Citrus Sinensis ID: 016204
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 393 | ||||||
| 255567758 | 313 | catalytic, putative [Ricinus communis] g | 0.529 | 0.664 | 0.793 | 5e-96 | |
| 413968592 | 223 | HAD superfamily protein [Solanum tuberos | 0.529 | 0.932 | 0.786 | 3e-93 | |
| 224127222 | 308 | predicted protein [Populus trichocarpa] | 0.513 | 0.655 | 0.772 | 2e-89 | |
| 297807077 | 306 | hypothetical protein ARALYDRAFT_909002 [ | 0.506 | 0.650 | 0.745 | 9e-85 | |
| 449452883 | 313 | PREDICTED: uncharacterized hydrolase Yut | 0.529 | 0.664 | 0.778 | 1e-84 | |
| 225434150 | 314 | PREDICTED: uncharacterized hydrolase yut | 0.529 | 0.662 | 0.760 | 7e-84 | |
| 19310550 | 316 | unknown protein [Arabidopsis thaliana] | 0.506 | 0.629 | 0.735 | 7e-84 | |
| 42567769 | 306 | haloacid dehalogenase-like hydrolase dom | 0.506 | 0.650 | 0.735 | 8e-84 | |
| 357475623 | 312 | hypothetical protein MTR_4g087590 [Medic | 0.526 | 0.663 | 0.764 | 5e-83 | |
| 356500114 | 315 | PREDICTED: uncharacterized hydrolase yut | 0.529 | 0.660 | 0.752 | 2e-81 |
| >gi|255567758|ref|XP_002524857.1| catalytic, putative [Ricinus communis] gi|223535820|gb|EEF37481.1| catalytic, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 357 bits (917), Expect = 5e-96, Method: Compositional matrix adjust.
Identities = 165/208 (79%), Positives = 190/208 (91%)
Query: 1 MIAKCSVQSNDPHLFQTLNGLRHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLAT 60
M+ + S++ N+ HLFQT NGL+H+AETRRFKAWLLDQFGVLHDGK+PYPGAISTL+ +A+
Sbjct: 1 MMPQSSIKYNEAHLFQTFNGLQHLAETRRFKAWLLDQFGVLHDGKQPYPGAISTLKKIAS 60
Query: 61 TGAKMVVISNSSRRASTTIDKLKSLGFDPSLFAGAITSGELTHQYLLRRDDAWFAALGRS 120
+GAKMV+ISNSSRRASTT+DK+KSLGFDPSLF GAITSGELTHQ+L RRDD WFAALG+S
Sbjct: 61 SGAKMVIISNSSRRASTTMDKMKSLGFDPSLFVGAITSGELTHQFLQRRDDDWFAALGKS 120
Query: 121 CIHMTWSDRGAISLEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEI 180
CIHMTWSDRGAISLEGLGL+VVENVEEA F+LAHGTE +G PSG PM+L++LEKILE
Sbjct: 121 CIHMTWSDRGAISLEGLGLQVVENVEEAAFVLAHGTEALGQPSGAACPMTLEELEKILEH 180
Query: 181 CASKKIPMVVANPDYVTVEARALRVMPG 208
CA+K IPMVVANPD+VTVEAR LRVMPG
Sbjct: 181 CAAKGIPMVVANPDFVTVEARNLRVMPG 208
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|413968592|gb|AFW90633.1| HAD superfamily protein [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|224127222|ref|XP_002329430.1| predicted protein [Populus trichocarpa] gi|222870480|gb|EEF07611.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297807077|ref|XP_002871422.1| hypothetical protein ARALYDRAFT_909002 [Arabidopsis lyrata subsp. lyrata] gi|297317259|gb|EFH47681.1| hypothetical protein ARALYDRAFT_909002 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449452883|ref|XP_004144188.1| PREDICTED: uncharacterized hydrolase YutF-like [Cucumis sativus] gi|449511400|ref|XP_004163945.1| PREDICTED: uncharacterized hydrolase YutF-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225434150|ref|XP_002278008.1| PREDICTED: uncharacterized hydrolase yutF [Vitis vinifera] gi|296084318|emb|CBI24706.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|19310550|gb|AAL85008.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42567769|ref|NP_196608.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|50198963|gb|AAT70484.1| At5g10460 [Arabidopsis thaliana] gi|332004162|gb|AED91545.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357475623|ref|XP_003608097.1| hypothetical protein MTR_4g087590 [Medicago truncatula] gi|355509152|gb|AES90294.1| hypothetical protein MTR_4g087590 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356500114|ref|XP_003518879.1| PREDICTED: uncharacterized hydrolase yutF-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 393 | ||||||
| TAIR|locus:2142454 | 306 | AT5G10460 "AT5G10460" [Arabido | 0.496 | 0.637 | 0.753 | 8.7e-115 | |
| TIGR_CMR|SPO_3151 | 310 | SPO_3151 "HAD-superfamily subf | 0.249 | 0.316 | 0.330 | 4.4e-17 | |
| UNIPROTKB|F1MW60 | 296 | PDXP "Pyridoxal phosphate phos | 0.211 | 0.280 | 0.363 | 3.5e-07 | |
| UNIPROTKB|Q3ZBF9 | 296 | PDXP "Pyridoxal phosphate phos | 0.211 | 0.280 | 0.363 | 3.5e-07 | |
| UNIPROTKB|J9NUR4 | 296 | PDXP "Uncharacterized protein" | 0.203 | 0.270 | 0.364 | 9.1e-07 | |
| UNIPROTKB|Q96GD0 | 296 | PDXP "Pyridoxal phosphate phos | 0.213 | 0.283 | 0.359 | 1e-06 | |
| MGI|MGI:1919282 | 292 | Pdxp "pyridoxal (pyridoxine, v | 0.201 | 0.270 | 0.357 | 2.2e-06 | |
| RGD|1586212 | 309 | Pdxp "pyridoxal (pyridoxine, v | 0.201 | 0.255 | 0.357 | 4.4e-06 | |
| UNIPROTKB|Q3ZCH9 | 259 | HDHD2 "Haloacid dehalogenase-l | 0.216 | 0.328 | 0.292 | 1.3e-05 | |
| UNIPROTKB|I3LRP7 | 244 | I3LRP7 "Uncharacterized protei | 0.216 | 0.348 | 0.292 | 2.7e-05 |
| TAIR|locus:2142454 AT5G10460 "AT5G10460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 780 (279.6 bits), Expect = 8.7e-115, Sum P(2) = 8.7e-115
Identities = 147/195 (75%), Positives = 167/195 (85%)
Query: 14 LFQTLNGLRHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSR 73
L Q +NGL+ I ETR FKAWLLDQ+GVLHDGKKPYPGAISTL+ LAT GAK+V+ISNSSR
Sbjct: 7 LSQPMNGLKDIVETRNFKAWLLDQYGVLHDGKKPYPGAISTLKNLATAGAKIVIISNSSR 66
Query: 74 RASTTIDKLKSLGFDPSLFAGAITSGELTHQYLLRRDDAWFAALGRSCIHMTWSDRGAIS 133
RASTT++KLK LGFDPS F GAITSGELTHQ L RRDD WFAALGR CIH+TW+DRGAIS
Sbjct: 67 RASTTMEKLKGLGFDPSFFTGAITSGELTHQSLQRRDDPWFAALGRRCIHITWNDRGAIS 126
Query: 134 LEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANP 193
LEGL L VVENVEEADF+LAHGTE +GLPSG V P ++ +LEKILE A++ +PM+VANP
Sbjct: 127 LEGLDLNVVENVEEADFVLAHGTEALGLPSGSVSPRTIDELEKILEKSAARGLPMIVANP 186
Query: 194 DYVTVEARALRVMPG 208
DYVTVEA +MPG
Sbjct: 187 DYVTVEANVFHIMPG 201
|
|
| TIGR_CMR|SPO_3151 SPO_3151 "HAD-superfamily subfamily IIA hydrolase, TIGR01459" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MW60 PDXP "Pyridoxal phosphate phosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBF9 PDXP "Pyridoxal phosphate phosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NUR4 PDXP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96GD0 PDXP "Pyridoxal phosphate phosphatase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919282 Pdxp "pyridoxal (pyridoxine, vitamin B6) phosphatase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1586212 Pdxp "pyridoxal (pyridoxine, vitamin B6) phosphatase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZCH9 HDHD2 "Haloacid dehalogenase-like hydrolase domain-containing protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LRP7 I3LRP7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 393 | |||
| TIGR01459 | 242 | TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class | 2e-23 | |
| pfam13344 | 101 | pfam13344, Hydrolase_6, Haloacid dehalogenase-like | 3e-16 | |
| COG0647 | 269 | COG0647, NagD, Predicted sugar phosphatases of the | 3e-15 | |
| COG0647 | 269 | COG0647, NagD, Predicted sugar phosphatases of the | 3e-15 | |
| pfam13242 | 74 | pfam13242, Hydrolase_like, HAD-hyrolase-like | 1e-11 | |
| TIGR01459 | 242 | TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class | 4e-11 | |
| TIGR01460 | 236 | TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super | 6e-10 | |
| COG1011 | 229 | COG1011, COG1011, Predicted hydrolase (HAD superfa | 2e-07 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 2e-07 | |
| TIGR01460 | 236 | TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super | 8e-07 | |
| TIGR02253 | 221 | TIGR02253, CTE7, HAD superfamily (subfamily IA) hy | 1e-05 | |
| TIGR01452 | 279 | TIGR01452, PGP_euk, phosphoglycolate/pyridoxal pho | 4e-05 | |
| pfam13419 | 176 | pfam13419, HAD_2, Haloacid dehalogenase-like hydro | 6e-05 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 1e-04 | |
| TIGR02253 | 221 | TIGR02253, CTE7, HAD superfamily (subfamily IA) hy | 2e-04 | |
| PRK09449 | 224 | PRK09449, PRK09449, dUMP phosphatase; Provisional | 2e-04 | |
| COG0546 | 220 | COG0546, Gph, Predicted phosphatases [General func | 2e-04 | |
| TIGR02252 | 203 | TIGR02252, DREG-2, REG-2-like, HAD superfamily (su | 6e-04 | |
| TIGR01458 | 257 | TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfam | 0.002 | |
| TIGR01509 | 177 | TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup | 0.002 | |
| COG0637 | 221 | COG0637, COG0637, Predicted phosphatase/phosphohex | 0.003 | |
| PRK10444 | 248 | PRK10444, PRK10444, UMP phosphatase; Provisional | 0.004 | |
| PLN02645 | 311 | PLN02645, PLN02645, phosphoglycolate phosphatase | 0.004 |
| >gnl|CDD|130526 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
Score = 97.7 bits (243), Expect = 2e-23
Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 11/173 (6%)
Query: 29 RFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSRRASTTIDKLKSLGFD 88
+ +LLD +GV+ DG YPGA+ L + G + +SNS R + LKSLG +
Sbjct: 7 DYDVFLLDLWGVIIDGNHTYPGAVQNLNKIIAQGKPVYFVSNSPRNIFSLHKTLKSLGIN 66
Query: 89 PSLFAGAITSGELTHQYLLRRDDAWFAALGRSCI-HMTWSDRGAISLEGLGLKVVENVEE 147
L I+SGE+ Q +L + + I + + I+L EN
Sbjct: 67 ADLPEMIISSGEIAVQMIL--ESKKRFDIRNGIIYLLGHLENDIINLMQCYTTDDENKAN 124
Query: 148 ADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANPDYVTVEA 200
A I + +E L L + +++ ++KIP + ANPD +
Sbjct: 125 ASLITIYRSENEKLD--------LDEFDELFAPIVARKIPNICANPDRGINQH 169
|
This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all gram negative and primarily alpha proteobacteria. Only one sequence hase been annotated as other than "hypothetical." That one, from Brucella, is annotated as related to NagD, but only by sequence similarity and should be treated with some skepticism. (See comments for Class IIA subfamily model). Length = 242 |
| >gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like | Back alignment and domain information |
|---|
