Citrus Sinensis ID: 016307

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--

MTPVCPFAKARPDDASPRKPGENSNKYPAECPFSKARPDDAASRKAVENSAKPQAEHDGDKAKSDSMDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVVSSLDYENLDPTLF

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEccccccccHHHHHcccccccccHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccc

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccHHHHcccccccHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHEEEEEEHcccccHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcHHccccccc

mtpvcpfakarpddasprkpgensnkypaecpfskarpddaasrkavensakpqaehdgdkaksdsmdsasippkcpfgydaqsfkigplsCMICQALLfecskctpcshvyckacisrfkdcplcgadiekieadTTLQDVVDRFIEGHARIkrshtnsdkeedeagenkkVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKigdlkyyggdlQAARSYYVRSLNVRRdavkrhsnvpsQVLDVAVSLAKVAdvdrsignedvaVDGFQEAIKRLESltlkpeeagLEQRVRFLFQLLVVSsldyenldptlf

mtpvcpfakarpddasprkpgensnkypaecpfSKARPDDAASRKAvensakpqaehdgdkaksdsMDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHarikrshtnsdkeedeagenkkviyeDVSMERGAFLVQQAMRAFRAQNvesaksrlslCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDavkrhsnvpsqvlDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVvssldyenldptlf

MTPVCPFAKARPDDASPRKPGENSNKYPAECPFSKARPDDAASRKAVENSAKPQAEHdgdkaksdsmdsasIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVVSSLDYENLDPTLF

***************************************************************************CPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHA*********************VIYEDVSMERGAFLVQQAMRAFRAQ********LSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVVSSLDYE*******

************************************************************************************FKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVVSSLDYENLDPTLF

*************************KYPAECPFSK***********************************SIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKR*************ENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVVSSLDYENLDPTLF

**************************************************************************KCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIK***************NKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESLTLKPEEAGLEQRVRFLFQLLVVSSLDYENLDPTLF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		392	2.2.26 [Sep-21-2011]
Q5FWP4		625	E3 ubiquitin-protein liga	N/A	no	0.216	0.136	0.309	3e-07
A5WW08		637	E3 ubiquitin-protein liga	yes	no	0.170	0.105	0.338	6e-07
Q96EP1		664	E3 ubiquitin-protein liga	yes	no	0.170	0.100	0.352	2e-06
Q810L3		664	E3 ubiquitin-protein liga	yes	no	0.170	0.100	0.352	2e-06
Q6P256		626	E3 ubiquitin-protein liga	yes	no	0.170	0.107	0.352	2e-06
Q5RF77		571	E3 ubiquitin-protein liga	yes	no	0.170	0.117	0.352	2e-06
Q640D5		323	Polycomb complex protein	N/A	no	0.224	0.272	0.265	5e-06
Q91648		326	Polycomb complex protein	N/A	no	0.224	0.269	0.309	8e-06
Q5SDR3		326	Polycomb complex protein	no	no	0.153	0.184	0.328	2e-05
Q5R8L2		326	Polycomb complex protein	no	no	0.153	0.184	0.328	2e-05

>sp\|Q5FWP4\|CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis GN=chfr PE=1 SV=1	Back alignment and function desciption

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 12/97 (12%)

Query: 72  IPPKCPFGY--DAQSFKIGP------LSCMICQALLFECSKCTPCSHVYCKACISRFKD- 122
           +P  CP G   ++++  + P      L+C+ICQ LL +C    PC H +C AC S + + 
Sbjct: 238 VPASCPIGASDESKTPSMKPDKMEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWMER 297

Query: 123 ---CPLCGADIEKIEADTTLQDVVDRFIEGHARIKRS 156
              CP C   +E+I  +  L ++V+ ++  H    RS
Sbjct: 298 SSLCPTCRCPVERICKNHILNNLVEAYLIQHPEKCRS 334

E3 ubiquitin-protein ligase that functions in the antephase checkpoint by actively delaying passage into mitosis in response to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each other along the periphery of the nucleus. Probably involved in signaling the presence of mitotic stress caused by microtubule poisons by mediating the 'Lys-48'-linked ubiquitination of target proteins, leading to their degradation by the proteasome. May also promote the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating ubc13-mms2 (ube2n-ube2v2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|A5WW08\|CHFR_DANRE E3 ubiquitin-protein ligase CHFR OS=Danio rerio GN=chfr PE=2 SV=1	Back alignment and function description

>sp\|Q96EP1\|CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens GN=CHFR PE=1 SV=2	Back alignment and function description

