999999


Q ss_pred             CCCCeEEcCCCCccccCccEEEECCEEEEEecCCCCCCccceEEEEECCCCceEeCCCCCCCCCcceeEEEEeCCEEEEE
Q 016201          105 PDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIYIV  184 (393)
Q Consensus       105 ~~~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~r~~~~~~~~~~~iyv~  184 (393)
                      ..++|+.+++|+.+|..+++++++++||++||.++... ++++|+|||.+++|+.+++|+.  +|.++++++++++||++
T Consensus       357 ~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~-l~svE~YDp~~~~W~~va~m~~--~r~~~gv~~~~g~iYi~  433 (571)
T KOG4441|consen  357 RTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKS-LNSVECYDPVTNKWTPVAPMLT--RRSGHGVAVLGGKLYII  433 (571)
T ss_pred             CCCceeccCCccCccccceeEEECCEEEEEeccccccc-cccEEEecCCCCcccccCCCCc--ceeeeEEEEECCEEEEE
Confidence            99999999999999999999999999999999997664 6899999999999999999998  49999999999999999


Q ss_pred             eceeCCCCCCCCCeeEEEeCCCCCeEeCCCCCCCCCCceEEEECCEEEEEccCCCCCCCCCcceeEeeeeccccccCCeE
Q 016201          185 SGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWR  264 (393)
Q Consensus       185 GG~~~~~~~~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~d~~~~~~~W~  264 (393)
                      ||.++...  .++.+++|||.+++|+.+++|+.+|.++++++++++||++||+++.....++++||       |.+++|+
T Consensus       434 GG~~~~~~--~l~sve~YDP~t~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~yd-------p~~~~W~  504 (571)
T KOG4441|consen  434 GGGDGSSN--CLNSVECYDPETNTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYD-------PETNQWT  504 (571)
T ss_pred             cCcCCCcc--ccceEEEEcCCCCceeecCCcccccccceEEEECCEEEEECCccCCCccceEEEEc-------CCCCcee
Confidence            99888652  48999999999999999999999999999999999999999998854455566666       8999999


Q ss_pred             EeccCCCCCCceeEEEECCEEEEEcCCCCCCCCCCCCCccccccccceecCceEEeC-CCCCeEECCCCCCCCCCcc
Q 016201          265 TEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPMPKPNSHIE  340 (393)
Q Consensus       265 ~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd-~~~~W~~~~~~~~~r~~~~  340 (393)
                      .+++|+.++..+++++++++||++||.++..                 .++.|.+|| .+++|+...++...|....
T Consensus       505 ~v~~m~~~rs~~g~~~~~~~ly~vGG~~~~~-----------------~l~~ve~ydp~~d~W~~~~~~~~~~~~~~  564 (571)
T KOG4441|consen  505 MVAPMTSPRSAVGVVVLGGKLYAVGGFDGNN-----------------NLNTVECYDPETDTWTEVTEPESGRGGAG  564 (571)
T ss_pred             EcccCccccccccEEEECCEEEEEecccCcc-----------------ccceeEEcCCCCCceeeCCCccccccCcc
Confidence            9999999999999999999999999988764                 477899999 5689999998666665543

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF13859 BNR_3: BNR repeat-like domain; PDB: 3B69_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 2e-06
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 5e-05
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-06
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 8e-05
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-04
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 7e-04
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 96/234 (41%), Gaps = 26/234 (11%)
Query: 66  IPHVNATKIDRQRESVAV----IDKKGQDAERFLSATFADLPAPDLEWEQMPSAPVPRLD 121
           IP  +++ + +Q +   V    +D++ +D  + L + F  L     EW  +P  P  R  
Sbjct: 45  IPRNHSSIVTQQNQVYVVGGLYVDEENKD--QPLQSYFFQLDNVSSEWVGLPPLPSARCL 102
Query: 122 GAAIQIKNLFYVFAGY-----GSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVS 176
               ++ +  YV AG       SLD V      Y+    KW +  ++P  + + H  V+S
Sbjct: 103 FGLGEVDDKIYVVAGKDLQTEASLDSVL----CYDPVAAKWSEVKNLPIKV-YGH-NVIS 156
Query: 177 DGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGG 236
               IY + G+     +  T+R F+ + +   W  + P+ +PR      + +G++ + GG
Sbjct: 157 HNGMIYCLGGKTDD--KKCTNRVFIYNPKKGDWKDLAPMKTPRSMFGVAIHKGKIVIAGG 214
Query: 237 SKENRHTPGLEHWSIAVKDGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGG 290
             E+  +  +E + +           W      P+     +       L+ +GG
Sbjct: 215 VTEDGLSASVEAFDLKT-------NKWEVMTEFPQERSSISLVSLAGSLYAIGG 261
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query393
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-32
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-20
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-18
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 7e-05
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-26
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 7e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-26
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 9e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-11
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-26
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 6e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-25
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-24
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-18
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 6e-13
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 1e-08
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-24
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-21
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-24
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-18
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 9e-15
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-04
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-12
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-12
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 8e-04
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
 Score =  124 bits (313), Expect = 1e-32
 Identities = 54/294 (18%), Positives = 89/294 (30%), Gaps = 50/294 (17%)