| >gnl|CDD|130526 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >gnl|CDD|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >gnl|CDD|233420 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >gnl|CDD|181865 PRK09449, PRK09449, dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|200170 TIGR02252, DREG-2, REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|162372 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182466 PRK10444, PRK10444, UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178251 PLN02645, PLN02645, phosphoglycolate phosphatase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 393 | |||
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 100.0 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 100.0 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 100.0 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 100.0 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 100.0 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 100.0 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 100.0 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 100.0 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 99.97 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 99.97 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 99.97 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 99.85 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.83 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.81 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.79 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.78 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 99.78 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.78 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.77 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.77 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.77 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.76 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.76 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.76 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.75 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.75 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.75 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.74 | |
| KOG1618 | 389 | consensus Predicted phosphatase [General function | 99.74 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.74 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.73 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.72 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.72 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.72 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.71 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.71 | |
| PLN02940 | 382 | riboflavin kinase | 99.7 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.68 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.68 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.66 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.66 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 99.65 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.65 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.65 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.62 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.62 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.61 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 99.6 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 99.6 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.6 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.6 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.6 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.59 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.58 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.57 | |
| PLN02887 | 580 | hydrolase family protein | 99.57 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.57 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.56 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.55 | |
| PLN02811 | 220 | hydrolase | 99.53 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.53 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.52 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.52 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.5 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.5 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 99.49 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.48 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.48 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.48 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.45 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.45 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.44 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.43 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.42 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.42 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.4 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.4 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.4 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.39 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 99.39 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.39 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.38 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 99.38 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.38 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.37 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.37 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.36 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.35 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 99.34 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.33 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 99.31 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.31 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.29 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.24 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.21 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.21 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 99.19 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.19 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 99.19 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.14 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.14 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.12 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.08 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 99.07 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 99.05 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.03 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.03 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.02 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.0 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 98.99 | |
| PLN02423 | 245 | phosphomannomutase | 98.97 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.94 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 98.91 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 98.84 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 98.83 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 98.78 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 98.77 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.76 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.61 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 98.59 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.59 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.54 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 98.54 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.51 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 98.5 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.44 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.4 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.39 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.38 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.36 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.33 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.31 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.28 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 98.28 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.27 | |
| PLN02580 | 384 | trehalose-phosphatase | 98.25 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.25 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 98.24 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 98.21 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.19 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 98.12 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 98.11 | |
| PLN03017 | 366 | trehalose-phosphatase | 98.06 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.04 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 98.02 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 98.02 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 98.02 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 98.01 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 97.99 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.99 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 97.98 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.98 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 97.97 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.93 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 97.91 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.9 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.88 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 97.85 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 97.83 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 97.82 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 97.79 | |
| PLN02151 | 354 | trehalose-phosphatase | 97.75 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 97.75 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 97.74 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.74 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 97.73 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 97.73 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 97.71 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.7 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 97.69 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 97.68 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 97.66 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 97.66 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 97.63 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 97.63 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 97.59 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 97.59 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 97.58 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 97.57 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 97.56 | |
| PLN02940 | 382 | riboflavin kinase | 97.54 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 97.53 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.53 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.41 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 97.4 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 97.39 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 97.38 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 97.37 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 97.36 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 97.33 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 97.31 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 97.16 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.15 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 97.13 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.08 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 97.04 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 96.92 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 96.89 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 96.77 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 96.74 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 96.66 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 96.55 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 96.48 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 96.47 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 96.43 | |
| PLN02954 | 224 | phosphoserine phosphatase | 96.41 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 96.34 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 96.32 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 96.15 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 96.14 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 96.02 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 96.01 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 95.9 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 95.78 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 95.65 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 95.56 | |
| PF05761 | 448 | 5_nucleotid: 5' nucleotidase family; InterPro: IPR | 95.49 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 95.42 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 95.4 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 95.35 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 95.23 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 95.1 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 94.92 | |
| PF06189 | 264 | 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 | 94.7 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 94.05 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 93.21 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 93.2 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 93.08 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 92.78 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 92.69 | |
| PRK05301 | 378 | pyrroloquinoline quinone biosynthesis protein PqqE | 92.63 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 92.26 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 91.99 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 91.99 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 91.93 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 91.85 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 91.82 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 91.56 | |
| TIGR02109 | 358 | PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. | 91.35 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 91.26 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 91.25 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 91.07 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 91.0 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 90.98 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 90.71 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 90.6 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 90.33 | |
| PLN02811 | 220 | hydrolase | 89.97 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 89.92 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 89.8 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 89.75 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 89.64 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 89.46 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 89.37 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 89.12 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 88.99 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 88.93 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 88.83 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 88.82 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 88.8 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 88.38 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 88.37 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 88.15 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 88.01 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 87.71 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 87.71 | |
| COG4850 | 373 | Uncharacterized conserved protein [Function unknow | 87.62 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 87.61 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 87.05 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 86.97 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 86.92 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 86.75 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 86.69 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 86.34 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 86.33 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 86.21 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 86.14 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 86.03 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 85.96 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 85.72 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 85.09 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 85.08 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 85.05 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 84.75 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 84.09 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 83.8 | |
| PLN02887 | 580 | hydrolase family protein | 82.89 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 82.69 | |
| PRK08508 | 279 | biotin synthase; Provisional | 82.55 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 82.51 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 82.35 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 81.35 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 81.31 | |
| PLN02423 | 245 | phosphomannomutase | 81.01 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 81.01 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 80.64 | |
| PF04312 | 138 | DUF460: Protein of unknown function (DUF460); Inte | 80.43 |
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-43 Score=327.42 Aligned_cols=232 Identities=30% Similarity=0.557 Sum_probs=201.2
Q ss_pred cCCcEEEEeccccccCCCcCCccHHHHHHHHHHCCCeEEEEcCCCCCch-HHHHHHHh-CCCCCcccceEEeCchhHHHH
Q 016204 28 RRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSRRAS-TTIDKLKS-LGFDPSLFAGAITSGELTHQY 105 (393)
Q Consensus 28 ~~~k~i~~DlDGtL~~g~~~ipga~eal~~L~~~G~~v~~~TN~~~~~~-~~~~~l~~-lG~~~~~~~~iits~~~~~~~ 105 (393)
++|++|+||+|||||+|+++||||.|+|+.|+++|++++|+|||+++++ .+.++|+. +|.+... ++|+||+.++++|
T Consensus 6 ~~y~~~l~DlDGvl~~G~~~ipga~e~l~~L~~~g~~~iflTNn~~~s~~~~~~~L~~~~~~~~~~-~~i~TS~~at~~~ 84 (269)
T COG0647 6 DKYDGFLFDLDGVLYRGNEAIPGAAEALKRLKAAGKPVIFLTNNSTRSREVVAARLSSLGGVDVTP-DDIVTSGDATADY 84 (269)
T ss_pred hhcCEEEEcCcCceEeCCccCchHHHHHHHHHHcCCeEEEEeCCCCCCHHHHHHHHHhhcCCCCCH-HHeecHHHHHHHH
Confidence 3899999999999999999999999999999999999999999998885 59999999 5666776 9999999999999
Q ss_pred HHcccchhhhhcCCeEEEEccCCcccc-ccccCCceeeCCccC--cCEEEecCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q 016204 106 LLRRDDAWFAALGRSCIHMTWSDRGAI-SLEGLGLKVVENVEE--ADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICA 182 (393)
Q Consensus 106 l~~~~~~~~~~~g~~~~~~~~~~~~~~-~~~~~g~~~~~~~~~--~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 182 (393)
+.++.. +++||+++ +.+.. +++++|+..+.+.+. +++|++ +.|+.++|+++.+++. +.
T Consensus 85 l~~~~~------~~kv~viG--~~~l~~~l~~~G~~~~~~~~~~~~d~Vv~----------g~d~~~~~e~l~~a~~-~i 145 (269)
T COG0647 85 LAKQKP------GKKVYVIG--EEGLKEELEGAGFELVDEEEPARVDAVVV----------GLDRTLTYEKLAEALL-AI 145 (269)
T ss_pred HHhhCC------CCEEEEEC--CcchHHHHHhCCcEEeccCCCCcccEEEE----------ecCCCCCHHHHHHHHH-HH
Confidence 998653 57888886 44444 899999998875444 578888 8899999999999986 55
Q ss_pred hCCCCEEeecCceeeeeCCceeecCCCcccccccccccchhhhhhhHHhcccEEEEecCCccccCHHHHHHHHHHHhcCC
Q 016204 183 SKKIPMVVANPDYVTVEARALRVMPGKDILVNEIFRPHNVAQEKYIISRMTDLILFDLKNFNLVSVDIIYSSHKLLSRNF 262 (393)
Q Consensus 183 ~~~~~~~~~n~d~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~M~k~iiFD~DGTL~ds~~~~~~~~~l~~~~~ 262 (393)
..|++|+++|||..+|.+++ ..||.|+
T Consensus 146 ~~g~~fI~tNpD~~~p~~~g--~~pgaGa--------------------------------------------------- 172 (269)
T COG0647 146 AAGAPFIATNPDLTVPTERG--LRPGAGA--------------------------------------------------- 172 (269)
T ss_pred HcCCcEEEeCCCccccCCCC--CccCcHH---------------------------------------------------
Confidence 66799999999999999887 5777554
Q ss_pred CCChHHHHHHHhCCCchHHHHHHHhhhhccccc-cccccccccCCCcHHHHHHHHHHhCCCCCcEEEEecCchhhHHHHH
Q 016204 263 SISKNFTFRNFIGLPFVYECVLIILGTLASKFE-KLGGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSLHHDIKGAN 341 (393)
Q Consensus 263 ~~~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~-~~~~~~~~~gKP~p~~~~~~~~~lgi~~~~~v~VGDsl~~Di~~a~ 341 (393)
+...++ .++.++...|||++.+|+.+++.++.++++++||||++.+||.+|+
T Consensus 173 ---------------------------i~~~~~~~tg~~~~~~GKP~~~i~~~al~~~~~~~~~~~mVGD~~~TDI~~a~ 225 (269)
T COG0647 173 ---------------------------IAALLEQATGREPTVIGKPSPAIYEAALEKLGLDRSEVLMVGDRLDTDILGAK 225 (269)
T ss_pred ---------------------------HHHHHHHhhCCcccccCCCCHHHHHHHHHHhCCCcccEEEEcCCchhhHHHHH
Confidence 233333 3456667999999999999999999999999999999999999999
Q ss_pred HcCCeEEEEcCCCCCccc
Q 016204 342 AAGIQSVFIIGGIHATEL 359 (393)
Q Consensus 342 ~aG~~~i~v~~G~~~~~~ 359 (393)
++|+.+++|.||.++.++
T Consensus 226 ~~G~~t~LV~TGv~~~~~ 243 (269)
T COG0647 226 AAGLDTLLVLTGVSSAED 243 (269)
T ss_pred HcCCCEEEEccCCCChhh
Confidence 999999999999997775
|
|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >KOG1618 consensus Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >COG4850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08508 biotin synthase; Provisional | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 393 | ||||
| 2cfs_A | 298 | Crystal Structure Of Human Pyridoxal 5'-Phosphate P | 3e-05 | ||
| 2cfr_A | 298 | Crystal Structure Of Human Pyridoxal 5'-Phosphate P | 3e-05 | ||
| 2oyc_A | 306 | Crystal Structure Of Human Pyridoxal Phosphate Phos | 3e-05 | ||
| 2hx1_A | 284 | Crystal Structure Of Possible Sugar Phosphatase, Ha | 1e-04 | ||
| 3qgm_A | 268 | P-Nitrophenyl Phosphatase From Archaeoglobus Fulgid | 1e-04 | ||
| 3ib6_A | 189 | Crystal Structure Of An Uncharacterized Protein Fro | 3e-04 | ||
| 2hoq_A | 241 | Crystal Structure Of The Probable Haloacid Dehaloge | 6e-04 |
| >pdb|2CFS|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 | Back alignment and structure |
|
| >pdb|2CFR|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 | Back alignment and structure |
| >pdb|2OYC|A Chain A, Crystal Structure Of Human Pyridoxal Phosphate Phosphatase Length = 306 | Back alignment and structure |
| >pdb|2HX1|A Chain A, Crystal Structure Of Possible Sugar Phosphatase, Had Superfamily (Zp_00311070.1) From Cytophaga Hutchinsonii Atcc 33406 At 2.10 A Resolution Length = 284 | Back alignment and structure |
| >pdb|3QGM|A Chain A, P-Nitrophenyl Phosphatase From Archaeoglobus Fulgidus Length = 268 | Back alignment and structure |
| >pdb|3IB6|A Chain A, Crystal Structure Of An Uncharacterized Protein From Listeria Monocytogenes Serotype 4b Length = 189 | Back alignment and structure |
| >pdb|2HOQ|A Chain A, Crystal Structure Of The Probable Haloacid Dehalogenase (Ph1655) From Pyrococcus Horikoshii Ot3 Length = 241 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 393 | |||
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 1e-12 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 3e-09 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 2e-12 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 7e-11 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 2e-05 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 9e-11 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 2e-05 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 1e-10 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 2e-10 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 6e-06 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 2e-10 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 2e-10 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 8e-05 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 2e-10 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 3e-10 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 8e-09 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 1e-09 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 1e-09 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 7e-09 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 2e-09 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 4e-09 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 5e-08 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 5e-09 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 2e-08 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 6e-09 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 4e-08 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 7e-09 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 6e-08 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 7e-09 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 6e-08 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 1e-08 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 1e-05 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 2e-08 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 2e-08 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 2e-06 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 3e-08 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 5e-07 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 6e-08 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 2e-07 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 2e-05 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 5e-06 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 2e-05 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 2e-05 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 8e-04 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 2e-05 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 2e-05 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 2e-05 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 5e-05 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 7e-05 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 4e-04 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 1e-04 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 7e-04 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 1e-04 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 4e-04 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 2e-04 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 2e-04 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 2e-04 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 2e-04 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 3e-04 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 3e-04 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 5e-04 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 6e-04 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 5e-04 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 7e-04 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 8e-04 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 8e-04 |
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 | Back alignment and structure |
|---|
Score = 66.5 bits (163), Expect = 1e-12
Identities = 42/182 (23%), Positives = 69/182 (37%), Gaps = 14/182 (7%)
Query: 17 TLNGLRHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISN-SSRRA 75
+ + + ++K D FGVL PG +T + L G +++N +SR
Sbjct: 3 QIESFKSLLP--KYKCIFFDAFGVLKTYNGLLPGIENTFDYLKAQGQDYYIVTNDASRSP 60
Query: 76 STTIDKLKSLGFDPSLFAGAITSGELTHQYL-LRRDDAWFAALGRSCIHMTWSDRGAISL 134
D LG I+SG +T +Y+ L+ D A LG + G I +
Sbjct: 61 EQLADSYHKLGLFSITADKIISSGMITKEYIDLKVDGGIVAYLGTANSANYLVSDG-IKM 119
Query: 135 EGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANPD 194
+ N+ E + ++ EG DL K + + + IP +VAN D
Sbjct: 120 LPVSAIDDSNIGEVNALVLLDDEGFNWF---------HDLNKTVNLLRKRTIPAIVANTD 170
Query: 195 YV 196
Sbjct: 171 NT 172
|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Length = 352 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Length = 240 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Length = 232 | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Length = 253 | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Length = 201 | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 393 | |||
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 100.0 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 100.0 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 100.0 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.97 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 99.97 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.97 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.97 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.96 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.96 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.95 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.93 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.92 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.85 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.84 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.84 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.83 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.83 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.82 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.81 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.8 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.8 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.79 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.78 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.78 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.78 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.76 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.76 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.76 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.75 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.75 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.75 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.75 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.75 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.75 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.74 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.74 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.74 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.74 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.73 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.73 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.73 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.72 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.72 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.72 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.72 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.71 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.71 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.71 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.7 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.7 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.7 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.7 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.7 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.7 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 99.7 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.69 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.69 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.69 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.68 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.68 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.68 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.68 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.68 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.67 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.67 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.66 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.66 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.66 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.65 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 99.65 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.65 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.65 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.65 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.64 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.64 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.64 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.64 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.63 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.62 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.62 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.62 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.61 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.61 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.59 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.58 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.56 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.56 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.56 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.55 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.54 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.54 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.53 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.52 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.52 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.52 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.49 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.49 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.48 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.48 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.48 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.48 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.48 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.48 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.47 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.47 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.46 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.46 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.45 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.43 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.43 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.42 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.42 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.41 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.39 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.39 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.35 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.34 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.34 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.32 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.29 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 99.26 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.25 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.24 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.23 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.19 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.18 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 99.17 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.16 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 99.16 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.13 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 99.09 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.05 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.01 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 99.0 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 98.96 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.88 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 98.81 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 98.74 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 98.7 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.65 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 98.05 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 98.55 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.34 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 98.26 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 98.23 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 98.22 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 98.21 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.16 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.15 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.14 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.13 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.1 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 98.09 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 98.08 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.02 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 98.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 98.0 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 97.98 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 97.97 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 97.96 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 97.95 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 97.94 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.94 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 97.91 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 97.9 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 97.86 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 97.85 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 97.85 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.85 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.85 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 97.84 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.81 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.81 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 97.79 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 97.79 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.79 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 97.76 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 97.75 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 97.71 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 97.7 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 97.65 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.64 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.59 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 97.59 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 97.56 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 97.54 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 97.54 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 97.48 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 97.48 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 97.47 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 97.44 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 97.42 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.37 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 97.34 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 97.34 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.3 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.29 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 97.28 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 97.25 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.24 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 97.18 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 97.16 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 97.12 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 97.06 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 96.92 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 96.75 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 96.71 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 96.61 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 96.58 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 96.55 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 96.44 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 96.25 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 96.13 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 96.11 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 96.04 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 96.02 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 95.95 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 95.9 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 95.9 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 95.89 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 95.77 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 95.75 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 95.72 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 95.71 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 95.66 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 95.62 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 95.5 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 95.43 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 95.34 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 95.32 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 95.24 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 95.18 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 95.07 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.96 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 94.95 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 94.9 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 94.89 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 94.83 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 94.82 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 94.65 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 94.59 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 94.53 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 94.44 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 94.43 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 94.35 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 94.29 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 94.25 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 94.09 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 93.98 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 93.95 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 93.9 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 93.9 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 93.88 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 93.71 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 93.67 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 93.63 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 93.5 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 93.45 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 93.35 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 93.34 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 93.03 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 92.98 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 92.71 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 92.6 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 92.46 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 92.42 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 91.88 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 91.78 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 91.57 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 91.44 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 91.36 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 90.66 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 91.32 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 91.16 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 90.94 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 90.63 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 90.2 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 90.09 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 89.87 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 89.87 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 89.77 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 89.57 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 89.56 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 89.03 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 88.74 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 88.61 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 88.04 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 87.5 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 87.34 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 87.01 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 86.72 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 86.48 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 86.42 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 85.41 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 82.6 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 82.52 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 81.38 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 80.83 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 80.75 |
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-33 Score=273.74 Aligned_cols=253 Identities=22% Similarity=0.223 Sum_probs=197.4
Q ss_pred CCcEEEEeccccccCCCcCCccHHHHHHHHHHCCCeEEEEcCCCCCc-hHHHHHHH-hCCCCCcccceEEeCchhHHHHH
Q 016204 29 RFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSRRA-STTIDKLK-SLGFDPSLFAGAITSGELTHQYL 106 (393)
Q Consensus 29 ~~k~i~~DlDGtL~~g~~~ipga~eal~~L~~~G~~v~~~TN~~~~~-~~~~~~l~-~lG~~~~~~~~iits~~~~~~~l 106 (393)
+.++|+||+|||||+|.+++|||.++|++|+++|++++|+|||+.++ +++.++|. .+|++... ++|+||+.+++.++
T Consensus 12 ~~~~~l~D~DGvl~~g~~~~p~a~~~l~~l~~~g~~~~~vTNn~~~~~~~~~~~l~~~lgi~~~~-~~i~ts~~~~~~~~ 90 (352)
T 3kc2_A 12 KKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYILLTNGGGFSERARTEFISSKLDVDVSP-LQIIQSHTPYKSLV 90 (352)
T ss_dssp CCEEEEECCBTTTEETTEECTTHHHHHHHHHHTTCCEEEECSCCSSCHHHHHHHHHHHHTSCCCG-GGEECTTGGGGGGT
T ss_pred cCCEEEEECCCeeEcCCeeCcCHHHHHHHHHHCCCEEEEEeCCCCCCchHHHHHHHHhcCCCCCh-hhEeehHHHHHHHH
Confidence 67999999999999999999999999999999999999999998766 68899998 69999988 99999999998877
Q ss_pred HcccchhhhhcCCeEEEEccCCcccc-ccccCCceeeCC----------------------------c-----cCcCEEE
Q 016204 107 LRRDDAWFAALGRSCIHMTWSDRGAI-SLEGLGLKVVEN----------------------------V-----EEADFIL 152 (393)
Q Consensus 107 ~~~~~~~~~~~g~~~~~~~~~~~~~~-~~~~~g~~~~~~----------------------------~-----~~~~~v~ 152 (393)
. . +++++++|. .+.. +++++|++.+.. . ...++|+
T Consensus 91 ~--~-------~~~v~viG~--~~l~~~l~~~G~~~v~~~~d~~~~~~~~~p~~~l~~ee~~~~~d~ipD~~~~~v~AVv 159 (352)
T 3kc2_A 91 N--K-------YSRILAVGT--PSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDLTTKKFDAVL 159 (352)
T ss_dssp T--T-------CSEEEEESS--TTHHHHHHHHTCSEEEEHHHHHHHCGGGCTTCCCCHHHHHHHCCCCTTTTTSCCCEEE
T ss_pred h--c-------CCEEEEECC--HHHHHHHHhCCCeEecchhHhhhhcccccccccCCHHHHhhhccCcccccccCCCEEE
Confidence 4 2 467777753 3443 788899987621 0 1225666
Q ss_pred ecCCCCCCCCCCCCCCCCHHHHHHHHHHHHh---------------CCCCEEeecCceeeeeCCceeecCCCcccccccc
Q 016204 153 AHGTEGMGLPSGDVRPMSLQDLEKILEICAS---------------KKIPMVVANPDYVTVEARALRVMPGKDILVNEIF 217 (393)
Q Consensus 153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------------~~~~~~~~n~d~~~~~~~~~~~~~g~~~~~~~~~ 217 (393)
+ +.|....+.+++.++.++.. .+++++++|+|..+|.+... ..+|.|+++.
T Consensus 160 v----------~~Dp~d~~~~lq~~~d~L~s~~G~~~~~~~~~~~~~~~~~i~tN~D~~~~~~~~~-~r~g~Ga~~~--- 225 (352)
T 3kc2_A 160 V----------FNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPIYFSNQDLLWANPYKL-NRFGQGAFRL--- 225 (352)
T ss_dssp E----------CSCCSCHHHHHHHHHHHHTSBTTBTTCCCSCCCSSCSSCEEESCCCSEECCSSSS-CEECHHHHHH---
T ss_pred E----------eCCCcchHHHHHHHHHHHHhcCCCcCcccccccCCCCCeEEEECCCcccccCCCC-cccCchHHHH---
Confidence 6 56677778899999887753 57899999999999986542 2346443221
Q ss_pred cccchhhhhhhHHhcccEEEEecCCccccCHHHHHHHHHHHhcCCCCChHHHHHHHhCCCchHHHHHHHhhhhccccccc
Q 016204 218 RPHNVAQEKYIISRMTDLILFDLKNFNLVSVDIIYSSHKLLSRNFSISKNFTFRNFIGLPFVYECVLIILGTLASKFEKL 297 (393)
Q Consensus 218 ~~~~~~~~~~~~~~M~k~iiFD~DGTL~ds~~~~~~~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~ 297 (393)
.+...+...
T Consensus 226 -----------------------------------------------------------------------al~~~y~~~ 234 (352)
T 3kc2_A 226 -----------------------------------------------------------------------LVRRLYLEL 234 (352)
T ss_dssp -----------------------------------------------------------------------HHHHHHHHH
T ss_pred -----------------------------------------------------------------------HHHHHHHHh
Confidence 222333322
Q ss_pred -ccc--ccccCCCcHHHHHHHHHHhC----------------------C-----CCCcEEEEecCchhhHHHHHHcCCeE
Q 016204 298 -GGE--VRWMGKPDKIIYKSAMAMVG----------------------V-----DACDSIAVGDSLHHDIKGANAAGIQS 347 (393)
Q Consensus 298 -~~~--~~~~gKP~p~~~~~~~~~lg----------------------i-----~~~~~v~VGDsl~~Di~~a~~aG~~~ 347 (393)
+.+ ....|||++.+|+.+++.++ + ++++++||||++.+||.+|+++|+.+
T Consensus 235 tg~~~~~~~~GKP~~~~y~~A~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGD~~~~Di~~A~~aG~~t 314 (352)
T 3kc2_A 235 NGEPLQDYTLGKPTKLTYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNPASDIIGAQNYGWNS 314 (352)
T ss_dssp HSSCCCCEECSTTCHHHHHHHHHHHHHHHHHHHC--------------CCTTTTTSSEEEEEESCTTTHHHHHHHHTCEE
T ss_pred cCCCCCceEecCCCHHHHHHHHHHHHHHHHhhhcccccccccccccccccccCCCcceEEEEecCcHHHHHHHHHcCCEE
Confidence 333 46899999999999877652 2 67999999999657999999999999
Q ss_pred EEEcCCCCCccc---CCCCccccCChhHHHHHHH
Q 016204 348 VFIIGGIHATEL---GLDSYGEVADLSSVQTLVS 378 (393)
Q Consensus 348 i~v~~G~~~~~~---~~~~~~~i~~~~~l~~~l~ 378 (393)
|+|.+|.+..+. ...++++++++.++.+++.
T Consensus 315 i~V~~G~~~~~~~~~~~~pd~vi~~l~el~~~il 348 (352)
T 3kc2_A 315 CLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTL 348 (352)
T ss_dssp EECSSSSCCTTCCCTTCCCSEECSSHHHHHHHHH
T ss_pred EEEccCCCCcccccccCCCCEEECCHHHHHHHHH
Confidence 999999876543 2578889999999887654
|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 393 | ||||
| d1yv9a1 | 253 | c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En | 9e-12 | |
| d1yv9a1 | 253 | c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En | 1e-08 | |
| d1wvia_ | 253 | c.108.1.14 (A:) Putative phosphatase SMU.1415c {St | 3e-11 | |
| d1wvia_ | 253 | c.108.1.14 (A:) Putative phosphatase SMU.1415c {St | 2e-07 | |
| d1vjra_ | 261 | c.108.1.14 (A:) Hypothetical protein TM1742 {Therm | 3e-11 | |
| d1vjra_ | 261 | c.108.1.14 (A:) Hypothetical protein TM1742 {Therm | 1e-07 | |
| d2c4na1 | 250 | c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId | 6e-09 | |
| d2c4na1 | 250 | c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId | 1e-07 | |
| d1qq5a_ | 245 | c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan | 4e-07 | |
| d2fi1a1 | 187 | c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str | 2e-05 | |
| d1zs9a1 | 253 | c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien | 2e-05 | |
| d2g80a1 | 225 | c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast | 2e-05 | |
| d1cr6a1 | 222 | c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal | 2e-05 | |
| d1x42a1 | 230 | c.108.1.1 (A:1-230) Hypothetical protein PH0459 {A | 4e-05 | |
| d2o2xa1 | 209 | c.108.1.19 (A:8-216) Hypothetical protein Mll2559 | 9e-05 | |
| d2go7a1 | 204 | c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S | 2e-04 | |
| d1te2a_ | 218 | c.108.1.6 (A:) Phosphatase YniC {Escherichia coli | 2e-04 | |
| d2fpwa1 | 161 | c.108.1.19 (A:3-163) Histidine biosynthesis bifunc | 3e-04 | |
| d2gfha1 | 247 | c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas | 7e-04 | |
| d2b0ca1 | 197 | c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc | 8e-04 | |
| d1zd3a1 | 225 | c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal | 0.001 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 0.001 | |
| d1o08a_ | 221 | c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu | 0.002 | |
| d1u7pa_ | 164 | c.108.1.17 (A:) Magnesium-dependent phosphatase-1, | 0.003 |
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NagD-like domain: Putative hydrolase EF1188 species: Enterococcus faecalis [TaxId: 1351]
Score = 62.4 bits (150), Expect = 9e-12
Identities = 15/98 (15%), Positives = 37/98 (37%), Gaps = 1/98 (1%)
Query: 30 FKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISN-SSRRASTTIDKLKSLGFD 88
++ +L+D G ++ GK+P P +E L + ++N +++ T +L +
Sbjct: 2 YQGYLIDLDGTIYLGKEPIPAGKRFVERLQEKDLPFLFVTNNTTKSPETVAQRLANEFDI 61
Query: 89 PSLFAGAITSGELTHQYLLRRDDAWFAALGRSCIHMTW 126
+ T+ T Y+ + + +
Sbjct: 62 HVPASLVYTATLATIDYMKEANRGKKVFVIGEAGLIDL 99
|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 393 | |||
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 100.0 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 100.0 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 100.0 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.84 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.83 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.83 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.8 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 99.8 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.79 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.79 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.75 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.75 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.74 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.74 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.73 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.73 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.72 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.72 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.67 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.66 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.65 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.63 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.63 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.57 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.54 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.54 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 99.52 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 99.52 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.48 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.47 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.43 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.4 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 99.38 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.35 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.34 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.32 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.23 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.18 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.18 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.16 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.05 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 98.98 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 98.9 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.78 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 98.74 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.65 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.64 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 98.6 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.54 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.32 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 98.22 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.19 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.17 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 98.14 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 98.14 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 97.98 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 97.93 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 97.93 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 97.9 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 97.81 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 97.69 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 97.68 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 97.68 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 97.62 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 97.16 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 97.01 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 96.79 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 96.66 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 96.66 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 96.56 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 96.33 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 96.12 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 95.81 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 95.24 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 95.18 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 95.07 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 94.87 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 94.5 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 94.04 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 93.51 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 93.03 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 92.85 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 92.84 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 92.61 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 92.58 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 92.16 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 91.93 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 91.77 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 91.62 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 91.35 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 91.27 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 90.99 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 90.11 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 89.08 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 87.76 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 87.14 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 86.64 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 85.49 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 84.02 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 82.84 | |
| d2bdea1 | 458 | Cytosolic IMP-GMP specific 5'-nucleotidase {Legion | 81.39 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 81.2 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 80.21 |
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NagD-like domain: Putative phosphatase SMU.1415c species: Streptococcus mutans [TaxId: 1309]
Probab=100.00 E-value=3.2e-34 Score=264.49 Aligned_cols=246 Identities=21% Similarity=0.344 Sum_probs=187.6
Q ss_pred CCcEEEEeccccccCCCcCCccHHHHHHHHHHCCCeEEEEcCCCCCc-hHHHHHHH-hCCCCCcccceEEeCchhHHHHH
Q 016204 29 RFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSRRA-STTIDKLK-SLGFDPSLFAGAITSGELTHQYL 106 (393)
Q Consensus 29 ~~k~i~~DlDGtL~~g~~~ipga~eal~~L~~~G~~v~~~TN~~~~~-~~~~~~l~-~lG~~~~~~~~iits~~~~~~~l 106 (393)
+||+|+||+|||||++..++|+|.++|+.|+++|++++|+|||++++ ..+.++|. .+|++... +.++++..++..++
T Consensus 1 tyk~vlFDlDGTL~~~~~~i~~a~e~l~~l~~~g~~~~~~TN~s~~~~~~~~~~l~~~~~~~~~~-~~i~~~~~~~~~~l 79 (253)
T d1wvia_ 1 TYKGYLIDLDGTIYKGKDRIPAGEDFVKRLQERQLPYILVTNNTTRTPEMVQEMLATSFNIKTPL-ETIYTATLATIDYM 79 (253)
T ss_dssp CCCEEEEECBTTTEETTEECHHHHHHHHHHHHHTCCEEEEECCCSSCHHHHHHHHHHHHSCCCCG-GGEEEHHHHHHHHH
T ss_pred CcCEEEEcCcCceEECCCcCccHHHHHHHHHHCCCCEEEEeCCCCCCHHHHHHHHHhhcCccccc-cccccHHHHHHHHH
Confidence 48999999999999999999999999999999999999999998766 57777775 36788777 89999999999999
Q ss_pred HcccchhhhhcCCeEEEEccCCcccc-ccccCCceeeCCccCcCEEEecCCCCCCCCCCCCCCCCHHHHHHHHHHHHhCC
Q 016204 107 LRRDDAWFAALGRSCIHMTWSDRGAI-SLEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKK 185 (393)
Q Consensus 107 ~~~~~~~~~~~g~~~~~~~~~~~~~~-~~~~~g~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 185 (393)
..... +..++.++ ..+.. .+.+.+..... +.+...+. +.+..+++.+...+. ...+.+
T Consensus 80 ~~~~~------~~~~~~~~--~~~l~~~~~~~~~~~~~--~~~~~~~~----------~~~~~~~~~~~~~~~-~~~~~~ 138 (253)
T d1wvia_ 80 NDMKR------GKTAYVIG--ETGLKKAVAEAGYREDS--ENPAYVVV----------GLDTNLTYEKLTLAT-LAIQKG 138 (253)
T ss_dssp HHHCC------CSEEEEES--CHHHHHHHHHTTCEECS--SSCSEEEE----------CCCTTCBHHHHHHHH-HHHHTT
T ss_pred HHhcc------Cceeeecc--chHHHHHHHHcCCcccc--cccceEEE----------ecCCCcCHHHHHHHh-hhhhhc
Confidence 86542 34555543 22222 45555654432 34445555 445677777766654 356678
Q ss_pred CCEEeecCceeeeeCCceeecCCCcccccccccccchhhhhhhHHhcccEEEEecCCccccCHHHHHHHHHHHhcCCCCC
Q 016204 186 IPMVVANPDYVTVEARALRVMPGKDILVNEIFRPHNVAQEKYIISRMTDLILFDLKNFNLVSVDIIYSSHKLLSRNFSIS 265 (393)
Q Consensus 186 ~~~~~~n~d~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~M~k~iiFD~DGTL~ds~~~~~~~~~l~~~~~~~~ 265 (393)
.+++++|++..++...... .+.+.
T Consensus 139 ~~~i~tn~~~~~~~~~~~~--~~~~~------------------------------------------------------ 162 (253)
T d1wvia_ 139 AVFIGTNPDLNIPTERGLL--PGAGA------------------------------------------------------ 162 (253)
T ss_dssp CEEEESCCCSEEEETTEEE--ECHHH------------------------------------------------------
T ss_pred cccccCCCCceeEcCCccc--ccCCc------------------------------------------------------
Confidence 8999999999998766432 22110
Q ss_pred hHHHHHHHhCCCchHHHHHHHhhhhccccccccccccccCCCcHHHHHHHHHHhCCCCCcEEEEecCchhhHHHHHHcCC
Q 016204 266 KNFTFRNFIGLPFVYECVLIILGTLASKFEKLGGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSLHHDIKGANAAGI 345 (393)
Q Consensus 266 ~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~gKP~p~~~~~~~~~lgi~~~~~v~VGDsl~~Di~~a~~aG~ 345 (393)
.........+.++...|||+|.+|+.+++++|++|++|+||||++.+||++|+++||
T Consensus 163 -----------------------~~~~~~~~~~~~~~~~gKP~p~~~~~al~~l~i~~~~~~mIGDs~~~DI~gA~~aG~ 219 (253)
T d1wvia_ 163 -----------------------ILFLLEKATRVKPIIIGKPEAVIMNKALDRLGVKRHEAIMVGDNYLTDITAGIKNDI 219 (253)
T ss_dssp -----------------------HHHHHHHHHCCCCEECSTTSHHHHHHHHHHHTSCGGGEEEEESCTTTTHHHHHHTTC
T ss_pred -----------------------chhcccccccceeEEeccCCcccceehhhhccccccceEEEcCChHHHHHHHHHCCC
Confidence 111112224567778899999999999999999999999999997679999999999
Q ss_pred eEEEEcCCCCCcccCCCCccccCChhHHHHHHHhcCCCCcEEecCcc
Q 016204 346 QSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVLPSFS 392 (393)
Q Consensus 346 ~~i~v~~G~~~~~~~~~~~~~i~~~~~l~~~l~~~~~~p~~~~~~l~ 392 (393)
++|+|.+|.++.++ +...+..|||+++||+
T Consensus 220 ~si~V~~G~~~~~~-----------------~~~~~~~PD~vi~sl~ 249 (253)
T d1wvia_ 220 ATLLVTTGFTKPEE-----------------VPALPIQPDFVLSSLA 249 (253)
T ss_dssp EEEEESSSSSCTTT-----------------GGGCSSCCSEEESCGG
T ss_pred CEEEECCCCCCHHH-----------------HhhcCCCCCEEECCHH
Confidence 99999999887765 3456778999999886
|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|