>sp\|Q810L3\|CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus GN=Chfr PE=1 SV=1	Back alignment and function description

>sp\|Q6P256\|CHFR_XENTR E3 ubiquitin-protein ligase CHFR OS=Xenopus tropicalis GN=chfr PE=2 SV=1	Back alignment and function description

>sp\|Q5RF77\|CHFR_PONAB E3 ubiquitin-protein ligase CHFR OS=Pongo abelii GN=CHFR PE=2 SV=1	Back alignment and function description

>sp\|Q640D5\|BMI1B_XENLA Polycomb complex protein BMI-1-B OS=Xenopus laevis GN=bmi1b PE=2 SV=1	Back alignment and function description

>sp\|Q91648\|BMI1A_XENLA Polycomb complex protein BMI-1-A OS=Xenopus laevis GN=bmi1a PE=1 SV=1	Back alignment and function description

>sp\|Q5SDR3\|BMI1_CHICK Polycomb complex protein BMI-1 OS=Gallus gallus GN=BMI1 PE=2 SV=1	Back alignment and function description

>sp\|Q5R8L2\|BMI1_PONAB Polycomb complex protein BMI-1 OS=Pongo abelii GN=BMI1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		392
118489075		363	unknown [Populus trichocarpa x Populus d	0.892	0.964	0.742	1e-154
224075908		353	predicted protein [Populus trichocarpa]	0.880	0.977	0.752	1e-154
296085428		394	unnamed protein product [Vitis vinifera]	0.915	0.911	0.714	1e-153
225465383		369	PREDICTED: uncharacterized protein LOC10	0.915	0.972	0.714	1e-152
224053090		363	predicted protein [Populus trichocarpa]	0.892	0.964	0.723	1e-151
356508245		367	PREDICTED: uncharacterized protein LOC10	0.890	0.950	0.722	1e-149
356517714		367	PREDICTED: uncharacterized protein LOC10	0.890	0.950	0.711	1e-145
449458710		404	PREDICTED: uncharacterized protein LOC10	0.948	0.920	0.660	1e-145
297820180		415	binding protein [Arabidopsis lyrata subs	0.941	0.889	0.682	1e-145
255569221		392	ubiquitin-protein ligase, putative [Rici	0.954	0.954	0.683	1e-144

>gi\|118489075\|gb\|ABK96344.1\| unknown [Populus trichocarpa x Populus deltoides]	Back alignment and taxonomy information

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 282/380 (74%), Positives = 307/380 (80%), Gaps = 30/380 (7%)

Query: 1   MTPVCPFAKA-RPDDASPRKPGENSNKYPAECPFSKARPDDAASRKAVENSAKPQAEHD- 58
           MTPVCPF KA RPDD SPRKPG        ECP                   K  AEH+ 
Sbjct: 1   MTPVCPFVKASRPDDGSPRKPG--------ECPI------------------KHGAEHEG 34

Query: 59  GDKAKSDS-MDSASIPPKCPFGYDAQSFKIGPLSCMICQALLFECSKCTPCSHVYCKACI 117
           G KAK +S  +SA++ PKCPFGYD+Q+FK+GPLSCMICQALLF+CSKC PCSHVYCK CI
Sbjct: 35  GGKAKKESGGESATVSPKCPFGYDSQTFKLGPLSCMICQALLFDCSKCVPCSHVYCKVCI 94

Query: 118 SRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEEDEAGENKKVIYED 177
           SRFKDCPLCGAD+EKIEADT LQ VVDRFI+GHARIKRSH + DK E EAGENKKVIYED
Sbjct: 95  SRFKDCPLCGADVEKIEADTDLQSVVDRFIDGHARIKRSHVDMDK-EGEAGENKKVIYED 153

Query: 178 VSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTSELCSQLGAVLGML 237
           VS+ERGAFLVQQAMRAFRAQNVESAKSRLSLC EDIR +IE +GNTSELCSQLGAVLGML
Sbjct: 154 VSLERGAFLVQQAMRAFRAQNVESAKSRLSLCAEDIRGRIETVGNTSELCSQLGAVLGML 213

Query: 238 GDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYYGGDLQAARS 297
           GDCCRA+GDA +AV YF +SVEFL KL   DLEI HT SVSLNKIGDLKYY GDL+AARS
Sbjct: 214 GDCCRAVGDAGSAVTYFEESVEFLSKLAAADLEITHTHSVSLNKIGDLKYYDGDLEAARS 273

Query: 298 YYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAVDGFQEAIKRLESL 357
           YY+RSLNVRRDA+K H +V SQ LDVAVSLAKVAD DRSIGNED A+D F EAIK LESL
Sbjct: 274 YYMRSLNVRRDAIKHHPSVSSQTLDVAVSLAKVADADRSIGNEDAALDRFHEAIKLLESL 333

Query: 358 TLKPEEAGLEQRVRFLFQLL 377
           TLKPEEAGLEQR   + + L
Sbjct: 334 TLKPEEAGLEQRRLSVLEFL 353

Source: Populus trichocarpa x Populus deltoides

Species: Populus trichocarpa x Populus deltoides

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224075908\|ref\|XP_002304823.1\| predicted protein [Populus trichocarpa] gi\|222842255\|gb\|EEE79802.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296085428\|emb\|CBI29160.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225465383\|ref\|XP_002276838.1\| PREDICTED: uncharacterized protein LOC100262520 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224053090\|ref\|XP_002297702.1\| predicted protein [Populus trichocarpa] gi\|222844960\|gb\|EEE82507.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356508245\|ref\|XP_003522869.1\| PREDICTED: uncharacterized protein LOC100813258 [Glycine max]	Back alignment and taxonomy information

>gi\|356517714\|ref\|XP_003527531.1\| PREDICTED: uncharacterized protein LOC100813844 [Glycine max]	Back alignment and taxonomy information

>gi\|449458710\|ref\|XP_004147090.1\| PREDICTED: uncharacterized protein LOC101210945 [Cucumis sativus] gi\|449503311\|ref\|XP_004161939.1\| PREDICTED: uncharacterized LOC101210945 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297820180\|ref\|XP_002877973.1\| binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297323811\|gb\|EFH54232.1\| binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|255569221\|ref\|XP_002525579.1\| ubiquitin-protein ligase, putative [Ricinus communis] gi\|223535158\|gb\|EEF36838.1\| ubiquitin-protein ligase, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		392
TAIR\|locus:2096179		405	AT3G54360 [Arabidopsis thalian	0.931	0.901	0.646	2.6e-127
UNIPROTKB\|Q5T8Z4		150	BMI1 "Polycomb complex protein	0.163	0.426	0.32	2.5e-06
UNIPROTKB\|Q5T8Z5		92	BMI1 "Polycomb complex protein	0.163	0.695	0.32	2.5e-06
UNIPROTKB\|Q5T8Z6		105	BMI1 "Polycomb complex protein	0.163	0.609	0.32	2.5e-06
ZFIN\|ZDB-GENE-030131-3522		637	chfr "checkpoint with forkhead	0.201	0.124	0.325	3.5e-06
UNIPROTKB\|Q5FWP4		625	chfr "E3 ubiquitin-protein lig	0.216	0.136	0.319	7.3e-06
UNIPROTKB\|F5GWT6		349	CHFR "E3 ubiquitin-protein lig	0.201	0.226	0.325	7.7e-06
UNIPROTKB\|E1BBP0		663	CHFR "Uncharacterized protein"	0.318	0.188	0.284	1.3e-05
MGI\|MGI:2444898		664	Chfr "checkpoint with forkhead	0.364	0.215	0.277	1.7e-05
UNIPROTKB\|Q5RF77		571	CHFR "E3 ubiquitin-protein lig	0.201	0.138	0.325	1.8e-05

TAIR\|locus:2096179 AT3G54360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1250 (445.1 bits), Expect = 2.6e-127, P = 2.6e-127
 Identities = 249/385 (64%), Positives = 293/385 (76%)

Query:     2 TPVCPFAKA-RPDDASPRKPGENSNKYPAECPFSKA-RPDDAASRKAVEN---------S 50
             T VCPF+KA RPDD S RK GE +    + CPFSKA RPDDA++RK  E          S
Sbjct:     4 TSVCPFSKAARPDDGSTRKQGEIT---ASGCPFSKAARPDDASARKQGETTASGCPFSKS 60

Query:    51 AKPQAE------HXXXXXXXXXXXXXXIPPKCPFGYDAQSFKIGPLSCMICQALLFECSK 104
             A+P                        +P KCPFGYD+Q+FK+GP SCM+CQALL+E S+
Sbjct:    61 ARPDENGSKGCPEQEGNLNKDSTDSATVPAKCPFGYDSQTFKLGPFSCMLCQALLYESSR 120