Query: 111 QMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHS 170
            +P  PVP   G      +  Y+  G         +       D KW      P      
Sbjct: 2   VLPETPVPFKSGTGAIDNDTVYIGLGSAG---TAWYKLDTQAKDKKWTALAAFPGGPRDQ 58

Query: 171 HLGVVSDGRYIYIVSGQYGPQCRGPTSRT--FVLDSETRKWDSI-PPLPSPRYSPATQLW 227
                 DG  +Y+  G                  + +T  W  +    P       T + 
Sbjct: 59  ATSAFIDGN-LYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKLMSHAPMGMAGHVTFVH 117

Query: 228 RGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKA------------------------- 262
            G+ +V GG  +N      E  + A KD  A++K                          
Sbjct: 118 NGKAYVTGGVNQNIFNGYFEDLNEAGKDSTAIDKINAHYFDKKAEDYFFNKFLLSFDPST 177

Query: 263 --WRTEIPIPRGGPHRAC-FVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYM 319
             W      P  G   A      D+ +++ G+     AKPG        R + V+ ++  
Sbjct: 178 QQWSYAGESPWYGTAGAAVVNKGDKTWLINGE-----AKPGL-------RTDAVF-ELDF 224

Query: 320 LDDEMKWKVLPPMPKPNSHIECAWVIVNNSIIITGGTTEKHPMTKRMILVGEVF 373
             + +KW  L P+  P+        I N+S+I  GG       ++     G+ +
Sbjct: 225 TGNNLKWNKLAPVSSPDGVAGGFAGISNDSLIFAGGAG--FKGSRENYQNGKNY 276
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query393
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.79
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.68
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.38
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.35
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.23
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.18
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.09
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.07
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.01
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.95
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.94
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 96.85
3jrp_A379 Fusion protein of protein transport protein SEC13 96.77
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 96.6
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.56
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 96.53
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.48
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.47
3jrp_A379 Fusion protein of protein transport protein SEC13 96.42
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.38
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.33
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.26
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.2
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.18
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.18
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.07
3jro_A 753 Fusion protein of protein transport protein SEC13 96.04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.93
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.86
3jro_A 753 Fusion protein of protein transport protein SEC13 95.79
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.75
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.72
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.71
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.7
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.58
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.58
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.57
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.52
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 95.4
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.33
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.29
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.22
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.22
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 95.17
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.15
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.14
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.14
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.09
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 95.08
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 95.07
2pm7_B297 Protein transport protein SEC13, protein transport 95.05
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.04
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.98
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.98
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.85
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.8
4a2l_A795 BT_4663, two-component system sensor histidine kin 94.75
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.75
3v9f_A781 Two-component system sensor histidine kinase/RESP 94.68
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 94.54
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.5
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 94.49
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 94.47
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 94.43
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.41
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.36
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.33
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.3
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 94.18
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.88
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.85
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.75
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.75
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.74
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.69
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.64
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 93.63
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.63
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 93.63
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 93.63
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 93.62
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.55
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.32
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 93.31
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 93.13
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.12
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.1
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 93.07
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 92.78
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 92.77
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.65
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.55
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.48
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.44
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 92.42
2pm7_B297 Protein transport protein SEC13, protein transport 92.41
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.41
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 92.21
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 92.16
4a2l_A 795 BT_4663, two-component system sensor histidine kin 91.98
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 91.79
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 91.41
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 91.4
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 91.17
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 91.16
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 91.14
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 91.05
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 90.89
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 90.61
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 90.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 90.16
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.12
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 90.11
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 89.89
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 89.53
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 89.35
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 89.07
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 88.91
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 88.77
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 88.5
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 88.26
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 88.18
2ymu_A577 WD-40 repeat protein; unknown function, two domain 88.04
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 87.66
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 87.63
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 87.13
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.05
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.02
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 86.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 86.93
4e54_B435 DNA damage-binding protein 2; beta barrel, double 86.78
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 86.72
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 86.69
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 86.68
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 86.49
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 85.78
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 85.64
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 85.5
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 85.41
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 85.27
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 84.9
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 84.89
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 84.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 84.56
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 84.31
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 84.3
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 84.08
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 84.07
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 83.97
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 83.21
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 82.73
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 82.45
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 82.13
3ott_A758 Two-component system sensor histidine kinase; beta 81.88
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 81.67
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 80.98
2ymu_A577 WD-40 repeat protein; unknown function, two domain 80.92
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 80.8
2fp8_A322 Strictosidine synthase; six bladed beta propeller 80.58
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 80.34
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=2.4e-47  Score=353.24  Aligned_cols=283  Identities=17%  Similarity=0.256  Sum_probs=240.3

Q ss_pred             HHHHHHhhhccEEEEecCCCCCCCCcccceeeeeecCCCceEEecCCCCCccccccceeEEecCC----cch----hhHH
Q 016201           23 LGLLGAALIADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKK----GQD----AERF   94 (393)
Q Consensus        23 ~~~~~~~~~~~~ly~~GG~~~g~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~r~~~~~~~~~~~----~~~----~~~~   94 (393)
                      +-.|+++.++++||++||. .   ...++++++||+.+++|..++.++.+   |..++++++++.    |..    ....
T Consensus        15 ~~~~~~~~~~~~i~v~GG~-~---~~~~~~~~~~d~~~~~W~~~~~~p~~---r~~~~~~~~~~~lyv~GG~~~~~~~~~   87 (308)
T 1zgk_A           15 PRGSHAPKVGRLIYTAGGY-F---RQSLSYLEAYNPSNGTWLRLADLQVP---RSGLAGCVVGGLLYAVGGRNNSPDGNT   87 (308)
T ss_dssp             ------CCCCCCEEEECCB-S---SSBCCCEEEEETTTTEEEECCCCSSC---CBSCEEEEETTEEEEECCEEEETTEEE
T ss_pred             eCCccccCCCCEEEEEeCc-C---CCCcceEEEEcCCCCeEeECCCCCcc---cccceEEEECCEEEEECCCcCCCCCCe
Confidence            3589999999999999998 3   35778999999999999999998887   888888877655    221    1222


Q ss_pred             hhcceeeccCCCCCeEEcCCCCccccCccEEEECCEEEEEecCCCCCCccceEEEEECCCCceEeCCCCCCCCCcceeEE
Q 016201           95 LSATFADLPAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGV  174 (393)
Q Consensus        95 ~~~~~~~~~~~~~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~r~~~~~  174 (393)
                      ...+++.||+.+++|+++++||.+|..|++++++++|||+||.+... .++++++||+.+++|+.++++|.+  |..+++
T Consensus        88 ~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~~~p~~--r~~~~~  164 (308)
T 1zgk_A           88 DSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCI-HHNSVERYEPERDEWHLVAPMLTR--RIGVGV  164 (308)
T ss_dssp             ECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTE-ECCCEEEEETTTTEEEECCCCSSC--CBSCEE
T ss_pred             ecceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCCCc-ccccEEEECCCCCeEeECCCCCcc--ccceEE
Confidence            33489999999999999999999999999999999999999987643 468899999999999999998874  888899


Q ss_pred             EEeCCEEEEEeceeCCCCCCCCCeeEEEeCCCCCeEeCCCCCCCCCCceEEEECCEEEEEccCCCCCCCCCcceeEeeee
Q 016201          175 VSDGRYIYIVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVK  254 (393)
Q Consensus       175 ~~~~~~iyv~GG~~~~~~~~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~  254 (393)
                      ++++++||++||.++..   ..+++++||+.+++|+.++++|.+|..|++++++++||++||..+....+.+++|+    
T Consensus       165 ~~~~~~iyv~GG~~~~~---~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~yd----  237 (308)
T 1zgk_A          165 AVLNRLLYAVGGFDGTN---RLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD----  237 (308)
T ss_dssp             EEETTEEEEECCBCSSC---BCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEE----
T ss_pred             EEECCEEEEEeCCCCCC---cCceEEEEeCCCCeEeeCCCCCCccccceEEEECCEEEEEeCCCCCCccceEEEEe----
Confidence            99999999999987653   27899999999999999999999999999999999999999998665556666666    


Q ss_pred             ccccccCCeEEeccCCCCCCceeEEEECCEEEEEcCCCCCCCCCCCCCccccccccceecCceEEeC-CCCCeEECCCCC
Q 016201          255 DGKALEKAWRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPMP  333 (393)
Q Consensus       255 d~~~~~~~W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd-~~~~W~~~~~~~  333 (393)
                         +.+++|+.++++|.+|..+++++++++|||+||.++..                 ..+++++|| .+++|+.+++||
T Consensus       238 ---~~~~~W~~~~~~p~~r~~~~~~~~~~~i~v~GG~~~~~-----------------~~~~v~~yd~~~~~W~~~~~~p  297 (308)
T 1zgk_A          238 ---VETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHT-----------------FLDSVECYDPDTDTWSEVTRMT  297 (308)
T ss_dssp             ---TTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSC-----------------BCCEEEEEETTTTEEEEEEECS
T ss_pred             ---CCCCcEEECCCCCCCccceEEEEECCEEEEEcCcCCCc-----------------ccceEEEEcCCCCEEeecCCCC
Confidence               68999999999999999999999999999999987542                 357899999 668999999999


Q ss_pred             CCCCCccee
Q 016201          334 KPNSHIECA  342 (393)
Q Consensus       334 ~~r~~~~~~  342 (393)
                      .+|..++++
T Consensus       298 ~~r~~~~~~  306 (308)
T 1zgk_A          298 SGRSGVGVA  306 (308)
T ss_dssp             SCCBSCEEE
T ss_pred             CCcccceeE
Confidence            999887553
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 393
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-06
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 47.9 bits (112), Expect = 1e-06
 Identities = 30/268 (11%), Positives = 74/268 (27%), Gaps = 25/268 (9%)

Query: 103 PAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFD 162
            + D                +A       +   G  S      + +VY+ +   W    +
Sbjct: 105 SSSDSWIPGPDMQVARGYQSSATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPN 164

Query: 163 MPKDMAHS--HLGVVSDGRYIYIVSGQYGP--QCRGPTSRTFVLDSETRKWDSIPPLPSP 218
              +   +    G+     + ++   + G   Q    T+  +   S +    S     S 
Sbjct: 165 AKVNPMLTADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYYTSGSGDVKSAGKRQSN 224

Query: 219 RYSPA---------TQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKAWRTEIPI 269
           R                 +G++   GGS + + +    +  I                  
Sbjct: 225 RGVAPDAMCGNAVMYDAVKGKILTFGGSPDYQDSDATTNAHIITLGEPGTSPNTVFASNG 284

Query: 270 PRGGPHR--ACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLDDEMKWK 327
                    +  + +   F+ GGQ      +  +P+F           ++Y+ + +  + 
Sbjct: 285 LYFARTFHTSVVLPDGSTFITGGQRRGIPFEDSTPVFTP---------EIYVPEQD-TFY 334

Query: 328 VLPPMPKPNSHIECAWVIVNNSIIITGG 355
              P      +   + ++ +  +   GG
Sbjct: 335 KQNPNSIVRVYHSISLLLPDGRVFNGGG 362
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query393
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.95
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.71
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.3
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.26
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.54
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.23
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.35
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.3
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.08
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 93.01
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.34
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 92.24
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.04
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 90.82
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 90.6
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.4
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.4
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 90.07
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.05
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 89.62
d1tbga_340 beta1-subunit of the signal-transducing G protein 89.6
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 89.48
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.37
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 88.83
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 88.12
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 87.66
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 87.4
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 87.14
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 86.62
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 85.39
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 85.23
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 84.87
d1tbga_340 beta1-subunit of the signal-transducing G protein 84.36
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 84.0
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 83.62
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.8e-41  Score=305.65  Aligned_cols=275  Identities=17%  Similarity=0.282  Sum_probs=236.8

Q ss_pred             hccEEEEecCCCCCCCCcccceeeeeecCCCceEEecCCCCCccccccceeEEecCC-----cch---hhHHhhcceeec
Q 016201           31 IADFMWASSSSSFSSSSAHLSVASNWALEKSGVVVIPHVNATKIDRQRESVAVIDKK-----GQD---AERFLSATFADL  102 (393)
Q Consensus        31 ~~~~ly~~GG~~~g~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~r~~~~~~~~~~~-----~~~---~~~~~~~~~~~~  102 (393)
                      ++++||++||. +.   ..++.+++||+++++|.++++|+.+   |..|+++++++.     |..   .......+++.|
T Consensus         3 ~g~~iyv~GG~-~~---~~~~~~~~yd~~t~~W~~~~~~p~~---R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~y   75 (288)
T d1zgka1           3 VGRLIYTAGGY-FR---QSLSYLEAYNPSNGTWLRLADLQVP---RSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCY   75 (288)
T ss_dssp             CCCCEEEECCB-SS---SBCCCEEEEETTTTEEEECCCCSSC---CBSCEEEEETTEEEEECCEEEETTEEEECCCEEEE
T ss_pred             cCCEEEEECCc-CC---CCCceEEEEECCCCeEEECCCCCCc---cceeEEEEECCEEEEEeCcccCCCCccccchhhhc
Confidence            57899999998 33   4678999999999999999999887   999988887655     111   111223489999


Q ss_pred             cCCCCCeEEcCCCCccccCccEEEECCEEEEEecCCCCCCccceEEEEECCCCceEeCCCCCCCCCcceeEEEEeCCEEE
Q 016201          103 PAPDLEWEQMPSAPVPRLDGAAIQIKNLFYVFAGYGSLDYVHSHVDVYNFTDNKWVDRFDMPKDMAHSHLGVVSDGRYIY  182 (393)
Q Consensus       103 ~~~~~~W~~~~~~~~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~r~~~~~~~~~~~iy  182 (393)
                      |+.+++|+.+++||.+|..|++++++++||++||..+.. .++++++||+.+++|...+.++.  .|..+++++.++++|
T Consensus        76 d~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~~-~~~~~~~~~~~~~~~~~~~~~~~--~r~~~~~~~~~~~~~  152 (288)
T d1zgka1          76 NPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCI-HHNSVERYEPERDEWHLVAPMLT--RRIGVGVAVLNRLLY  152 (288)
T ss_dssp             ETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTE-ECCCEEEEETTTTEEEECCCCSS--CCBSCEEEEETTEEE
T ss_pred             ccccccccccccccceecceeccccceeeEEecceeccc-ccceeeeeccccCcccccccccc--ccccceeeeeeecce
Confidence            999999999999999999999999999999999986554 46889999999999999888877  488899999999999


Q ss_pred             EEeceeCCCCCCCCCeeEEEeCCCCCeEeCCCCCCCCCCceEEEECCEEEEEccCCCCCCCCCcceeEeeeeccccccCC
Q 016201          183 IVSGQYGPQCRGPTSRTFVLDSETRKWDSIPPLPSPRYSPATQLWRGRLHVMGGSKENRHTPGLEHWSIAVKDGKALEKA  262 (393)
Q Consensus       183 v~GG~~~~~~~~~~~~v~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~d~~~~~~~  262 (393)
                      ++||.+...   ...++++||+.+++|...+.++.++..+++++.+++||++||............|+       ..+++
T Consensus       153 ~~GG~~~~~---~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~~~~~~~~~~~-------~~~~~  222 (288)
T d1zgka1         153 AVGGFDGTN---RLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD-------VETET  222 (288)
T ss_dssp             EECCBCSSC---BCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEE-------TTTTE
T ss_pred             EecCccccc---ccceEEEeeccccccccccccccccccccccceeeeEEEecCccccccccceeeee-------eccee
Confidence            999986543   37789999999999999999999999999999999999999998766666666666       58999


Q ss_pred             eEEeccCCCCCCceeEEEECCEEEEEcCCCCCCCCCCCCCccccccccceecCceEEeC-CCCCeEECCCCCCCCCCcce
Q 016201          263 WRTEIPIPRGGPHRACFVFNDRLFVVGGQEGDFMAKPGSPIFKCSRRHEVVYGDVYMLD-DEMKWKVLPPMPKPNSHIEC  341 (393)
Q Consensus       263 W~~~~~~p~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~~~~~~~~v~~yd-~~~~W~~~~~~~~~r~~~~~  341 (393)
                      |+.++++|.+|..+++++++++|||+||.+...                 .++++++|| .+++|+.+++||.+|.++++
T Consensus       223 ~~~~~~~p~~r~~~~~~~~~~~l~v~GG~~~~~-----------------~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~  285 (288)
T d1zgka1         223 WTFVAPMKHRRSALGITVHQGRIYVLGGYDGHT-----------------FLDSVECYDPDTDTWSEVTRMTSGRSGVGV  285 (288)
T ss_dssp             EEECCCCSSCCBSCEEEEETTEEEEECCBCSSC-----------------BCCEEEEEETTTTEEEEEEECSSCCBSCEE
T ss_pred             eecccCccCcccceEEEEECCEEEEEecCCCCe-----------------ecceEEEEECCCCEEEECCCCCCCcEeEEE
Confidence            999999999999999999999999999987543                 467799999 67899999999999988754


Q ss_pred             e
Q 016201          342 A  342 (393)
Q Consensus       342 ~  342 (393)
                      +
T Consensus       286 ~  286 (288)
T d1zgka1         286 A  286 (288)
T ss_dssp             E
T ss_pred             E
Confidence            3
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure