Citrus Sinensis ID: 016234
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 393 | 2.2.26 [Sep-21-2011] | |||||||
| F4J117 | 591 | Phosphoglucan phosphatase | yes | no | 0.997 | 0.663 | 0.770 | 0.0 | |
| Q9FEB5 | 379 | Phosphoglucan phosphatase | no | no | 0.674 | 0.699 | 0.321 | 1e-30 | |
| Q9SRK5 | 282 | Phosphoglucan phosphatase | no | no | 0.488 | 0.680 | 0.341 | 2e-24 | |
| Q91XQ2 | 327 | Laforin (Fragment) OS=Rat | yes | no | 0.473 | 0.568 | 0.267 | 4e-10 | |
| Q9WUA5 | 330 | Laforin OS=Mus musculus G | yes | no | 0.445 | 0.530 | 0.259 | 1e-09 | |
| O95278 | 331 | Laforin OS=Homo sapiens G | yes | no | 0.445 | 0.528 | 0.263 | 3e-09 | |
| Q1M199 | 331 | Laforin OS=Canis familiar | yes | no | 0.473 | 0.561 | 0.258 | 5e-09 | |
| Q9SCY5 | 289 | SNF1-related protein kina | no | no | 0.279 | 0.380 | 0.327 | 1e-06 | |
| Q5R801 | 270 | 5'-AMP-activated protein | no | no | 0.216 | 0.314 | 0.365 | 3e-05 | |
| Q5RD73 | 185 | Dual specificity protein | no | no | 0.287 | 0.610 | 0.338 | 3e-05 |
| >sp|F4J117|LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana GN=LSF1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 649 bits (1674), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 302/392 (77%), Positives = 348/392 (88%)
Query: 2 SSEGSSNTGFAMFSTKYLAPQGRKLLDCQNGHTQLLSRKNVLSQPMNHLVCVFSEEESGD 61
SS+GS N+G+A FS+K+ PQG KLL+ Q+ Q ++KN+LS P++ LV VFSE+ GD
Sbjct: 199 SSQGSGNSGYAAFSSKFFTPQGWKLLNRQSNSFQSGTKKNILSPPISPLVSVFSEDVPGD 258
Query: 62 GEWAHGSFPLEEYLKALDRSKGELYYNHSLGMRYSKITEQIYVGSCIQKEADVETLSKAG 121
GEW +G+FPLEEY+KALDRSKGEL YNH+LGMRYSKITEQIYVGSCIQ E DVE LS+AG
Sbjct: 259 GEWGYGNFPLEEYIKALDRSKGELSYNHALGMRYSKITEQIYVGSCIQTEEDVENLSEAG 318
Query: 122 ITAVLNFQSGTEAENWGIDYKSINESCQKFNLLMINYPIRDSDSFDMRKKLPFCVGLLLR 181
ITA+LNFQ GTEA+NWGID +SIN++CQK +LMINYPI+D+DSFD+RKKLP CVGLLLR
Sbjct: 319 ITAILNFQGGTEAQNWGIDSQSINDACQKSEVLMINYPIKDADSFDLRKKLPLCVGLLLR 378
Query: 182 LLKKNHRVFVTCTTGLNRSPASVIAYLHWMTDTSLHAAYNFVNGLHLCRPDRPAVAWATR 241
LLKKNHRVFVTCTTG +RS A VIAYLHWMTDTSLHAAY+FV GLH C+PDRPA+AWAT
Sbjct: 379 LLKKNHRVFVTCTTGFDRSSACVIAYLHWMTDTSLHAAYSFVTGLHACKPDRPAIAWATW 438
Query: 242 DLIAMVENGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIR 301
DLIAMV++GKHDG PTH+VTFVWNG EGE+VLLVGDFTGNWK+PIKATHKGG R+E E+R
Sbjct: 439 DLIAMVDDGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVR 498
Query: 302 LTQGKYYYKYIVNGQWRHSTISPTERDDKGNVNNIIIVGDTASVRPSIQQPMKDANVVKV 361
LTQGKYYYKYI+NG WRHS SPTERDD+GN NNII+VGD A+VRP+IQQP KDAN++KV
Sbjct: 499 LTQGKYYYKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKV 558
Query: 362 IERPLTENERFMLAKAARCIAFSVCPIRLCPK 393
IER LTE+ERF LAKAARCIAFSVCPIRLCPK
Sbjct: 559 IERVLTESERFRLAKAARCIAFSVCPIRLCPK 590
|
Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation. Participates to the regulation of the initial steps of starch degradation at the granule surface. May release a different set of phosphate groups from those removed by DSP4. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: - |
| >sp|Q9FEB5|DSP4_ARATH Phosphoglucan phosphatase DSP4, chloroplastic OS=Arabidopsis thaliana GN=DSP4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SRK5|LSF2_ARATH Phosphoglucan phosphatase LSF2, chloroplastic OS=Arabidopsis thaliana GN=LSF2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q91XQ2|EPM2A_RAT Laforin (Fragment) OS=Rattus norvegicus GN=Epm2a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9WUA5|EPM2A_MOUSE Laforin OS=Mus musculus GN=Epm2a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O95278|EPM2A_HUMAN Laforin OS=Homo sapiens GN=EPM2A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q1M199|EPM2A_CANFA Laforin OS=Canis familiaris GN=EPM2A PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SCY5|KINB2_ARATH SNF1-related protein kinase regulatory subunit beta-2 OS=Arabidopsis thaliana GN=KINB2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R801|AAKB1_PONAB 5'-AMP-activated protein kinase subunit beta-1 OS=Pongo abelii GN=PRKAB1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q5RD73|DUS3_PONAB Dual specificity protein phosphatase 3 OS=Pongo abelii GN=DUSP3 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 393 | ||||||
| 225452450 | 583 | PREDICTED: uncharacterized protein LOC10 | 0.994 | 0.670 | 0.808 | 0.0 | |
| 147821809 | 538 | hypothetical protein VITISV_037832 [Viti | 0.994 | 0.726 | 0.808 | 0.0 | |
| 255567329 | 536 | protein tyrosine, putative [Ricinus comm | 0.997 | 0.731 | 0.774 | 0.0 | |
| 449446666 | 589 | PREDICTED: phosphoglucan phosphatase LSF | 0.997 | 0.665 | 0.765 | 0.0 | |
| 18395843 | 591 | protein like SEX4 1 [Arabidopsis thalian | 0.997 | 0.663 | 0.770 | 0.0 | |
| 21592520 | 591 | unknown [Arabidopsis thaliana] | 0.997 | 0.663 | 0.770 | 0.0 | |
| 297828590 | 765 | hypothetical protein ARALYDRAFT_340294 [ | 0.997 | 0.512 | 0.760 | 0.0 | |
| 356573817 | 589 | PREDICTED: uncharacterized protein LOC10 | 0.997 | 0.665 | 0.760 | 1e-178 | |
| 356560597 | 585 | PREDICTED: uncharacterized protein LOC10 | 0.997 | 0.670 | 0.760 | 1e-177 | |
| 6016710 | 716 | unknown protein [Arabidopsis thaliana] | 0.872 | 0.479 | 0.727 | 1e-146 |
| >gi|225452450|ref|XP_002274298.1| PREDICTED: uncharacterized protein LOC100252584 [Vitis vinifera] gi|296087660|emb|CBI34916.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 685 bits (1767), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 316/391 (80%), Positives = 346/391 (88%)
Query: 3 SEGSSNTGFAMFSTKYLAPQGRKLLDCQNGHTQLLSRKNVLSQPMNHLVCVFSEEESGDG 62
S+G N+GF FS K++ QG K L QNG ++N+LS P++ LVC+FSEEESGD
Sbjct: 193 SDGGGNSGFVTFSPKFITSQGWKFLMGQNGDVNSKMQRNILSPPISQLVCIFSEEESGDV 252
Query: 63 EWAHGSFPLEEYLKALDRSKGELYYNHSLGMRYSKITEQIYVGSCIQKEADVETLSKAGI 122
EWAHGSFPL+EY+KALDRSKGELYYNHSLGMRYSKITEQIYVGSCIQ EADVETLS AGI
Sbjct: 253 EWAHGSFPLDEYIKALDRSKGELYYNHSLGMRYSKITEQIYVGSCIQTEADVETLSNAGI 312
Query: 123 TAVLNFQSGTEAENWGIDYKSINESCQKFNLLMINYPIRDSDSFDMRKKLPFCVGLLLRL 182
TA+LNFQSG EAENWGI+ +SINESCQKFN+LMINYPIR+ DS+ MRKKLPFCVGLLLRL
Sbjct: 313 TAILNFQSGIEAENWGINSRSINESCQKFNILMINYPIREVDSYGMRKKLPFCVGLLLRL 372
Query: 183 LKKNHRVFVTCTTGLNRSPASVIAYLHWMTDTSLHAAYNFVNGLHLCRPDRPAVAWATRD 242
LKKNHRVFVTCTTG +RSPA V+AYLHWMTDTSLHAAYNFV GLH CRPDRPA+AWAT D
Sbjct: 373 LKKNHRVFVTCTTGFDRSPACVVAYLHWMTDTSLHAAYNFVTGLHSCRPDRPAIAWATWD 432
Query: 243 LIAMVENGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIRL 302
LIAMVE GKHDGP THAVTFVWNG EGE+V LVGDFT NWK+PIKA HKGGSRYEVE+RL
Sbjct: 433 LIAMVEKGKHDGPATHAVTFVWNGHEGEEVFLVGDFTANWKEPIKAVHKGGSRYEVEVRL 492
Query: 303 TQGKYYYKYIVNGQWRHSTISPTERDDKGNVNNIIIVGDTASVRPSIQQPMKDANVVKVI 362
TQGKYYYK+I NGQWRHST SPTERD++ NVNN+I+VGD ASVRPSIQQ KD+NVVKVI
Sbjct: 493 TQGKYYYKFITNGQWRHSTASPTERDERANVNNVIVVGDIASVRPSIQQQKKDSNVVKVI 552
Query: 363 ERPLTENERFMLAKAARCIAFSVCPIRLCPK 393
ER LTENERFMLAKAARCIAFSVCPIRL PK
Sbjct: 553 ERQLTENERFMLAKAARCIAFSVCPIRLAPK 583
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147821809|emb|CAN61666.1| hypothetical protein VITISV_037832 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255567329|ref|XP_002524644.1| protein tyrosine, putative [Ricinus communis] gi|223536005|gb|EEF37663.1| protein tyrosine, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449446666|ref|XP_004141092.1| PREDICTED: phosphoglucan phosphatase LSF1, chloroplastic-like [Cucumis sativus] gi|449489459|ref|XP_004158318.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan phosphatase LSF1, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18395843|ref|NP_566139.1| protein like SEX4 1 [Arabidopsis thaliana] gi|387942514|sp|F4J117.1|LSF1_ARATH RecName: Full=Phosphoglucan phosphatase LSF1, chloroplastic; AltName: Full=Phosphoglucan phosphatase like sex Four1; AltName: Full=Protein LIKE SEX4 1; Flags: Precursor gi|332640157|gb|AEE73678.1| protein like SEX4 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21592520|gb|AAM64470.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297828590|ref|XP_002882177.1| hypothetical protein ARALYDRAFT_340294 [Arabidopsis lyrata subsp. lyrata] gi|297328017|gb|EFH58436.1| hypothetical protein ARALYDRAFT_340294 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356573817|ref|XP_003555052.1| PREDICTED: uncharacterized protein LOC100814503 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356560597|ref|XP_003548577.1| PREDICTED: uncharacterized protein LOC100806392 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|6016710|gb|AAF01536.1|AC009325_6 unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 393 | ||||||
| TAIR|locus:2084133 | 591 | LSF1 "AT3G01510" [Arabidopsis | 0.997 | 0.663 | 0.770 | 1.3e-171 | |
| UNIPROTKB|A8J2N4 | 428 | DSP8 "Dual specificity protein | 0.659 | 0.605 | 0.330 | 9.5e-34 | |
| TAIR|locus:2083845 | 379 | SEX4 "STARCH-EXCESS 4" [Arabid | 0.765 | 0.794 | 0.307 | 2.3e-32 | |
| TAIR|locus:2085542 | 282 | LSF2 "LIKE SEX4 2" [Arabidopsi | 0.488 | 0.680 | 0.341 | 6.6e-26 | |
| UNIPROTKB|Q2QYN1 | 271 | LOC_Os12g02120 "Dual specifici | 0.483 | 0.701 | 0.34 | 2e-24 | |
| UNIPROTKB|Q2RBF6 | 271 | Os11g0113100 "cDNA clone:J0231 | 0.483 | 0.701 | 0.34 | 2e-24 | |
| UNIPROTKB|A8J1L0 | 204 | DSP6 "Dual-specificity protein | 0.399 | 0.769 | 0.335 | 9.9e-22 | |
| UNIPROTKB|Q22X01 | 480 | TTHERM_00633520 "Dual specific | 0.335 | 0.275 | 0.348 | 2.9e-12 | |
| UNIPROTKB|P80387 | 122 | PRKAB1 "5'-AMP-activated prote | 0.239 | 0.770 | 0.342 | 4.9e-08 | |
| DICTYBASE|DDB_G0281089 | 347 | prkab "AMP-activated protein k | 0.236 | 0.268 | 0.355 | 1e-07 |
| TAIR|locus:2084133 LSF1 "AT3G01510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1668 (592.2 bits), Expect = 1.3e-171, P = 1.3e-171
Identities = 302/392 (77%), Positives = 348/392 (88%)
Query: 2 SSEGSSNTGFAMFSTKYLAPQGRKLLDCQNGHTQLLSRKNVLSQPMNHLVCVFSEEESGD 61
SS+GS N+G+A FS+K+ PQG KLL+ Q+ Q ++KN+LS P++ LV VFSE+ GD
Sbjct: 199 SSQGSGNSGYAAFSSKFFTPQGWKLLNRQSNSFQSGTKKNILSPPISPLVSVFSEDVPGD 258
Query: 62 GEWAHGSFPLEEYLKALDRSKGELYYNHSLGMRYSKITEQIYVGSCIQKEADVETLSKAG 121
GEW +G+FPLEEY+KALDRSKGEL YNH+LGMRYSKITEQIYVGSCIQ E DVE LS+AG
Sbjct: 259 GEWGYGNFPLEEYIKALDRSKGELSYNHALGMRYSKITEQIYVGSCIQTEEDVENLSEAG 318
Query: 122 ITAVLNFQSGTEAENWGIDYKSINESCQKFNLLMINYPIRDSDSFDMRKKLPFCVGLLLR 181
ITA+LNFQ GTEA+NWGID +SIN++CQK +LMINYPI+D+DSFD+RKKLP CVGLLLR
Sbjct: 319 ITAILNFQGGTEAQNWGIDSQSINDACQKSEVLMINYPIKDADSFDLRKKLPLCVGLLLR 378
Query: 182 LLKKNHRVFVTCTTGLNRSPASVIAYLHWMTDTSLHAAYNFVNGLHLCRPDRPAVAWATR 241
LLKKNHRVFVTCTTG +RS A VIAYLHWMTDTSLHAAY+FV GLH C+PDRPA+AWAT
Sbjct: 379 LLKKNHRVFVTCTTGFDRSSACVIAYLHWMTDTSLHAAYSFVTGLHACKPDRPAIAWATW 438
Query: 242 DLIAMVENGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIR 301
DLIAMV++GKHDG PTH+VTFVWNG EGE+VLLVGDFTGNWK+PIKATHKGG R+E E+R
Sbjct: 439 DLIAMVDDGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVR 498
Query: 302 LTQGKYYYKYIVNGQWRHSTISPTERDDKGNVNNIIIVGDTASVRPSIQQPMKDANVVKV 361
LTQGKYYYKYI+NG WRHS SPTERDD+GN NNII+VGD A+VRP+IQQP KDAN++KV
Sbjct: 499 LTQGKYYYKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKV 558
Query: 362 IERPLTENERFMLAKAARCIAFSVCPIRLCPK 393
IER LTE+ERF LAKAARCIAFSVCPIRLCPK
Sbjct: 559 IERVLTESERFRLAKAARCIAFSVCPIRLCPK 590
|
|
| UNIPROTKB|A8J2N4 DSP8 "Dual specificity protein phosphatase 8" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083845 SEX4 "STARCH-EXCESS 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085542 LSF2 "LIKE SEX4 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2QYN1 LOC_Os12g02120 "Dual specificity phosphatase, catalytic domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2RBF6 Os11g0113100 "cDNA clone:J023127J23, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8J1L0 DSP6 "Dual-specificity protein phosphatase 6" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q22X01 TTHERM_00633520 "Dual specificity phosphatase, catalytic domain containing protein" [Tetrahymena thermophila SB210 (taxid:312017)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P80387 PRKAB1 "5'-AMP-activated protein kinase subunit beta-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281089 prkab "AMP-activated protein kinase beta subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| F4J117 | LSF1_ARATH | 3, ., 1, ., 3, ., - | 0.7704 | 0.9974 | 0.6632 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3.16 | LOW CONFIDENCE prediction! |
| 3rd Layer | 3.1.3 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 393 | |||
| cd02859 | 80 | cd02859, E_set_AMPKbeta_like_N, N-terminal Early s | 2e-28 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 3e-15 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 4e-14 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 6e-13 | |
| cd02688 | 82 | cd02688, E_set, Early set domain associated with t | 2e-07 | |
| cd07184 | 86 | cd07184, E_set_Isoamylase_like_N, N-terminal Early | 3e-04 |
| >gnl|CDD|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit | Back alignment and domain information |
|---|
Score = 106 bits (266), Expect = 2e-28
Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
Query: 260 VTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIRLTQGKYYYKYIVNGQWRH 319
VTF W G G++V + G F NW+ PI G + + L G+Y YK+IV+G+W H
Sbjct: 2 VTFRWPGPGGKEVYVTGSFD-NWQQPIPLEKSGDGEFSATVELPPGRYEYKFIVDGEWVH 60
Query: 320 STISPTERDDKGNVNNIIIV 339
PT D+ GN+NN++ V
Sbjct: 61 DPDLPTVTDEFGNLNNVLEV 80
|
E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase. Length = 80 |
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|199878 cd02688, E_set, Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus | Back alignment and domain information |
|---|
| >gnl|CDD|199892 cd07184, E_set_Isoamylase_like_N, N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 393 | |||
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 99.96 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.95 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 99.94 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 99.94 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.93 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.93 | |
| cd02859 | 79 | AMPKbeta_GBD_like AMP-activated protein kinase (AM | 99.91 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.89 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.88 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.87 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.85 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.82 | |
| cd02861 | 82 | E_set_proteins_like E or "early" set-like proteins | 99.8 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.67 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.64 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.6 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.59 | |
| KOG1616 | 289 | consensus Protein involved in Snf1 protein kinase | 99.55 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.53 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 99.53 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.45 | |
| cd02858 | 85 | Esterase_N_term Esterase N-terminal domain. Estera | 99.37 | |
| PLN02727 | 986 | NAD kinase | 99.29 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 99.02 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 98.96 | |
| cd02688 | 83 | E_set E or "early" set of sugar utilizing enzymes | 98.95 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.91 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.91 | |
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 98.72 | |
| cd02854 | 99 | Glycogen_branching_enzyme_like_N_term Glycogen bra | 98.68 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.67 | |
| PF02922 | 85 | CBM_48: Carbohydrate-binding module 48 (Isoamylase | 98.56 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.48 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.32 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.25 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.13 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.09 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.03 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.0 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 97.99 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 97.95 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 97.85 | |
| cd02855 | 106 | Glycogen_branching_enzyme_N_term Glycogen branchin | 97.82 | |
| cd02860 | 100 | Pullulanase_N_term Pullulanase domain N-terminus. | 97.78 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 97.78 | |
| cd02856 | 103 | Glycogen_debranching_enzyme_N_term Glycogen_debran | 97.76 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 97.71 | |
| cd05814 | 120 | CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- | 97.69 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 97.68 | |
| cd05808 | 95 | CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 | 97.68 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 97.57 | |
| PF00686 | 96 | CBM_20: Starch binding domain; InterPro: IPR002044 | 97.54 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 97.5 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 97.5 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 97.48 | |
| cd02852 | 119 | Isoamylase_N_term Isoamylase N-terminus domain. Is | 97.39 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 97.37 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 97.26 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 97.23 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 97.22 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 97.19 | |
| cd05816 | 99 | CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP | 97.19 | |
| cd02853 | 85 | MTHase_N_term Maltooligosyl trehalose synthase (MT | 97.13 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 97.08 | |
| cd05817 | 100 | CBM20_DSP Dual-specificity phosphatase (DSP), N-te | 96.97 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 96.94 | |
| cd05811 | 106 | CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g | 96.91 | |
| cd05818 | 92 | CBM20_water_dikinase Phosphoglucan water dikinase | 96.87 | |
| cd05809 | 99 | CBM20_beta_amylase Beta-amylase, C-terminal CBM20 | 96.85 | |
| cd05820 | 103 | CBM20_novamyl Novamyl (also known as acarviose tra | 96.76 | |
| cd05813 | 95 | CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 | 96.67 | |
| cd05467 | 96 | CBM20 The family 20 carbohydrate-binding module (C | 96.66 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 96.61 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 96.5 | |
| cd05810 | 97 | CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol | 96.49 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 96.38 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 96.04 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 95.99 | |
| cd05815 | 101 | CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP | 95.93 | |
| cd05807 | 101 | CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat | 95.85 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 95.8 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 95.17 | |
| PF03423 | 87 | CBM_25: Carbohydrate binding domain (family 25); I | 95.14 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 94.97 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 94.8 | |
| PLN02960 | 897 | alpha-amylase | 94.73 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 94.32 | |
| cd05806 | 112 | CBM20_laforin Laforin protein tyrosine phosphatase | 94.03 | |
| PF11806 | 122 | DUF3327: Domain of unknown function (DUF3327); Int | 93.43 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 93.36 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 93.15 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 92.78 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 92.68 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 92.45 | |
| PLN02316 | 1036 | synthase/transferase | 92.22 | |
| PLN02316 | 1036 | synthase/transferase | 91.13 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 90.95 | |
| KOG4471 | 717 | consensus Phosphatidylinositol 3-phosphate 3-phosp | 90.64 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 90.41 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 90.22 | |
| PF04343 | 122 | DUF488: Protein of unknown function, DUF488; Inter | 90.11 | |
| KOG0470 | 757 | consensus 1,4-alpha-glucan branching enzyme/starch | 88.89 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 88.64 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 87.44 | |
| PRK01415 | 247 | hypothetical protein; Validated | 86.94 | |
| PLN03244 | 872 | alpha-amylase; Provisional | 83.32 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 81.0 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 80.32 |
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
Probab=99.96 E-value=6.9e-29 Score=214.43 Aligned_cols=132 Identities=20% Similarity=0.309 Sum_probs=122.6
Q ss_pred CCceeeeCCeEEcCCcCCcccHHHHHhCCCceEEecCCCCCccccCCChhhhhhHhhhCCeEEEEEeccCCCCccccccH
Q 016234 93 MRYSKITEQIYVGSCIQKEADVETLSKAGITAVLNFQSGTEAENWGIDYKSINESCQKFNLLMINYPIRDSDSFDMRKKL 172 (393)
Q Consensus 93 ~~~~~I~p~LylGs~~~~a~d~~~L~~~GIt~Vvnl~~~~~~~~~~~~~~~~~~~~~~~gi~y~~ipi~D~~~~~l~~~l 172 (393)
-.+++|++.||+++.. .+.+...|+++||++|||++.+.+...+ .+++|+.+|+.|.+...+.++|
T Consensus 15 ~~~SqIt~sLfl~~Gv-aA~~k~~l~~~~It~IiNat~E~pn~~l-------------~~~qy~kv~~~D~p~~~l~~hf 80 (198)
T KOG1718|consen 15 GGMSQITPSLFLSNGV-AANDKLLLKKRKITCIINATTEVPNTSL-------------PDIQYMKVPLEDTPQARLYDHF 80 (198)
T ss_pred cchhhcCcceeEeccc-cccCHHHHHhcCceEEEEcccCCCCccC-------------CCceeEEEEcccCCcchhhhhh
Confidence 3489999999999665 7899999999999999999999865443 5899999999999999999999
Q ss_pred HHHHHHHHHHHhCCCeEEEEcCCCCChhHHHHHHHHHHHcCCCHHHHHHHHhhccCC-CCCccchhH
Q 016234 173 PFCVGLLLRLLKKNHRVFVTCTTGLNRSPASVIAYLHWMTDTSLHAAYNFVNGLHLC-RPDRPAVAW 238 (393)
Q Consensus 173 ~~av~fI~~~l~~g~~VLVHC~aGisRS~tlv~aYLm~~~g~sl~eA~~~vr~~R~~-~Pn~~fl~~ 238 (393)
+.+.+.|+....+||++||||.||+|||+++++||||++.+|++.||+.|+|++||+ +||.||+++
T Consensus 81 D~vAD~I~~v~~~gG~TLvHC~AGVSRSAsLClAYLmK~~~msLreAy~~vKa~RpiIRPN~GFw~Q 147 (198)
T KOG1718|consen 81 DPVADKIHSVIMRGGKTLVHCVAGVSRSASLCLAYLMKYHCMSLREAYHWVKARRPIIRPNVGFWRQ 147 (198)
T ss_pred hHHHHHHHHHHhcCCcEEEEEccccchhHHHHHHHHHHHccchHHHHHHHHHhhCceeCCCccHHHH
Confidence 999999999999999999999999999999999999999999999999999999996 799999964
|
|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd02861 E_set_proteins_like E or "early" set-like proteins | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd02858 Esterase_N_term Esterase N-terminal domain | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain | Back alignment and domain information |
|---|
| >cd02860 Pullulanase_N_term Pullulanase domain N-terminus | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd02852 Isoamylase_N_term Isoamylase N-terminus domain | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 | Back alignment and domain information |
|---|
| >cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 | Back alignment and domain information |
|---|
| >cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >PF04343 DUF488: Protein of unknown function, DUF488; InterPro: IPR007438 This family includes several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN03244 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 393 | ||||
| 3nme_A | 294 | Structure Of A Plant Phosphatase Length = 294 | 2e-28 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 2e-06 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 2e-06 | ||
| 1z0m_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 2e-05 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 2e-05 | ||
| 1j4x_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase C124 | 2e-05 | ||
| 1z0n_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 4e-05 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 2e-04 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 2e-04 | ||
| 2f15_A | 96 | Glycogen-Binding Domain Of The Amp-Activated Protei | 2e-04 | ||
| 2q05_A | 195 | Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO | 3e-04 | ||
| 3emu_A | 161 | Crystal Structure Of A Leucine Rich Repeat And Phos | 7e-04 |
| >pdb|3NME|A Chain A, Structure Of A Plant Phosphatase Length = 294 | Back alignment and structure |
|
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta1 Subunit Length = 96 | Back alignment and structure |
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 | Back alignment and structure |
| >pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Length = 96 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta2 Subunit Length = 96 | Back alignment and structure |
| >pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS Wr Length = 195 | Back alignment and structure |
| >pdb|3EMU|A Chain A, Crystal Structure Of A Leucine Rich Repeat And Phosphatase Domain Containing Protein From Entamoeba Histolytica Length = 161 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
Score = 239 bits (610), Expect = 5e-77
Identities = 88/299 (29%), Positives = 138/299 (46%), Gaps = 20/299 (6%)
Query: 83 GELYYNHSLGMRYSKITEQIYVGSCIQKEADVETLSKAGITAVLNFQSGTEAENWGIDYK 142
G Y H LGM Y+ I + VGSC+Q DV+ L K G+ + Q + E +G+D
Sbjct: 1 GSHMYRHELGMNYNFIRPDLIVGSCLQTPEDVDKLRKIGVKTIFCLQQDPDLEYFGVDIS 60
Query: 143 SINESCQKF-NLLMINYPIRDSDSFDMRKKLPFCVGLLLRLLKKN-HRVFVTCTTGLNRS 200
SI +K+ ++ I IRD D+FD+R +LP VG L + +K+N +V T G+ R+
Sbjct: 61 SIQAYAKKYSDIQHIRCEIRDFDAFDLRMRLPAVVGTLYKAVKRNGGVTYVHSTAGMGRA 120
Query: 201 PASVIAYLHWMTDTSLHAAYNFVNGLHLCRPDRPAVAWATRDLIAMVENGKHDGPPTHAV 260
PA + Y+ W+ L A+ + C P A+ AT D++ V
Sbjct: 121 PAVALTYMFWVQGYKLMEAHKLLMSKRSCFPKLDAIRNATIDILTG--------LKRKTV 172
Query: 261 TFVWNGQEGEDVLLVGDFTGNWKDPIKATH-KGGSRYEVEIRLTQGKYYYKYIVNGQWRH 319
T + V + G W I T KG + ++ L +G++ YKYI++G+W H
Sbjct: 173 TLTLKDKGFSRVEISGLDI-GWGQRIPLTLGKGTGFWILKRELPEGQFEYKYIIDGEWTH 231
Query: 320 STISPTERDDK-GNVNNIIIV-GDTASVRPSIQQPMKDANVVKVIERPLTENERFMLAK 376
+ P +K G+ NN V D SV + ++ + + L E ER L +
Sbjct: 232 NEAEPFIGPNKDGHTNNYAKVVDDPTSVDGTTRERLSSED------PELLEEERSKLIQ 284
|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Length = 96 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Length = 252 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Length = 156 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 393 | |||
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 100.0 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.97 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.97 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.97 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.97 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.96 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.96 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.96 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.96 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.96 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.96 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.96 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.95 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.95 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.95 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.95 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.95 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.95 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.95 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.94 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.93 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.93 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.91 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.9 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.9 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 99.89 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.88 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.86 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.86 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 99.86 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.85 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.82 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.8 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.79 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.77 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.76 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.74 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.71 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.67 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.53 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.5 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.43 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.13 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.11 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.06 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.84 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.78 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.76 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.59 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.56 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.55 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.54 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.53 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.48 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.47 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.47 | |
| 2z0b_A | 131 | GDE5, KIAA1434, putative glycerophosphodiester pho | 98.47 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.45 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.45 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.44 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.43 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.42 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.41 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.41 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.4 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.39 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.37 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.35 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.34 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.34 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.32 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.31 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 98.24 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.2 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.2 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.2 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.18 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.17 | |
| 1ac0_A | 108 | Glucoamylase; hydrolase, starch binding domain; HE | 98.1 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.07 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.04 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 98.02 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.01 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.01 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.0 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 97.99 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 97.94 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 97.91 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.82 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.77 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 97.54 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.47 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 97.47 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 97.38 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 96.63 | |
| 2laa_A | 104 | Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa | 96.58 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 96.48 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 96.31 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 96.12 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 95.77 | |
| 2vn4_A | 599 | Glucoamylase; hydrolase, carbohydrate binding, gly | 95.62 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 95.62 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 95.53 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 95.43 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 95.06 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 95.04 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 95.0 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 94.96 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 94.57 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 94.5 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 94.39 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 94.04 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 94.03 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 93.68 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 93.5 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 91.65 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 91.62 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 91.54 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 91.46 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 90.05 | |
| 2c3v_A | 102 | Alpha-amylase G-6; carbohydrate-binding module, st | 87.57 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 86.03 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 80.25 |
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-63 Score=483.56 Aligned_cols=280 Identities=30% Similarity=0.528 Sum_probs=250.5
Q ss_pred ceeecccCCCCceeeeCCeEEcCCcCCcccHHHHHhCCCceEEecCCCCCccccCCChhhhhhHhhhC-CeEEEEEeccC
Q 016234 84 ELYYNHSLGMRYSKITEQIYVGSCIQKEADVETLSKAGITAVLNFQSGTEAENWGIDYKSINESCQKF-NLLMINYPIRD 162 (393)
Q Consensus 84 ~~~~~~~~~~~~~~I~p~LylGs~~~~a~d~~~L~~~GIt~Vvnl~~~~~~~~~~~~~~~~~~~~~~~-gi~y~~ipi~D 162 (393)
+++|+|+++|++++|+|+||+|++++++.|++.|+++||++||||+.+.+...++++...+.+.++.. ||.|+++|+.|
T Consensus 2 ~~~y~~~~~~n~s~I~p~LylGs~~~~~~d~~~L~~~GIt~Vlnl~~~~e~~~~g~~~~~~~~~~~~~~gi~~~~ipi~D 81 (294)
T 3nme_A 2 SHMYRHELGMNYNFIRPDLIVGSCLQTPEDVDKLRKIGVKTIFCLQQDPDLEYFGVDISSIQAYAKKYSDIQHIRCEIRD 81 (294)
T ss_dssp ---CCGGGCCCEEEEETTEEEECCCCSTHHHHHHHHTTEEEEEECCCHHHHHHTTCCHHHHHHHHHTCTTCEEEECCCCT
T ss_pred CccccCCCCCCceEEeCCEEEEcCCCCHHHHHHHHHCCCCEEEECCCCcchhhccCChhhhhhhhhhcCCcEEEEEeCCC
Confidence 46899999999999999999999987789999999999999999999888777777777777778876 79999999999
Q ss_pred CCCccccccHHHHHHHHHHHHh-CCCeEEEEcCCCCChhHHHHHHHHHHHcCCCHHHHHHHHhhccCCCCCccchhHHHH
Q 016234 163 SDSFDMRKKLPFCVGLLLRLLK-KNHRVFVTCTTGLNRSPASVIAYLHWMTDTSLHAAYNFVNGLHLCRPDRPAVAWATR 241 (393)
Q Consensus 163 ~~~~~l~~~l~~av~fI~~~l~-~g~~VLVHC~aGisRS~tlv~aYLm~~~g~sl~eA~~~vr~~R~~~Pn~~fl~~~~~ 241 (393)
...+++..+|+++++||+++++ .|++|||||.+|+|||+++++||||+.+||++++|+++|+++||+.||.++++++|+
T Consensus 82 ~~~~~l~~~~~~~~~~I~~~l~~~g~~VLVHC~aG~sRS~tvv~ayLm~~~g~s~~~A~~~v~~~Rp~~Pn~~~l~~~~~ 161 (294)
T 3nme_A 82 FDAFDLRMRLPAVVGTLYKAVKRNGGVTYVHSTAGMGRAPAVALTYMFWVQGYKLMEAHKLLMSKRSCFPKLDAIRNATI 161 (294)
T ss_dssp TCHHHHHHHHHHHHHHHHHHHHHHCSEEEEECSSSSSHHHHHHHHHHHHTSCCCHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_pred CCCCCHHHHHHHHHHHHHHHHHhCCCEEEEECCCCCchhHHHHHHHHHHHhCCCHHHHHHHHHHhCCCCCChhhhhHHHH
Confidence 9988998899999999999984 588999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHcCCCCCCCCccceeeeeCCCCceEEEEeecCCCCcccccccccC-CCcEEEEEEcCCceEEEEEEEcCeeecC
Q 016234 242 DLIAMVENGKHDGPPTHAVTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKG-GSRYEVEIRLTQGKYYYKYIVNGQWRHS 320 (393)
Q Consensus 242 ~ll~~~~~~r~dg~~~~~v~f~w~~~~~~~V~l~GsF~~~W~~~~~m~~~~-~g~~~~~~~L~~G~y~YkF~VDG~w~~d 320 (393)
++|. +.++++|+|+|.++++++|+|+|||| ||++.++|.|.. +|.|++++.||||+|+|||+|||+|++|
T Consensus 162 ~~L~--------~~~k~~v~f~~~~~~~~~V~v~GsF~-~W~~~~~l~k~~~~g~~~~~~~L~~G~y~YkFiVDG~w~~d 232 (294)
T 3nme_A 162 DILT--------GLKRKTVTLTLKDKGFSRVEISGLDI-GWGQRIPLTLGKGTGFWILKRELPEGQFEYKYIIDGEWTHN 232 (294)
T ss_dssp HHHH--------CCCCEEEEEEEECSSCSCEEEEETTT-EEEEEEECEECTTTCEEEEEEEECSEEEEEEEEETTEEECC
T ss_pred Hhhh--------ccccccceeeeccCCCCEEEEEEecc-CCCCcccceEcCCCCEEEEEEECCCceEEEEEEECCEEeeC
Confidence 9998 77889999999987999999999999 999889999875 8999999999999999999999999999
Q ss_pred CCCCee-eCCCCCcceEEEeCCC-CCCCCccccc--CCCcchhhhhcCCCChhHHHHHHHhhcc
Q 016234 321 TISPTE-RDDKGNVNNIIIVGDT-ASVRPSIQQP--MKDANVVKVIERPLTENERFMLAKAARC 380 (393)
Q Consensus 321 ~~~p~~-~d~~G~~nnvi~v~~~-~~~~~~~~~~--~~d~~~~~~~~~~l~~~e~~~i~~~~~~ 380 (393)
|++|.+ +|++|+.||+|.|.+. .+...+...+ .+|+ .|+++||++|.+..-.
T Consensus 233 ~~~~~~~~d~~G~~nn~~~v~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~ 288 (294)
T 3nme_A 233 EAEPFIGPNKDGHTNNYAKVVDDPTSVDGTTRERLSSEDP--------ELLEEERSKLIQFLET 288 (294)
T ss_dssp TTSCEECSCTTSCCEEEEEECCCCCTTCTTHHHHHSSSSC--------CCCHHHHHHHHHHHHH
T ss_pred CCCCeeeECCCCCEeEEEEECCCCcchhHHHHHHhhcCCc--------cccHHHHHHHHHHHHh
Confidence 999954 8999999999999862 2223333333 5888 9999999999876543
|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >2c3v_A Alpha-amylase G-6; carbohydrate-binding module, starch binding, carbohydrate binding, glycoside hydrolase, amylose, amylopectin; HET: TYI; 1.39A {Bacillus halodurans} PDB: 2c3v_B* 2c3w_A* 2c3x_A* | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 393 | ||||
| d1z0na1 | 87 | b.1.18.21 (A:77-163) 5'-AMP-activated protein kina | 2e-20 | |
| d2qlvb1 | 87 | b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisi | 1e-16 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 2e-16 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 6e-14 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-13 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 8e-11 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-06 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 0.003 |
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Length = 87 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: AMPK-beta glycogen binding domain-like domain: 5'-AMP-activated protein kinase subunit beta-1 species: Rattus norvegicus [TaxId: 10116]
Score = 83.0 bits (205), Expect = 2e-20
Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
Query: 260 VTFVWNGQEGEDVLLVGDFTGNWKDPIKATHKGGSRYEVEIRLTQGKYYYKYIVNGQWRH 319
F W G G++V L G F NW + + + + L +G++ YK+ V+GQW H
Sbjct: 4 TVFRWTG-GGKEVYLSGSFN-NWSK--LPMTRSQNNFVAILDLPEGEHQYKFFVDGQWTH 59
Query: 320 STISPTERDDKGNVNNIIIVGDT 342
P G VNNII V T
Sbjct: 60 DPSEPIVTSQLGTVNNIIQVKKT 82
|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 87 | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 393 | |||
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.97 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.96 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.96 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.92 | |
| d2qlvb1 | 87 | SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | 99.92 | |
| d1z0na1 | 87 | 5'-AMP-activated protein kinase subunit beta-1 {Ra | 99.91 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.87 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.8 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.79 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.72 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.7 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.84 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.82 | |
| d2bhua1 | 97 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 98.57 | |
| d1m7xa1 | 110 | 1,4-alpha-glucan branching enzyme, N-terminal doma | 98.37 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.33 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.07 | |
| d1eh9a1 | 90 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 97.96 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 97.91 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 97.9 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 97.88 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.88 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 97.87 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 97.81 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 97.79 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 97.78 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 97.74 | |
| d1kula_ | 108 | Glucoamylase, granular starch-binding domain {Aspe | 97.72 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 97.71 | |
| d3bmva2 | 105 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.56 | |
| d1cyga2 | 106 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.3 | |
| d1qhoa2 | 110 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.29 | |
| d1vema1 | 99 | beta-amylase {Bacillus cereus [TaxId: 1396]} | 96.96 | |
| d1bf2a1 | 162 | Isoamylase, N-terminal domain N {Pseudomonas amylo | 96.48 | |
| d2fhfa1 | 115 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 96.32 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 96.19 | |
| d3c8da1 | 145 | Enterochelin esterase {Shigella flexneri 2a str. 2 | 93.12 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 86.14 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 84.55 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=9.2e-31 Score=232.89 Aligned_cols=159 Identities=24% Similarity=0.334 Sum_probs=134.7
Q ss_pred HHHHHHHHhcCCceeecccCCCCceeeeCCeEEcCCcCCcccHHHHHhCCCceEEecCCCCCccccCCChhhhhhHhhhC
Q 016234 72 EEYLKALDRSKGELYYNHSLGMRYSKITEQIYVGSCIQKEADVETLSKAGITAVLNFQSGTEAENWGIDYKSINESCQKF 151 (393)
Q Consensus 72 ~e~~~~~~~~~~~~~~~~~~~~~~~~I~p~LylGs~~~~a~d~~~L~~~GIt~Vvnl~~~~~~~~~~~~~~~~~~~~~~~ 151 (393)
.++...+....+.+. .....+++|+|+||+|+.+ .+.|.+.|+++||++|||++.+.+...+.. ....++..
T Consensus 3 ~~~~~~~~~~~~~~~---~p~~p~~~I~~~LylG~~~-~a~d~~~L~~~gI~~Iin~~~~~~~~~~~~----~~~~~~~~ 74 (178)
T d1vhra_ 3 QDLNDLLSDGSGCYS---LPSQPCNEVTPRIYVGNAS-VAQDIPKLQKLGITHVLNAAEGRSFMHVNT----NANFYKDS 74 (178)
T ss_dssp HHHHHHHSSSSSCCC---CCSSSEEEEETTEEEECHH-HHTCHHHHHHHTCCEEEETTBSSSTTSBCC----CHHHHTTT
T ss_pred HHHHHHhhCCCcccc---CCCCCcCEeeCCEEECChh-HhcCHHHHHHcCCEEEEEcCcccccccccc----cccccccC
Confidence 344555555444311 2334589999999999998 999999999999999999998776544322 34567788
Q ss_pred CeEEEEEeccCCCCccccccHHHHHHHHHHHHhC-CCeEEEEcCCCCChhHHHHHHHHHHHcCCCHHHHHHHHhhccCCC
Q 016234 152 NLLMINYPIRDSDSFDMRKKLPFCVGLLLRLLKK-NHRVFVTCTTGLNRSPASVIAYLHWMTDTSLHAAYNFVNGLHLCR 230 (393)
Q Consensus 152 gi~y~~ipi~D~~~~~l~~~l~~av~fI~~~l~~-g~~VLVHC~aGisRS~tlv~aYLm~~~g~sl~eA~~~vr~~R~~~ 230 (393)
|++|+++|+.|.+..++..+|+++++||++++.+ +++|||||.+|+|||+++++||||+++||++++|+++||++||+.
T Consensus 75 ~i~y~~ipi~D~~~~~i~~~~~~~~~fi~~~~~~~~~~VLVHC~~G~sRS~~vv~aYLm~~~~~s~~~A~~~vr~~R~i~ 154 (178)
T d1vhra_ 75 GITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIG 154 (178)
T ss_dssp TCEEEECCCCCSTTCCGGGGHHHHHHHHHHHHTSTTCCEEEECSSSSSHHHHHHHHHHHHHSCCCHHHHHHHHHHHSCCC
T ss_pred CcEEEEEecCCCcchhHHHHHHHHHHHhhhhhhcCCceEEEEcCCCCccHHHHHHHHHHHhcCCCHHHHHHHHHhCCCCC
Confidence 9999999999999999999999999999998865 569999999999999999999999999999999999999999999
Q ss_pred CCccchhH
Q 016234 231 PDRPAVAW 238 (393)
Q Consensus 231 Pn~~fl~~ 238 (393)
||.+|+.+
T Consensus 155 pn~~f~~q 162 (178)
T d1vhra_ 155 PNDGFLAQ 162 (178)
T ss_dssp CCHHHHHH
T ss_pred CCHHHHHH
Confidence 99999963
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c8da1 b.1.18.20 (A:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|