Query:   105 CTPCSHVYCKACISRFKDCPLCGADIEKIEADTTLQDVVDRFIEGHARIKRSHTNSDKEE 164
             C PC+HV+CK C++RFKDCPLCGADIE IE D  LQ +VD+FIEGHARIKRS  N  ++E
Sbjct:   121 CVPCTHVFCKVCLTRFKDCPLCGADIESIEVDENLQKMVDQFIEGHARIKRSVVNGTEKE 180

Query:   165 DEAGENKKVIYEDVSMERGAFLVQQAMRAFRAQNVESAKSRLSLCTEDIRDQIERMGNTS 224
             +   +NKKVIY DVSMERG+FLVQQAMRAF AQN ESAKSRL++CTEDIRDQ+ R GNT 
Sbjct:   181 EVENDNKKVIYADVSMERGSFLVQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTP 240

Query:   225 ELCSQLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGD 284
             ELCSQLGAVLGMLGDC RAMGD+ +AV +F +SVEFLMKLP++DLEI HTLSVSLNKIGD
Sbjct:   241 ELCSQLGAVLGMLGDCSRAMGDSSSAVKHFEESVEFLMKLPLNDLEITHTLSVSLNKIGD 300

Query:   285 LKYYGGDLQAARSYYVRSLNVRRDAVKRHSNVPSQVLDVAVSLAKVADVDRSIGNEDVAV 344
             LKYY  DLQAARSYY R+LNVRRDA+K H N PSQ+LDVAVSLAKVAD+DR++ NE  A 
Sbjct:   301 LKYYDEDLQAARSYYDRALNVRRDAMKHHPNAPSQILDVAVSLAKVADIDRTLQNEVAAT 360

Query:   345 DGFQEAIKRLESLTLKPEEAGLEQR 369
             DGF+E ++ LESL L  E++ LEQR
Sbjct:   361 DGFKEGMRLLESLKLDSEDSALEQR 385

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA

UNIPROTKB\|Q5T8Z4 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5T8Z5 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5T8Z6 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-3522 chfr "checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5FWP4 chfr "E3 ubiquitin-protein ligase CHFR" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|F5GWT6 CHFR "E3 ubiquitin-protein ligase CHFR" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BBP0 CHFR "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:2444898 Chfr "checkpoint with forkhead and ring finger domains" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5RF77 CHFR "E3 ubiquitin-protein ligase CHFR" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	grail3.0074014501	hypothetical protein (353 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		392
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	9e-08
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	3e-07
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	8e-07
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	4e-06
smart00184		40	smart00184, RING, Ring finger	5e-06
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	1e-05
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	3e-04

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

 Score = 48.9 bits (117), Expect = 9e-08
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 4/80 (5%)

Query: 229 QLGAVLGMLGDCCRAMGDADAAVAYFADSVEFLMKLPMDDLEIIHTLSVSLNKIGDLKYY 288
            L A L  L    R +GD D A+     ++E   +L  D  E        LN +  L   
Sbjct: 3   DLAAALNNLALVLRRLGDYDEALELLEKALELARELGEDHPETARA----LNNLARLYLA 58

Query: 289 GGDLQAARSYYVRSLNVRRD 308
            GD   A  Y  ++L +R  
Sbjct: 59  LGDYDEALEYLEKALALREA 78

Length = 78

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		392
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.06
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	98.99
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.81
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.8
KOG4367		699	consensus Predicted Zn-finger protein [Function un	98.79
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.75
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.74
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	98.67
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	98.66
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.64
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.62
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	98.62
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.61
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	98.6
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.54
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.5
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.43
PHA02929		238	N1R/p28-like protein; Provisional	98.37
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.37
PF14634		44	zf-RING_5: zinc-RING finger domain	98.35
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.29
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	98.29
PHA02926		242	zinc finger-like protein; Provisional	98.26
KOG2660		331	consensus Locus-specific chromosome binding protei	98.19
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.17
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	98.15
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.14
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.06
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	98.03
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	97.96
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.92
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	97.87
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.77
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.69
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	97.61
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.52
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	97.39
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	97.35
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	97.33
COG5152		259	Uncharacterized conserved protein, contains RING a	97.32
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	97.27
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	97.24
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	97.21
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	97.19
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	97.17
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.11
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	97.03
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	96.98
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	96.96
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	96.92
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	96.81
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	96.74
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	96.7
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	96.57
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	96.39
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	96.36
KOG0297		391	consensus TNF receptor-associated factor [Signal t	96.35
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	96.31
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	96.2
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	96.16
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	96.09
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	96.05
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	95.89
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	95.83
KOG1002		791	consensus Nucleotide excision repair protein RAD16	95.8
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	95.76
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	95.73
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	95.67
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	95.64
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	95.54
KOG0825		1134	consensus PHD Zn-finger protein [General function	95.45
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	95.35
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	95.24
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	95.23
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	95.19
KOG1126		638	consensus DNA-binding cell division cycle control	95.0
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	94.88
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	94.85
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	94.79
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	94.74
PRK15359		144	type III secretion system chaperone protein SscB;	94.74
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	94.72
KOG4739		233	consensus Uncharacterized protein involved in syna	94.72
KOG0553		304	consensus TPR repeat-containing protein [General f	94.71
PRK15359		144	type III secretion system chaperone protein SscB;	94.63
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	94.62
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	94.57
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	94.32
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	94.15
PRK11788		389	tetratricopeptide repeat protein; Provisional	94.06
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	94.0
KOG2376		652	consensus Signal recognition particle, subunit Srp	93.96
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	93.92
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	93.88
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	93.86
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	93.83
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	93.8
PRK11788		389	tetratricopeptide repeat protein; Provisional	93.76
PRK11189		296	lipoprotein NlpI; Provisional	93.72
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	93.6
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	93.6
PRK11189		296	lipoprotein NlpI; Provisional	93.49
KOG1125		579	consensus TPR repeat-containing protein [General f	93.32
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	93.32
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	93.3
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	93.24
PRK10370		198	formate-dependent nitrite reductase complex subuni	93.22
KOG1941		518	consensus Acetylcholine receptor-associated protei	93.18
PF04641		260	Rtf2: Rtf2 RING-finger	93.13
PRK04841		903	transcriptional regulator MalT; Provisional	93.09
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	93.0
PF10952		140	DUF2753: Protein of unknown function (DUF2753); In	92.84
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	92.51
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	92.44
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	92.4
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	92.33
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	92.33
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	92.14
TIGR02552		135	LcrH_SycD type III secretion low calcium response	92.11
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	92.1
KOG1585		308	consensus Protein required for fusion of vesicles	92.02
KOG3039		303	consensus Uncharacterized conserved protein [Funct	91.92
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	91.7
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	91.63
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	91.53
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	91.42
KOG2003		840	consensus TPR repeat-containing protein [General f	91.37
PRK12370		553	invasion protein regulator; Provisional	91.28
TIGR02552		135	LcrH_SycD type III secretion low calcium response	91.15
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	91.07
KOG1586		288	consensus Protein required for fusion of vesicles	90.97
KOG1001		674	consensus Helicase-like transcription factor HLTF/	90.94
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	90.89
PRK04841		903	transcriptional regulator MalT; Provisional	90.82
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	90.56
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	90.46
PF13371		73	TPR_9: Tetratricopeptide repeat	90.32
KOG3002		299	consensus Zn finger protein [General function pred	90.21
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	90.14
KOG1941		518	consensus Acetylcholine receptor-associated protei	90.1
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	89.66
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	89.5
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	89.5
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	89.49
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	89.42
PRK10803		263	tol-pal system protein YbgF; Provisional	89.4
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	89.33
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	88.57
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	88.5
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	88.49
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	88.48
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	88.47
KOG0547		606	consensus Translocase of outer mitochondrial membr	88.44
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	88.26
PRK10370		198	formate-dependent nitrite reductase complex subuni	88.13
PF12688		120	TPR_5: Tetratrico peptide repeat	88.12
PRK10803		263	tol-pal system protein YbgF; Provisional	88.09
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	87.98
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	87.95
KOG4555		175	consensus TPR repeat-containing protein [Function	87.73
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	87.59
PRK12370		553	invasion protein regulator; Provisional	87.5
cd02682		75	MIT_AAA_Arch MIT: domain contained within Microtub	87.4
COG5236		493	Uncharacterized conserved protein, contains RING Z	87.37
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	87.22
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	86.71
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	86.55
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	86.39
COG5219		1525	Uncharacterized conserved protein, contains RING Z	86.13
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	86.07
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	86.06
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	85.89
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	85.67
KOG4234		271	consensus TPR repeat-containing protein [General f	85.65
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	85.46
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	85.15
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	84.83
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	84.81
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	84.16
PRK14720		906	transcript cleavage factor/unknown domain fusion p	83.91
KOG2003		840	consensus TPR repeat-containing protein [General f	83.85
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	83.6
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	83.6
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	83.48
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	83.02
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	82.97
PF04212		69	MIT: MIT (microtubule interacting and transport) d	82.65
KOG0553		304	consensus TPR repeat-containing protein [General f	82.35
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	82.24
PF13428		44	TPR_14: Tetratricopeptide repeat	82.24
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	81.39
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	81.34
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	81.16
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	81.16
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	81.05
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	80.88
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	80.25
KOG1126		638	consensus DNA-binding cell division cycle control	80.2
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	80.16
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	80.03

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

Probab=99.06  E-value=4.1e-11  Score=79.52  Aligned_cols=34  Identities=38%  Similarity=1.083  Sum_probs=27.9

Q ss_pred             ccccccccccCceeccccCcchHHhHhcCC--------CCCCC
Q 016307           92 CMICQALLFECSKCTPCSHVYCKACISRFK--------DCPLC  126 (392)
Q Consensus        92 C~iC~~~~~~~p~~~~C~h~fC~~Ci~~~~--------~CP~C  126 (392)
                      ||||+++|. +|++++|||+||..||.++|        .||.|
T Consensus         1 CpiC~~~~~-~Pv~l~CGH~FC~~Cl~~~~~~~~~~~~~CP~C   42 (42)
T PF15227_consen    1 CPICLDLFK-DPVSLPCGHSFCRSCLERLWKEPSGSGFSCPEC   42 (42)
T ss_dssp             ETTTTSB-S-SEEE-SSSSEEEHHHHHHHHCCSSSST---SSS
T ss_pred             CCccchhhC-CccccCCcCHHHHHHHHHHHHccCCcCCCCcCC
Confidence            899999999 99999999999999999874        38876

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		392
2h0d_A		97	Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti		3e-06
3rpg_B		117	Bmi1RING1B-Ubch5c Complex Structure Length = 117		4e-06
2ckl_A		108	Ring1b-Bmi1 E3 Catalytic Domain Structure Length =		4e-06

>pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97

Back alignment and structure

Iteration: 1
 Score = 49.7 bits (117), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 10/70 (14%)
Query: 90  LSCMICQALLFECSKCTPCSHVYCKACISRF----KDCPLCGADIEK------IEADTTL 139
           L C++C     + +    C H +CK CI R+    K CP+C   + K      I +D TL
Sbjct: 12  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTL 71
Query: 140 QDVVDRFIEG 149
           QD+V + + G
Sbjct: 72  QDIVYKLVPG 81

PyMOL of 2h0d

>pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117

Back alignment and structure

>pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		392
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	5e-14
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	2e-10
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	1e-09
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	1e-09
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	2e-09
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	2e-05
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	4e-09
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	3e-06
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	4e-06
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	1e-04
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	7e-04
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	7e-09
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	8e-08
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	2e-06
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	3e-06
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	6e-06
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	4e-05
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	5e-04
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	8e-09
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	1e-08
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	5e-07
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	8e-06
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	1e-05
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	1e-08
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	2e-08
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	3e-08
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	2e-07
1z6u_A		150	NP95-like ring finger protein isoform B; structura	2e-07
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	2e-07
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	2e-07
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	4e-07
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	5e-07
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	5e-07
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	2e-06
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	5e-06
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	5e-06
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	2e-05
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	6e-06
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	7e-06
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	9e-06
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	1e-05
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	1e-05
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	1e-05
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	2e-05
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	2e-05
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	3e-05
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	3e-05
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	3e-05
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	4e-05
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	2e-04
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	2e-04
3nw0_A		238	Non-structural maintenance of chromosomes element	5e-05
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	8e-05
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	9e-05
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	1e-04
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	1e-04
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	2e-04
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	2e-04
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	2e-04
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	2e-04
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	4e-04
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	4e-04
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	6e-04

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

 Score = 66.8 bits (163), Expect = 5e-14
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 10/70 (14%)

Query: 90  LSCMICQALLFECSKCTPCSHVYCKACISRF----KDCPLCGADI------EKIEADTTL 139
           L C++C     + +    C H +CK CI R+    K CP+C   +        I +D TL
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTL 75

Query: 140 QDVVDRFIEG 149
           QD+V + + G
Sbjct: 76  QDIVYKLVPG 85

PyMOL of 2ckl

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		392
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.32
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.26
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.26
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.24
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.23
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.22
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.17
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.14
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.13
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.11
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.09
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.08
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.08
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.06
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.05
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	99.05
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	99.04
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.99
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.97
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.97
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.96
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.94
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.94
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.94
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.93
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.92
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.91
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.91
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.9
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.89
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.88
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.87
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	98.86
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.86
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.86
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.84
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.82
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.81
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.81
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.8
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.79
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.75
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.74
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.73
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.72
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.71
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.7
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.69
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.68
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.66
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.65
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.64
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	98.64
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.63
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.6
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.59
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.58
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.55
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	98.54
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.53
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.52
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.5
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.49
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	98.46
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	98.44
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	98.43
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	98.43
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.38
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.36
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.36
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	98.36
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.35
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.35
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	98.35
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.34
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.3
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	98.29
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.27
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	98.26
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.26
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	98.25
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	98.24
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.23
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.2
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	98.19
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	98.17
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	98.16
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	98.16
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.12
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	98.11
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	98.11
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	98.09
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.08
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.07
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	98.05
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.05
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	98.04
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.04
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.03
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	97.9
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.89
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	97.87
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	97.87
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	97.86
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	97.83
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	97.82
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.81
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	97.81
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	97.8
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	97.79
4g1t_A		472	Interferon-induced protein with tetratricopeptide	97.74
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	97.71
4g1t_A		472	Interferon-induced protein with tetratricopeptide	97.69
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	97.61
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	97.61
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.61
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	97.59
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	97.57
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	97.54
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	97.51
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	97.46
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.42
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	97.4
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	97.4
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	97.4
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	97.4
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	97.39
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	97.34
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	97.31
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.31
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	97.29
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	97.28
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.25
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.25
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	97.22
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	97.21
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	97.17
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.16
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	97.15
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	97.13
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	97.13
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	97.13
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	97.12
2l6j_A		111	TPR repeat-containing protein associated with HSP;	97.12
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.11
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	97.08
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	97.03
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	97.02
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	97.02
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	97.0
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	96.98
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	96.97
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	96.96
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	96.94
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	96.92
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	96.91
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	96.88
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	96.87
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	96.84
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	96.83
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	96.83
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	96.81
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	96.79
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	96.79
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	96.77
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	96.76
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	96.74
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	96.74
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	96.73
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	96.72
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	96.72
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	96.7
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	96.67
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	96.64
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	96.63
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	96.61
3u4t_A		272	TPR repeat-containing protein; structural genomics	96.6
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	96.58
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	96.57
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	96.55
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	96.54
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	96.53
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	96.51
3k9i_A		117	BH0479 protein; putative protein binding protein,	96.5
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	96.5
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	96.49
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	96.47
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	96.47
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	96.46
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	96.42
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	96.4
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	96.38
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	96.38
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	96.37
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	96.37
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	96.37
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	96.34
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	96.34
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	96.33
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	96.32
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	96.3
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	96.3
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	96.3
3u4t_A		272	TPR repeat-containing protein; structural genomics	96.29
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	96.28
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	96.28
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	96.28
2kat_A		115	Uncharacterized protein; NESG, structure, structur	96.24
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	96.2
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	96.16
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	96.15
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	96.15
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	96.14
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	96.12
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	96.1
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	96.08
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	96.08
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	96.03
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	95.91
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	95.91
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	95.84
3k9i_A		117	BH0479 protein; putative protein binding protein,	95.83
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	95.71
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	95.67
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	95.66
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	95.6
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	95.27
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	95.23
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	95.22
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	95.21
2gw1_A		514	Mitochondrial precursor proteins import receptor;	95.21
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	95.2
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	95.16
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	95.07
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	95.0
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	94.95
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	94.91
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	94.69
2gw1_A		514	Mitochondrial precursor proteins import receptor;	94.66
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	94.52
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	94.42
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	94.03
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	93.94
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	93.53
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	91.58
2kat_A		115	Uncharacterized protein; NESG, structure, structur	91.51
2l6j_A		111	TPR repeat-containing protein associated with HSP;	90.69
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	90.34
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	90.26
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	89.52
1klx_A		138	Cysteine rich protein B; structural genomics, heli	89.39
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	89.01
2csv_A		72	Tripartite motif protein 29; ZF-B_BOX domain, TRIM	89.01
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	88.91
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	87.84
3nw0_A		238	Non-structural maintenance of chromosomes element	87.74
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	86.14
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	84.86
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	84.78
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	83.5
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	83.21
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	82.65
2w2u_A		83	Hypothetical P60 katanin; hydrolase transport comp	82.22
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	81.91
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	81.58
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	81.37
2v6y_A		83	AAA family ATPase, P60 katanin; MIT, VPS4, archaea	80.28

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

Probab=99.32  E-value=1.1e-12  Score=101.98  Aligned_cols=62  Identities=27%  Similarity=0.676  Sum_probs=55.1

Q ss_pred             CceeccccccccccCceecc-ccCcchHHhHhcCC------CCCCCCccccc---chhhHHHHHHHHHHHhhc
Q 016307           88 GPLSCMICQALLFECSKCTP-CSHVYCKACISRFK------DCPLCGADIEK---IEADTTLQDVVDRFIEGH  150 (392)
Q Consensus        88 ~~l~C~iC~~~~~~~p~~~~-C~h~fC~~Ci~~~~------~CP~C~~~~~~---~~~n~~l~~lv~~~~~~~  150 (392)
                      +.+.|+||++++. +|++++ |||+||..||..|+      .||.||..+..   +.+|..+.++++.+....
T Consensus        12 ~~~~C~IC~~~~~-~p~~~~~CgH~fC~~Ci~~~~~~~~~~~CP~Cr~~~~~~~~~~~n~~l~~~i~~~~~~~   83 (92)
T 3ztg_A           12 DELLCLICKDIMT-DAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALIANKFLRQAVNNFKNET   83 (92)
T ss_dssp             TTTEETTTTEECS-SCEECTTTCCEECHHHHHHHHHHCTTCCCTTTCCSSCCTTSCEECHHHHHHHHHHHHHH
T ss_pred             cCCCCCCCChhhc-CceECCCCCCHHHHHHHHHHHHhcCCCcCcCCCCcCCCccccCcCHHHHHHHHHHHHHH
Confidence            5789999999988 999999 99999999999884      69999998742   899999999999998643

PyMOL of 3ztg

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius}	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		392
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	8e-08
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	6e-07
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	1e-06
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	2e-06
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	2e-06
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	5e-05
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	1e-04
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	7e-04
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	0.004

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

 Score = 46.9 bits (111), Expect = 8e-08
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 8/58 (13%)

Query: 92  CMICQALLFECSKCTPCSHVYCKACISRF----KDCPLCGADIEKI----EADTTLQD 141
           C IC       S   PC H +C  CI+R+      CPLC   +E +    E+D+   D
Sbjct: 8   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGD 65

PyMOL of d1chca_

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		392
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.33
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.3
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.22
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.22
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.15
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.09
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	99.09
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.87
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.85
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.84
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.77
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.68
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.62
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.57
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	98.26
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.15
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.01
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	97.98
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.97
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	97.95
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.8
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.78
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	97.73
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	97.73
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.67
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	97.66
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.59
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.57
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	97.53
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	97.52
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	97.5
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	97.46
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	97.45
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	97.44
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	97.4
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.36
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	97.33
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.12
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.09
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	97.09
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	97.05
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	97.03
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	96.98
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	96.9
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	96.85
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	96.76
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	96.69
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	96.67
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	96.51
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	96.34
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	96.15
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	95.88
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	95.68
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	95.19
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	94.34
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	94.24
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	94.22
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	92.15
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	91.69
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	91.5
d2csva1		59	Tripartite motif-containing protein 29 {Human (Hom	90.7
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	88.09
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	87.55
d1wfda_		93	Hypothetical protein 1500032H18Rik {Mouse (Mus mus	80.91
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	80.1

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.33  E-value=3e-13  Score=100.68  Aligned_cols=63  Identities=19%  Similarity=0.242  Sum_probs=56.2

Q ss_pred             cCceeccccccccccCceeccccCcchHHhHhcCC-----CCCCCCccccc--chhhHHHHHHHHHHHhhc
Q 016307           87 IGPLSCMICQALLFECSKCTPCSHVYCKACISRFK-----DCPLCGADIEK--IEADTTLQDVVDRFIEGH  150 (392)
Q Consensus        87 ~~~l~C~iC~~~~~~~p~~~~C~h~fC~~Ci~~~~-----~CP~C~~~~~~--~~~n~~l~~lv~~~~~~~  150 (392)
                      .++|.||||++++. +|++++|||+||+.||.+|+     .||.|+.++..  +.+|..|+++|+.|...+
T Consensus         5 P~~l~CpIc~~l~~-dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l~~~   74 (80)
T d2c2la2           5 PDYLCGKISFELMR-EPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISEN   74 (80)
T ss_dssp             CSTTBCTTTCSBCS-SEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHHHHHHHTTC
T ss_pred             CccccCcCcCchhh-hhcccCCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHHHHHHHHHC
Confidence            36789999999998 99999999999999999883     49999998876  889999999999998643

PyMOL of d2c2la2

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure