Citrus Sinensis ID: 016314

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MGSHTNGVVSGDLAGSSNGGGGGGGGRGGGTATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHccccccEEEEEcccccccccccccEEEEccccccccccccHHHHHHHHHHcccccccccccccEEEEEEEEccccccHHHHHHHHcccHHHHHccccccccccccccccccHHHHHHHHcccccEEEccccccccccEEEEEEEcccccccccccccccEEEEEEccccEEEEEEEEEEEEEcccccccccccEEEcccccccccccEEEEEEEcccEEEEccccEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccEEcc
cccccccEEccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHcHHHHHHHHHHHHccHHHHcccEEEEEcccccHHHHHHHHccccEEEEEEcccHHHHHHHHHHHccccccEEEEEcccccccccccEEEEEEcccEEcEcEcccHHHHHHHHHHHEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccEcccccHHEEccccEEEEEEEEEEEHHHHcccccccEEEEcccccEEEEEEEEEEEEEccccccccccEEEEEcccccccccccEEEEEEEcccEEEEcccEEEEEEEEEccccccccEEEEEEEEEccccccccHcccccEEcc
mgshtngvvsgdlagssnggggggggrgggtatVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSifqnkhhfqgktvldvgtgSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGsvedivlpEKVDVIISEWMGYFLLRESMFDSVIcardrwlkptgvmypsharmwvapirsglgdqkqqdyEGALDDWYSFLKETKtyygvdmsvltkpfseeQKKYYLQTSlwsnlhpdqviGTAAVVKnidcstatvDDIREVRSKFLSSirgegtrlcgfsgwfdvhfrgstedpaqqeielttapstyngthwgqqvflfrpsvrvsegddlnvsFSMTRSKENHRLLEVEFSCEirestgqilppiknkfyie
mgshtngvVSGDLAGSSNGGGGGGGGRGGGTATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIegsvedivlpeKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFlssirgegtrLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSfsmtrskenhrLLEVEFSceirestgqilppiknkfyie
MGSHTNGVVSGDLAGSSNggggggggrgggTATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE
************************************EVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRG**********ELTTAPSTYNGTHWGQQVFLFRPSVRVSE***LNV***********RLLEVEFSCEIRESTGQILPPIK******
****************************************ANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEI*********PIKNKFYIE
********VSGDLAGSSN************TATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE
*************************************VDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSHTNGVVSGDLAGSSNGGGGGGGGRGGGTATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query391 2.2.26 [Sep-21-2011]
Q9MAT5383 Protein arginine N-methyl yes no 0.923 0.942 0.717 1e-161
Q9SNQ2380 Protein arginine N-methyl yes no 0.920 0.947 0.686 1e-157
A2Y953382 Protein arginine N-methyl N/A no 0.920 0.942 0.686 1e-157
A2XYY8379 Probable protein arginine N/A no 0.780 0.804 0.375 2e-58
Q7XKC0391 Probable protein arginine no no 0.780 0.780 0.375 6e-58
Q08A71435 Probable protein arginine no no 0.782 0.703 0.365 5e-57
Q6NWG4349 Protein arginine N-methyl yes no 0.785 0.879 0.382 6e-54
B0JYW5340 Protein arginine N-methyl yes no 0.777 0.894 0.371 5e-52
Q8AV13369 Protein arginine N-methyl N/A no 0.836 0.886 0.339 7e-51
Q6VRB0351 Protein arginine N-methyl N/A no 0.782 0.871 0.358 9e-51
>sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 Back     alignment and function desciption
 Score =  569 bits (1467), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/361 (71%), Positives = 306/361 (84%)

Query: 31  TATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSG 90
           +A VDKEVD+A YFCTY+FLYHQK+MLSDRVRMDAYFN++FQNKHHF+GKTVLDVGTGSG
Sbjct: 23  SAPVDKEVDYAQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSG 82

Query: 91  ILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIIS 150
           ILAIWSAQAGARKVYAVEATKM+DHAR LVKANNL  +VEVIEGSVEDI LPEKVDVIIS
Sbjct: 83  ILAIWSAQAGARKVYAVEATKMADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIIS 142

Query: 151 EWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDD 210
           EWMGYFLLRESMFDSVI ARDRWLKPTGVMYPSHARMW+API+S + D+K+ D++GA+ D
Sbjct: 143 EWMGYFLLRESMFDSVISARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMAD 202

Query: 211 WYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTA 270
           W++F  E K+YYGVDM VLTKPF+EEQ+KYY+QT++W++L+P Q+IGT  +VK +DC TA
Sbjct: 203 WHNFSDEIKSYYGVDMGVLTKPFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTA 262

Query: 271 TVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHW 330
           +V +I EVRS   S I  E TRLCGF GWFDV F G  EDPAQQEIELTTAPS  + THW
Sbjct: 263 SVSEIEEVRSNVTSVINMEHTRLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHW 322

Query: 331 GQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYI 390
           GQQVF+    + V EGD+LN+   M+RSKENHRL+E+E +CEI+E++G      K  ++I
Sbjct: 323 GQQVFIMSNPINVEEGDNLNLGLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFI 382

Query: 391 E 391
           E
Sbjct: 383 E 383
Methylates the guanidino nitrogens of arginyl residues in some proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 Back     alignment and function description
>sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=2 SV=1 Back     alignment and function description
>sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=2 SV=1 Back     alignment and function description
>sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=2 SV=2 Back     alignment and function description
>sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 Back     alignment and function description
>sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 Back     alignment and function description
>sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 Back     alignment and function description
>sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 Back     alignment and function description
>sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
225445416381 PREDICTED: probable protein arginine N-m 0.974 1.0 0.774 1e-180
224114359380 hypothetical protein POPTRDRAFT_746911 [ 0.918 0.944 0.799 1e-175
449464586379 PREDICTED: probable protein arginine N-m 0.964 0.994 0.767 1e-174
363806714374 uncharacterized protein LOC100790625 [Gl 0.936 0.978 0.777 1e-172
356508346374 PREDICTED: probable protein arginine N-m 0.936 0.978 0.771 1e-171
297738912337 unnamed protein product [Vitis vinifera] 0.859 0.997 0.804 1e-162
297848734372 arginine N-methyltransferase family prot 0.951 1.0 0.701 1e-161
18390448383 putative protein arginine N-methyltransf 0.923 0.942 0.717 1e-160
353251757376 Chain C, A Uniquely Open Conformation Re 0.923 0.960 0.717 1e-160
16930707383 At1g04870/F13M7_12 [Arabidopsis thaliana 0.923 0.942 0.717 1e-159
>gi|225445416|ref|XP_002285026.1| PREDICTED: probable protein arginine N-methyltransferase 4.2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/391 (77%), Positives = 334/391 (85%), Gaps = 10/391 (2%)

Query: 1   MGSHTNGVVSGDLAGSSNGGGGGGGGRGGGTATVDKEVDFANYFCTYAFLYHQKEMLSDR 60
           MGS   GV +GD   S NGGG            +DK VDFANYFCTYAFLYHQKEMLSDR
Sbjct: 1   MGSSAPGV-AGDRTASINGGGA---------TVIDKGVDFANYFCTYAFLYHQKEMLSDR 50

Query: 61  VRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLV 120
           VRMDAY+N+IF+NKHHF+GK VLDVGTGSGILAIWSAQAGARKVYAVEATKMS+HAR LV
Sbjct: 51  VRMDAYYNAIFENKHHFRGKAVLDVGTGSGILAIWSAQAGARKVYAVEATKMSEHARELV 110

Query: 121 KANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVM 180
           KANNLQD+VEVIEGSVED+ LPEKVDVIISEWMGYFLLRESMFDSVI ARDRWLKPTGVM
Sbjct: 111 KANNLQDIVEVIEGSVEDVTLPEKVDVIISEWMGYFLLRESMFDSVISARDRWLKPTGVM 170

Query: 181 YPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKY 240
           YPSHARMW+APIRSGL DQK+ DYEG+++DW  F+ ETK  YGVDMSVLTKPFSEEQ+KY
Sbjct: 171 YPSHARMWMAPIRSGLVDQKKNDYEGSMNDWLCFVNETKNDYGVDMSVLTKPFSEEQRKY 230

Query: 241 YLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWF 300
           YLQTSLW+NLHP QV+GTAA++K IDC TATVDDI EVRS F SSI  E TRLCGF GWF
Sbjct: 231 YLQTSLWNNLHPHQVVGTAAIIKEIDCLTATVDDICEVRSNFSSSILIENTRLCGFGGWF 290

Query: 301 DVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKE 360
           DVHFRG +++PAQQEIELTTAPS  + THWGQQVFL  P  R SEGDD+NVSF M RSKE
Sbjct: 291 DVHFRGRSDNPAQQEIELTTAPSLDSSTHWGQQVFLLHPPFRTSEGDDVNVSFLMNRSKE 350

Query: 361 NHRLLEVEFSCEIRESTGQILPPIKNKFYIE 391
           NHRL+EV+  CEIR+S+G++LP  KNKFYIE
Sbjct: 351 NHRLMEVDLGCEIRQSSGKLLPLFKNKFYIE 381

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224114359|ref|XP_002332378.1| hypothetical protein POPTRDRAFT_746911 [Populus trichocarpa] gi|222832202|gb|EEE70679.1| hypothetical protein POPTRDRAFT_746911 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449464586|ref|XP_004150010.1| PREDICTED: probable protein arginine N-methyltransferase 4.2-like [Cucumis sativus] gi|449525602|ref|XP_004169805.1| PREDICTED: probable protein arginine N-methyltransferase 4.2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363806714|ref|NP_001242269.1| uncharacterized protein LOC100790625 [Glycine max] gi|255644892|gb|ACU22946.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356508346|ref|XP_003522918.1| PREDICTED: probable protein arginine N-methyltransferase 4.2-like [Glycine max] Back     alignment and taxonomy information
>gi|297738912|emb|CBI28157.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297848734|ref|XP_002892248.1| arginine N-methyltransferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338090|gb|EFH68507.1| arginine N-methyltransferase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18390448|ref|NP_563720.1| putative protein arginine N-methyltransferase 4.2 [Arabidopsis thaliana] gi|75336166|sp|Q9MAT5.1|ANM10_ARATH RecName: Full=Protein arginine N-methyltransferase PRMT10 gi|7211979|gb|AAF40450.1|AC004809_8 Similar to protein arginine N-methyltransferase from Rattus norvegicus gb|U60882. ESTs gb|Z30908 and gb|Z29205 come from this gene [Arabidopsis thaliana] gi|22135775|gb|AAM91044.1| At1g04870/F13M7_12 [Arabidopsis thaliana] gi|332189633|gb|AEE27754.1| putative protein arginine N-methyltransferase 4.2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|353251757|pdb|3R0Q|C Chain C, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 gi|353251758|pdb|3R0Q|G Chain G, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 gi|353251759|pdb|3R0Q|A Chain A, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 gi|353251760|pdb|3R0Q|E Chain E, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 Back     alignment and taxonomy information
>gi|16930707|gb|AAL32019.1|AF436837_1 At1g04870/F13M7_12 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
TAIR|locus:2010607383 PRMT10 "protein arginine methy 0.923 0.942 0.717 1.2e-145
TAIR|locus:2087540435 PRMT6 "protein arginine methyl 0.455 0.409 0.484 3.5e-58
ZFIN|ZDB-GENE-030131-693378 prmt1 "protein arginine methyl 0.445 0.460 0.468 4.7e-50
UNIPROTKB|Q6VRB0351 prmt1-b "Protein arginine N-me 0.445 0.495 0.468 1.6e-49
UNIPROTKB|Q28F07351 prmt1 "Protein arginine N-meth 0.445 0.495 0.468 3.3e-49
UNIPROTKB|Q8AV13369 prmt1-a "Protein arginine N-me 0.445 0.471 0.462 5.3e-49
FB|FBgn0037834376 Art1 "Arginine methyltransfera 0.478 0.497 0.438 2.9e-48
UNIPROTKB|F1SKY6379 PRMT8 "Uncharacterized protein 0.445 0.459 0.441 3.7e-48
ZFIN|ZDB-GENE-041105-1512 prmt3 "protein arginine methyl 0.455 0.347 0.437 3.7e-48
UNIPROTKB|E2QWI7376 PRMT6 "Uncharacterized protein 0.800 0.832 0.386 6e-48
TAIR|locus:2010607 PRMT10 "protein arginine methyltransferase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1423 (506.0 bits), Expect = 1.2e-145, P = 1.2e-145
 Identities = 259/361 (71%), Positives = 306/361 (84%)

Query:    31 TATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSG 90
             +A VDKEVD+A YFCTY+FLYHQK+MLSDRVRMDAYFN++FQNKHHF+GKTVLDVGTGSG
Sbjct:    23 SAPVDKEVDYAQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSG 82

Query:    91 ILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIIS 150
             ILAIWSAQAGARKVYAVEATKM+DHAR LVKANNL  +VEVIEGSVEDI LPEKVDVIIS
Sbjct:    83 ILAIWSAQAGARKVYAVEATKMADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIIS 142

Query:   151 EWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDD 210
             EWMGYFLLRESMFDSVI ARDRWLKPTGVMYPSHARMW+API+S + D+K+ D++GA+ D
Sbjct:   143 EWMGYFLLRESMFDSVISARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMAD 202

Query:   211 WYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTA 270
             W++F  E K+YYGVDM VLTKPF+EEQ+KYY+QT++W++L+P Q+IGT  +VK +DC TA
Sbjct:   203 WHNFSDEIKSYYGVDMGVLTKPFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTA 262

Query:   271 TVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHW 330
             +V +I EVRS   S I  E TRLCGF GWFDV F G  EDPAQQEIELTTAPS  + THW
Sbjct:   263 SVSEIEEVRSNVTSVINMEHTRLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHW 322

Query:   331 GQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYI 390
             GQQVF+    + V EGD+LN+   M+RSKENHRL+E+E +CEI+E++G      K  ++I
Sbjct:   323 GQQVFIMSNPINVEEGDNLNLGLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFI 382

Query:   391 E 391
             E
Sbjct:   383 E 383
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA;ISS
GO:0008469 "histone-arginine N-methyltransferase activity" evidence=IDA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IGI;IMP
GO:0016277 "[myelin basic protein
GO:0019919 "peptidyl-arginine methylation, to asymmetrical-dimethyl arginine" evidence=IDA
GO:0035241 "protein-arginine omega-N monomethyltransferase activity" evidence=IDA
GO:0035242 "protein-arginine omega-N asymmetric methyltransferase activity" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2087540 PRMT6 "protein arginine methyltransferase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-693 prmt1 "protein arginine methyltransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VRB0 prmt1-b "Protein arginine N-methyltransferase 1-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q28F07 prmt1 "Protein arginine N-methyltransferase 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q8AV13 prmt1-a "Protein arginine N-methyltransferase 1-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
FB|FBgn0037834 Art1 "Arginine methyltransferase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKY6 PRMT8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041105-1 prmt3 "protein arginine methyltransferase 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWI7 PRMT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MAT5ANM10_ARATH2, ., 1, ., 1, ., -0.71740.92320.9425yesno
A2Y953ANM10_ORYSI2, ., 1, ., 1, ., -0.68610.92070.9424N/Ano
Q9SNQ2ANM10_ORYSJ2, ., 1, ., 1, ., -0.68610.92070.9473yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.766
4th Layer2.1.1.1250.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016844001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (381 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00021307001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (586 aa)
   •    0.423
GSVIVG00021672001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (315 aa)
   •    0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 2e-13
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 2e-11
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 1e-09
COG4076252 COG4076, COG4076, Predicted RNA methylase [General 8e-09
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 9e-09
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 9e-09
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 1e-08
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-m 2e-08
COG2263198 COG2263, COG2263, Predicted RNA methylase [Transla 3e-08
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 5e-08
pfam05185445 pfam05185, PRMT5, PRMT5 arginine-N-methyltransfera 6e-08
TIGR00406288 TIGR00406, prmA, ribosomal protein L11 methyltrans 9e-08
COG0742187 COG0742, COG0742, N6-adenine-specific methylase [D 1e-07
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 2e-07
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 4e-07
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [G 5e-07
COG2520341 COG2520, COG2520, Predicted methyltransferase [Gen 6e-07
pfam05175170 pfam05175, MTS, Methyltransferase small domain 7e-07
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 8e-07
pfam03602183 pfam03602, Cons_hypoth95, Conserved hypothetical p 1e-06
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 1e-06
COG2230283 COG2230, Cfa, Cyclopropane fatty acid synthase and 2e-06
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 3e-06
COG2521287 COG2521, COG2521, Predicted archaeal methyltransfe 5e-06
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 1e-05
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 1e-05
pfam02475199 pfam02475, Met_10, Met-10+ like-protein 2e-05
TIGR01983224 TIGR01983, UbiG, ubiquinone biosynthesis O-methylt 2e-05
PRK00107187 PRK00107, gidB, 16S rRNA methyltransferase GidB; R 2e-05
PRK05134233 PRK05134, PRK05134, bifunctional 3-demethylubiquin 4e-05
PRK14967223 PRK14967, PRK14967, putative methyltransferase; Pr 4e-05
TIGR03533284 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) m 8e-05
COG3897218 COG3897, COG3897, Predicted methyltransferase [Gen 8e-05
TIGR00138181 TIGR00138, gidB, 16S rRNA (guanine(527)-N(7))-meth 9e-05
TIGR01444144 TIGR01444, fkbM_fam, methyltransferase, FkbM famil 9e-05
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 9e-05
TIGR00095190 TIGR00095, TIGR00095, RNA methyltransferase, RsmD 1e-04
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 1e-04
COG0357215 COG0357, GidB, Predicted S-adenosylmethionine-depe 4e-04
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 4e-04
pfam02527184 pfam02527, GidB, rRNA small subunit methyltransfer 5e-04
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Trans 0.001
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 0.002
PRK11805307 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-meth 0.003
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [S 0.003
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information 
 Score = 65.5 bits (160), Expect = 2e-13
 Identities = 37/104 (35%), Positives = 51/104 (49%), Gaps = 6/104 (5%)

Query: 81  TVLDVGTGSGILAIWSAQAGARKVYAVEAT-KMSDHARTLVKANNLQDVVEVIEGSVEDI 139
            VLD+G G+G LA+  A     +V  V+ +    + AR    A  L D VEV++G  E++
Sbjct: 1   RVLDLGCGTGALALALASGPGARVTGVDISPVALELARK-AAAALLADNVEVLKGDAEEL 59

Query: 140 VL--PEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMY 181
                E  DVIIS       L E +   +  AR R LKP GV+ 
Sbjct: 60  PPEADESFDVIIS-DPPLHHLVEDLARFLEEAR-RLLKPGGVLV 101

There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.). Length = 107
>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|226562 COG4076, COG4076, Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225137 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|218484 pfam05185, PRMT5, PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase Back     alignment and domain information
>gnl|CDD|223813 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|226608 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225318 COG2520, COG2520, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|202698 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95 Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225139 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225319 COG2521, COG2521, Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|202251 pfam02475, Met_10, Met-10+ like-protein Back     alignment and domain information
>gnl|CDD|233668 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>gnl|CDD|234637 PRK00107, gidB, 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>gnl|CDD|235350 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>gnl|CDD|184931 PRK14967, PRK14967, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234247 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>gnl|CDD|226413 COG3897, COG3897, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|211555 TIGR00138, gidB, 16S rRNA (guanine(527)-N(7))-methyltransferase GidB Back     alignment and domain information
>gnl|CDD|233415 TIGR01444, fkbM_fam, methyltransferase, FkbM family Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|188022 TIGR00095, TIGR00095, RNA methyltransferase, RsmD family Back     alignment and domain information
>gnl|CDD|233708 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|223434 COG0357, GidB, Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|217086 pfam02527, GidB, rRNA small subunit methyltransferase G Back     alignment and domain information
>gnl|CDD|225370 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|236988 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 391
KOG1499346 consensus Protein arginine N-methyltransferase PRM 100.0
KOG1500517 consensus Protein arginine N-methyltransferase CAR 100.0
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 100.0
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 99.98
PTZ003571072 methyltransferase; Provisional 99.94
KOG1501 636 consensus Arginine N-methyltransferase [General fu 99.9
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.78
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.73
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.72
PLN02233261 ubiquinone biosynthesis methyltransferase 99.68
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.65
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.64
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.62
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.61
PRK11207197 tellurite resistance protein TehB; Provisional 99.61
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.6
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.59
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.58
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.57
PLN02244340 tocopherol O-methyltransferase 99.57
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.57
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.56
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.56
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.55
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.55
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.55
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.54
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.53
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.53
TIGR00452314 methyltransferase, putative. Known examples to dat 99.52
COG4076252 Predicted RNA methylase [General function predicti 99.51
COG4123248 Predicted O-methyltransferase [General function pr 99.51
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.51
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.5
PRK12335287 tellurite resistance protein TehB; Provisional 99.5
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.46
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.46
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.45
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.45
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.44
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.44
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.44
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.43
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.43
PRK14967223 putative methyltransferase; Provisional 99.43
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.43
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.42
PLN02490340 MPBQ/MSBQ methyltransferase 99.42
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.42
PRK05785226 hypothetical protein; Provisional 99.42
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.42
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.41
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.41
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.41
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.4
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.4
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.39
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.39
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.39
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.38
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.38
KOG1271227 consensus Methyltransferases [General function pre 99.37
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.36
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.36
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.36
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.36
PLN02336475 phosphoethanolamine N-methyltransferase 99.35
PRK06922677 hypothetical protein; Provisional 99.34
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.34
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.33
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.32
KOG4300252 consensus Predicted methyltransferase [General fun 99.32
PRK08317241 hypothetical protein; Provisional 99.32
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.31
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.31
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.31
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.31
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.31
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.31
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.3
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.3
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.3
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.3
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.28
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.28
PRK14968188 putative methyltransferase; Provisional 99.28
PRK04266226 fibrillarin; Provisional 99.28
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.28
PRK07402196 precorrin-6B methylase; Provisional 99.27
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.27
COG2890280 HemK Methylase of polypeptide chain release factor 99.27
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.26
PLN03075296 nicotianamine synthase; Provisional 99.26
PLN02336 475 phosphoethanolamine N-methyltransferase 99.25
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.25
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.25
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.25
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.24
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.24
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.24
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.23
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.23
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.23
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.21
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.21
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.21
PHA03412241 putative methyltransferase; Provisional 99.19
PRK04457262 spermidine synthase; Provisional 99.19
PRK14904445 16S rRNA methyltransferase B; Provisional 99.19
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.19
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.19
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.19
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.17
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.17
PTZ00146293 fibrillarin; Provisional 99.17
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.17
PRK06202232 hypothetical protein; Provisional 99.17
PRK10901427 16S rRNA methyltransferase B; Provisional 99.16
PRK14902444 16S rRNA methyltransferase B; Provisional 99.16
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.16
PRK14903431 16S rRNA methyltransferase B; Provisional 99.16
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.16
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.15
PRK14901434 16S rRNA methyltransferase B; Provisional 99.15
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.15
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.15
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.14
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.13
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.13
PRK00811283 spermidine synthase; Provisional 99.13
TIGR03438301 probable methyltransferase. This model represents 99.13
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.12
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.11
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.11
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.1
KOG2904328 consensus Predicted methyltransferase [General fun 99.1
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.09
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 99.07
PLN02476278 O-methyltransferase 99.07
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.06
PLN02672 1082 methionine S-methyltransferase 99.05
PHA03411279 putative methyltransferase; Provisional 99.04
COG4122219 Predicted O-methyltransferase [General function pr 99.03
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 99.03
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.03
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.0
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.98
PLN02366308 spermidine synthase 98.97
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.97
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.97
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.97
TIGR00438188 rrmJ cell division protein FtsJ. 98.96
KOG2899288 consensus Predicted methyltransferase [General fun 98.94
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.93
PLN02589247 caffeoyl-CoA O-methyltransferase 98.92
PRK01581374 speE spermidine synthase; Validated 98.92
PRK03612521 spermidine synthase; Provisional 98.91
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.89
KOG3010261 consensus Methyltransferase [General function pred 98.89
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.87
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.86
COG1041347 Predicted DNA modification methylase [DNA replicat 98.85
KOG1501636 consensus Arginine N-methyltransferase [General fu 98.84
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.84
KOG2361264 consensus Predicted methyltransferase [General fun 98.83
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.83
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.82
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.82
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.81
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.79
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.77
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.76
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.76
COG2521287 Predicted archaeal methyltransferase [General func 98.75
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.72
COG2520341 Predicted methyltransferase [General function pred 98.71
PRK04148134 hypothetical protein; Provisional 98.7
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.69
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.69
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 98.68
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.68
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.67
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.66
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.66
PLN02823336 spermine synthase 98.66
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.65
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.65
COG3897218 Predicted methyltransferase [General function pred 98.65
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.64
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.63
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.6
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.58
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.58
PLN02232160 ubiquinone biosynthesis methyltransferase 98.57
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.56
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.55
KOG2940325 consensus Predicted methyltransferase [General fun 98.51
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.51
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 98.5
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.49
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.49
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 98.48
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.48
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.47
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.43
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.43
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.42
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.41
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.41
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.4
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.37
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.31
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 98.31
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 98.28
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 98.26
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 98.23
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.23
PRK00536262 speE spermidine synthase; Provisional 98.14
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.13
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.12
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 98.11
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.1
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.09
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 98.07
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.06
PF13679141 Methyltransf_32: Methyltransferase domain 98.05
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.97
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.93
PRK10742250 putative methyltransferase; Provisional 97.93
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.89
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.89
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.88
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.87
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.86
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.85
PHA01634156 hypothetical protein 97.85
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.8
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.78
KOG2730263 consensus Methylase [General function prediction o 97.75
KOG3201201 consensus Uncharacterized conserved protein [Funct 97.74
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.73
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.71
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.67
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.66
COG4262508 Predicted spermidine synthase with an N-terminal m 97.6
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.53
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.49
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 97.47
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.4
KOG4058199 consensus Uncharacterized conserved protein [Funct 97.4
COG2384226 Predicted SAM-dependent methyltransferase [General 97.29
KOG1709271 consensus Guanidinoacetate methyltransferase and r 97.23
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 97.22
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.18
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.16
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 97.13
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 97.12
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.12
KOG1227351 consensus Putative methyltransferase [General func 97.04
KOG3987288 consensus Uncharacterized conserved protein DREV/C 97.02
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 97.0
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 96.99
COG5459484 Predicted rRNA methylase [Translation, ribosomal s 96.96
KOG1331293 consensus Predicted methyltransferase [General fun 96.84
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 96.81
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 96.74
KOG2671421 consensus Putative RNA methylase [Replication, rec 96.59
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 96.59
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.58
KOG1099294 consensus SAM-dependent methyltransferase/cell div 96.47
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 96.41
COG4798238 Predicted methyltransferase [General function pred 96.37
KOG2920282 consensus Predicted methyltransferase [General fun 96.29
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 96.15
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 95.96
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 95.87
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 95.79
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.68
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 95.64
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.5
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 95.45
KOG1562337 consensus Spermidine synthase [Amino acid transpor 95.1
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 94.95
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 94.94
COG1568354 Predicted methyltransferases [General function pre 94.94
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 94.76
COG3129292 Predicted SAM-dependent methyltransferase [General 94.65
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.59
KOG3115249 consensus Methyltransferase-like protein [General 94.55
KOG2078495 consensus tRNA modification enzyme [RNA processing 94.54
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 94.38
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 94.02
PRK11524284 putative methyltransferase; Provisional 93.74
PF05711248 TylF: Macrocin-O-methyltransferase (TylF); InterPr 93.65
PF00145335 DNA_methylase: C-5 cytosine-specific DNA methylase 93.57
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 93.53
PF03269177 DUF268: Caenorhabditis protein of unknown function 93.38
PRK13699227 putative methylase; Provisional 93.17
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 93.11
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 92.6
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 92.43
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 92.37
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 92.35
TIGR00027260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 92.15
KOG2198375 consensus tRNA cytosine-5-methylases and related e 92.05
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 92.04
TIGR00675315 dcm DNA-methyltransferase (dcm). All proteins in t 91.93
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 91.82
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 91.71
COG0286489 HsdM Type I restriction-modification system methyl 91.66
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 91.42
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 91.28
KOG0821326 consensus Predicted ribosomal RNA adenine dimethyl 91.13
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 90.94
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 90.54
PLN02740381 Alcohol dehydrogenase-like 90.21
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 90.14
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 90.02
PRK11524284 putative methyltransferase; Provisional 89.82
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 89.73
KOG2651476 consensus rRNA adenine N-6-methyltransferase [RNA 89.62
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 89.53
COG0270328 Dcm Site-specific DNA methylase [DNA replication, 89.46
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 88.97
KOG2912419 consensus Predicted DNA methylase [Function unknow 88.96
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 88.92
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 88.86
KOG3924419 consensus Putative protein methyltransferase invol 88.62
PF05206259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 88.52
PRK13699227 putative methylase; Provisional 87.97
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 87.79
PRK05854313 short chain dehydrogenase; Provisional 87.77
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 87.33
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 87.22
PRK10458467 DNA cytosine methylase; Provisional 87.09
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 86.97
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 86.71
PLN02827378 Alcohol dehydrogenase-like 86.5
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 86.24
COG2933358 Predicted SAM-dependent methyltransferase [General 86.17
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 86.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 85.93
COG1255129 Uncharacterized protein conserved in archaea [Func 85.41
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 85.13
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 85.03
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 85.01
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 85.01
COG4301321 Uncharacterized conserved protein [Function unknow 84.85
PF04072183 LCM: Leucine carboxyl methyltransferase; InterPro: 84.3
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 84.18
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 83.71
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 83.68
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 83.56
PF06460299 NSP13: Coronavirus NSP13; InterPro: IPR009461 This 83.37
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 82.8
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 82.46
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 82.45
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 82.42
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 82.35
COG1565370 Uncharacterized conserved protein [Function unknow 82.3
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 82.2
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 81.91
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 81.89
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.59
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 81.38
PLN02586360 probable cinnamyl alcohol dehydrogenase 81.34
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 81.29
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 81.22
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 81.11
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 80.65
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 80.56
PRK06139330 short chain dehydrogenase; Provisional 80.13
PRK07063260 short chain dehydrogenase; Provisional 80.02
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 80.01
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-62  Score=448.99  Aligned_cols=325  Identities=42%  Similarity=0.709  Sum_probs=297.1

Q ss_pred             cccchhhhhhhhhhhhhHhhcCChHhHHHHHHHHHhcCCCCCCCEEEEECCcccHHHHHHHHcCCCeEEEEechHHHHHH
Q 016314           37 EVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHA  116 (391)
Q Consensus        37 ~~~~~~y~~~~~~~~~~~~~l~d~~r~~~~~~~i~~~~~~~~~~~VLDlGcG~G~ls~~~a~~g~~~V~avD~s~~~~~a  116 (391)
                      ....+.||++|+.+..|+.||+|.+|+.+|+.+|.++...+++++|||+|||||++++++|++|+++|+|||.|.+++.|
T Consensus        19 ~~~~~~Yf~sY~~~~iheeML~D~VRt~aYr~~i~~n~~lf~dK~VlDVGcGtGILS~F~akAGA~~V~aVe~S~ia~~a   98 (346)
T KOG1499|consen   19 MTSDDYYFDSYAHFGIHEEMLKDSVRTLAYRNAILQNKHLFKDKTVLDVGCGTGILSMFAAKAGARKVYAVEASSIADFA   98 (346)
T ss_pred             cchhhhhhhhhhchHHHHHHHhhhhhHHHHHHHHhcchhhcCCCEEEEcCCCccHHHHHHHHhCcceEEEEechHHHHHH
Confidence            34667899999999999999999999999999999998899999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCCcEEEEEcccccCCCC-CcccEEEEccccccccCcchHHHHHHHHhccccCCeEEEcccceeEEeecccC
Q 016314          117 RTLVKANNLQDVVEVIEGSVEDIVLP-EKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSG  195 (391)
Q Consensus       117 ~~~~~~~~~~~~v~~~~~d~~~~~~~-~~~D~Ivs~~~~~~l~~e~~~~~~l~~~~~~LkpgG~~i~~~~~~~~~~~~~~  195 (391)
                      ++.+..|++++.|+++++.++++.+| +++|+|+||||||++..|.++++++.+..++|+|||.++|+.++++++++.+.
T Consensus        99 ~~iv~~N~~~~ii~vi~gkvEdi~LP~eKVDiIvSEWMGy~Ll~EsMldsVl~ARdkwL~~~G~i~P~~a~l~l~~i~d~  178 (346)
T KOG1499|consen   99 RKIVKDNGLEDVITVIKGKVEDIELPVEKVDIIVSEWMGYFLLYESMLDSVLYARDKWLKEGGLIYPDRATLYLAAIEDD  178 (346)
T ss_pred             HHHHHhcCccceEEEeecceEEEecCccceeEEeehhhhHHHHHhhhhhhhhhhhhhccCCCceEccccceEEEEeccCc
Confidence            99999999999999999999999999 99999999999999999999999999999999999999999999999999875


Q ss_pred             cCccchhhccccccchhhhhhcCccccccccccCCCcchhhhhhhhcccCceeecCCCCccccceeEEEEEcCCCCcccc
Q 016314          196 LGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDI  275 (391)
Q Consensus       196 ~~~~~~~~~~~~~~~w~~~~~~~~~~~g~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~p~~~~~~dl~~~~~~~~  275 (391)
                      .      ...+.+.+|+       ++|||||+++.+        ....++.++.+.+++++++|+.+.++|+.++..+++
T Consensus       179 ~------~~~~~i~fW~-------~Vygfdms~~~~--------~~~~e~lv~vv~~~~l~t~~~~i~~~Dl~t~~i~d~  237 (346)
T KOG1499|consen  179 S------YKDDKIGFWD-------DVYGFDMSCIKK--------IAIKEPLVDVVDPEQLLTEPCLIKEFDLYTVKIEDL  237 (346)
T ss_pred             h------hhhhhcCccc-------cccccchhhhhh--------hhhcccceeccChhHhcccceeeEEeeeeeeeccce
Confidence            2      3456678895       999999999954        344568899999999999999999999999999999


Q ss_pred             cceeeEEEEEEEecCceeEEEEEEEEeeecCCCCCCCCCcEEEecCCCCCCCCCccceEEecCCccccCCCCEEEEEEEE
Q 016314          276 REVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSM  355 (391)
Q Consensus       276 ~~~~~~~~~~~~~~~g~~~g~~~wf~~~l~~~~~~~~~~~i~lst~P~~~~~~hW~q~~~~l~~p~~v~~g~~l~~~~~~  355 (391)
                       .++..|++.++ +++.+|||++|||+.|....   +...+.+||+|. .+.|||+|+||.|+.|+.|+.|+.|.+++.+
T Consensus       238 -~F~s~f~l~v~-r~~~i~g~v~yFDv~F~~~~---~~~~~~fST~P~-~p~THWKQtVfyl~~p~~v~~ge~i~g~it~  311 (346)
T KOG1499|consen  238 -SFTSPFKLKVT-RNGYLHAFVAYFDVEFTGCH---GKKRLGFSTSPS-SPYTHWKQTVFYLENPLTVKEGEDITGTITM  311 (346)
T ss_pred             -eeccceEEEEc-cCceEEEEEEEEEEeeccCC---CCCcceeecCCC-CCCceeeeEEEEecCccceecCceEEEEEEE
Confidence             69999999999 99999999999999997651   126799999995 8999999999999999999999999999999


Q ss_pred             EeCCCCCeeeEEEEEEEEeccccccCCcccceee
Q 016314          356 TRSKENHRLLEVEFSCEIRESTGQILPPIKNKFY  389 (391)
Q Consensus       356 ~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~  389 (391)
                      .++.+|+|.+++.+.|+.++. +..-+...++|-
T Consensus       312 ~~~~~~~R~l~~~l~~~~~~~-~~~~~~~~~~y~  344 (346)
T KOG1499|consen  312 KPNKKNNRDLDISLSLNFKGQ-GLCSFSESDSYP  344 (346)
T ss_pred             eeCCCCCccceEEEEEecCCc-cccccccccccc
Confidence            999999999999999999998 443444444443

>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF05711 TylF: Macrocin-O-methyltransferase (TylF); InterPro: IPR008884 This family consists of bacterial macrocin O-methyltransferase (TylF) proteins Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>KOG0821 consensus Predicted ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>KOG2912 consensus Predicted DNA methylase [Function unknown] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG3924 consensus Putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1) [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
3r0q_C376 A Uniquely Open Conformation Revealed In The Crysta 1e-163
1ori_A343 Structure Of The Predominant Protein Arginine Methy 2e-50
1or8_A340 Structure Of The Predominant Protein Arginine Methy 2e-50
4hc4_A376 Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 ( 4e-50
1orh_A353 Structure Of The Predominant Protein Arginine Methy 4e-50
3q7e_A349 Crystal Structure Of Rat Protein Arginine Methyltra 7e-50
2fyt_A340 Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerev 1e-47
1f3l_A321 Crystal Structure Of The Conserved Core Of Protein 9e-47
2y1w_A348 Crystal Structure Of Coactivator Associated Arginin 5e-46
3b3f_A341 The 2.2 A Crystal Structure Of The Catalytic Domain 5e-46
4ikp_A341 Crystal Structure Of Coactivator-associated Arginin 5e-46
2v74_B346 Crystal Structure Of Coactivator-Associated Arginin 7e-46
3b3j_A480 The 2.55 A Crystal Structure Of The Apo Catalytic D 7e-46
1g6q_1328 Crystal Structure Of Yeast Arginine Methyltransfera 3e-40
3g5l_A253 Crystal Structure Of Putative S-Adenosylmethionine 2e-05
>pdb|3R0Q|C Chain C, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 Length = 376 Back     alignment and structure 
Iteration: 1

 Score =  569 bits (1467), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 259/361 (71%), Positives = 306/361 (84%)
Query: 31  TATVDKEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSG 90
           +A VDKEVD+A YFCTY+FLYHQK+MLSDRVRMDAYFN++FQNKHHF+GKTVLDVGTGSG
Sbjct: 16  SAPVDKEVDYAQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSG 75
Query: 91  ILAIWSAQAGARKVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIIS 150
           ILAIWSAQAGARKVYAVEATKM+DHAR LVKANNL  +VEVIEGSVEDI LPEKVDVIIS
Sbjct: 76  ILAIWSAQAGARKVYAVEATKMADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIIS 135
Query: 151 EWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDD 210
           EWMGYFLLRESMFDSVI ARDRWLKPTGVMYPSHARMW+API+S + D+K+ D++GA+ D
Sbjct: 136 EWMGYFLLRESMFDSVISARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMAD 195
Query: 211 WYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTA 270
           W++F  E K+YYGVDM VLTKPF+EEQ+KYY+QT++W++L+P Q+IGT  +VK +DC TA
Sbjct: 196 WHNFSDEIKSYYGVDMGVLTKPFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTA 255
Query: 271 TVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHW 330
           +V +I EVRS   S I  E TRLCGF GWFDV F G  EDPAQQEIELTTAPS  + THW
Sbjct: 256 SVSEIEEVRSNVTSVINMEHTRLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHW 315
Query: 331 GQQVFLFRPSVRVSEGDDLNVSFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYI 390
           GQQVF+    + V EGD+LN+   M+RSKENHRL+E+E +CEI+E++G      K  ++I
Sbjct: 316 GQQVFIMSNPINVEEGDNLNLGLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFI 375
Query: 391 E 391
           E
Sbjct: 376 E 376
>pdb|1ORI|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 343 Back     alignment and structure
>pdb|1OR8|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 340 Back     alignment and structure
>pdb|4HC4|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 (S. Cerevisiae) Length = 376 Back     alignment and structure
>pdb|1ORH|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 353 Back     alignment and structure
>pdb|3Q7E|A Chain A, Crystal Structure Of Rat Protein Arginine Methyltransferase 1 (Prmt1) M48l Mutant Length = 349 Back     alignment and structure
>pdb|2FYT|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerevisiae) Protein Length = 340 Back     alignment and structure
>pdb|1F3L|A Chain A, Crystal Structure Of The Conserved Core Of Protein Arginine Methyltransferase Prmt3 Length = 321 Back     alignment and structure
>pdb|2Y1W|A Chain A, Crystal Structure Of Coactivator Associated Arginine Methyltransferase 1 (Carm1) In Complex With Sinefungin And Indole Inhibitor Length = 348 Back     alignment and structure
>pdb|3B3F|A Chain A, The 2.2 A Crystal Structure Of The Catalytic Domain Of Coactivator- Associated Arginine Methyl Transferase I(Carm1,142-478), In Complex With S-Adenosyl Homocysteine Length = 341 Back     alignment and structure
>pdb|4IKP|A Chain A, Crystal Structure Of Coactivator-associated Arginine Methyltransferase 1 Length = 341 Back     alignment and structure
>pdb|2V74|B Chain B, Crystal Structure Of Coactivator-Associated Arginine Methyltransferase 1 (Carm1), In Complex With S-Adenosyl- Homocysteine Length = 346 Back     alignment and structure
>pdb|3B3J|A Chain A, The 2.55 A Crystal Structure Of The Apo Catalytic Domain Of Coactivator-Associated Arginine Methyl Transferase I(Carm1:28-507, Residues 28-146 And 479-507 Not Ordered) Length = 480 Back     alignment and structure
>pdb|1G6Q|1 Chain 1, Crystal Structure Of Yeast Arginine Methyltransferase, Hmt1 Length = 328 Back     alignment and structure
>pdb|3G5L|A Chain A, Crystal Structure Of Putative S-Adenosylmethionine Dependent Methyltransferase From Listeria Monocytogenes Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 100.0
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 100.0
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 100.0
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 100.0
2fyt_A340 Protein arginine N-methyltransferase 3; structural 100.0
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 100.0
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 100.0
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 100.0
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 100.0
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.65
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.64
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.64
3f4k_A257 Putative methyltransferase; structural genomics, P 99.63
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.63
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.63
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.62
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.62
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.62
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.62
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.61
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.61
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.59
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.59
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.59
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.58
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.57
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.57
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.57
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.57
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.57
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.57
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.56
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.56
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.56
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.56
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.56
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.55
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.55
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.55
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.55
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.55
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.54
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.54
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.54
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.54
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.54
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.54
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.54
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.54
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.54
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.53
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.53
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.53
3lpm_A259 Putative methyltransferase; structural genomics, p 99.53
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.53
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.53
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.53
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.53
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.52
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.52
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.52
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.52
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.52
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.52
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.52
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.51
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.51
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.51
3ocj_A305 Putative exported protein; structural genomics, PS 99.51
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.51
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.51
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.51
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.5
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.5
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.5
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.5
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.49
3lcc_A235 Putative methyl chloride transferase; halide methy 99.49
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.49
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.49
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.48
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.48
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.47
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.47
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.47
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.47
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.47
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.46
3k6r_A278 Putative transferase PH0793; structural genomics, 99.46
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.46
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.45
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.45
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.45
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.45
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.45
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.45
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.45
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.44
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.44
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.44
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.44
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.44
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.44
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.44
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.44
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.44
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.44
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.43
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.43
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.43
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.43
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.43
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.43
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.43
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.43
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.43
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.42
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.42
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.42
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.42
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.42
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.42
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.42
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.41
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.41
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.41
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.4
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.4
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.4
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.39
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.39
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.39
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.39
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.39
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.39
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.38
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.38
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.38
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.38
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.37
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.37
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.37
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.37
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.37
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.36
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.36
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.36
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.36
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.36
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.36
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.35
2h00_A254 Methyltransferase 10 domain containing protein; st 99.35
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.35
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.35
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.34
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.34
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.34
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.34
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.34
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.34
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.33
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.33
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.33
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.33
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.32
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.32
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.32
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.32
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.31
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.31
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.3
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.3
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.3
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.3
2b25_A336 Hypothetical protein; structural genomics, methyl 99.3
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.29
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.29
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.29
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.29
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.29
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.29
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.28
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.28
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.28
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.28
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.27
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.27
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.27
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.27
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.26
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.26
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.26
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.26
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.26
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.26
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.25
3cc8_A230 Putative methyltransferase; structural genomics, j 99.25
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.25
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.25
2pt6_A321 Spermidine synthase; transferase, structural genom 99.25
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.25
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.25
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.25
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.24
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.23
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.23
2o07_A304 Spermidine synthase; structural genomics, structur 99.23
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.23
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.22
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.22
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.22
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.22
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.2
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.2
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.2
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.2
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.2
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.2
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.2
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.2
2i7c_A283 Spermidine synthase; transferase, structural genom 99.19
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.19
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.19
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.19
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.18
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.18
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.17
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.16
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.16
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.16
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.15
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.15
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.15
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.14
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.13
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.12
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.12
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.11
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.1
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.1
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.1
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.1
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.09
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.07
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.04
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.04
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.02
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.02
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.0
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.99
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.99
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.97
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.97
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.97
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.96
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.96
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.95
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.94
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.93
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.92
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.92
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.9
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.86
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.82
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.82
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.81
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.81
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.8
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.77
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.77
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.74
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.74
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.69
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.64
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.64
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 98.49
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.45
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 98.37
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 98.37
3lkd_A542 Type I restriction-modification system methyltrans 98.35
3khk_A544 Type I restriction-modification system methylation 98.32
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 98.29
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.2
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.17
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.17
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.17
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 98.15
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.07
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 98.01
2px2_A269 Genome polyprotein [contains: capsid protein C (co 98.01
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 97.94
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.93
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 97.75
2zig_A297 TTHA0409, putative modification methylase; methylt 97.7
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 97.69
3ufb_A530 Type I restriction-modification system methyltran 97.4
2oo3_A283 Protein involved in catabolism of external DNA; st 97.25
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 97.16
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.1
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 97.05
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 96.75
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 96.65
3g7u_A376 Cytosine-specific methyltransferase; DNA-binding, 96.5
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 96.45
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA me 96.43
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 96.19
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.02
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 95.86
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.39
3ubt_Y331 Modification methylase HAEIII; protein-DNA complex 95.23
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 95.2
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.08
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 95.02
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 94.98
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.9
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 94.83
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 94.7
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.69
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 94.68
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 94.67
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 94.51
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.49
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 94.46
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.23
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 94.09
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 93.9
4h0n_A333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 93.83
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 93.82
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 93.74
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 93.72
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 93.68
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 93.59
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.33
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 93.22
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 93.1
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 93.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.95
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 92.88
3fbg_A346 Putative arginate lyase; structural genomics, unkn 92.87
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 92.82
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.82
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 92.79
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.7
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 92.48
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 92.3
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 92.11
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 92.05
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 91.86
2zig_A297 TTHA0409, putative modification methylase; methylt 91.79
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.65
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 91.63
4eye_A342 Probable oxidoreductase; structural genomics, niai 91.48
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 91.13
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 91.08
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 91.02
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.94
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 90.92
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 90.85
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 90.78
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 90.73
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 90.59
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 90.59
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 90.55
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 90.5
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 90.33
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 90.1
3me5_A482 Cytosine-specific methyltransferase; structural ge 90.09
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 89.89
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 89.82
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 89.61
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 89.28
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 89.2
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 88.72
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 88.59
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 88.5
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 88.44
3iei_A334 Leucine carboxyl methyltransferase 1; LCMT-1, S-ad 88.38
3krt_A456 Crotonyl COA reductase; structural genomics, prote 88.16
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 88.01
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 87.86
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 87.82
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 87.73
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 87.71
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 86.96
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 86.96
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 86.9
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 86.73
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 86.69
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 86.6
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 86.52
3tjr_A301 Short chain dehydrogenase; structural genomics, se 86.3
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 85.88
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 85.74
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 85.6
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 85.51
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 85.37
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 85.35
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 84.9
3ius_A286 Uncharacterized conserved protein; APC63810, silic 84.88
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 84.86
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 84.62
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 84.61
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 84.48
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 84.38
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 84.25
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 83.85
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 83.75
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 83.59
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 83.57
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 83.51
3imf_A257 Short chain dehydrogenase; structural genomics, in 82.97
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 82.94
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 82.9
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 82.9
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 82.87
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 82.68
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 82.63
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 82.55
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 82.52
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 82.52
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 82.51
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 82.4
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 82.38
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 82.34
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 82.24
4f3n_A432 Uncharacterized ACR, COG1565 superfamily; structur 82.22
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 82.09
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 81.79
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 81.47
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 81.45
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 81.44
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 81.35
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 81.17
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 81.13
3tsc_A277 Putative oxidoreductase; structural genomics, seat 80.91
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 80.81
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 80.67
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 80.58
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 80.54
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 80.51
1zkd_A387 DUF185; NESG, RPR58, structural genomics, PSI, pro 80.43
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 80.21
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 80.03
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.1e-63  Score=474.59  Aligned_cols=326  Identities=37%  Similarity=0.598  Sum_probs=278.1

Q ss_pred             ccccchhhhhhhhhhhhhHhhcCChHhHHHHHHHHHhcCCCCCCCEEEEECCcccHHHHHHHHcCCCeEEEEechHHHHH
Q 016314           36 KEVDFANYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDH  115 (391)
Q Consensus        36 ~~~~~~~y~~~~~~~~~~~~~l~d~~r~~~~~~~i~~~~~~~~~~~VLDlGcG~G~ls~~~a~~g~~~V~avD~s~~~~~  115 (391)
                      ...++..||++|+++..|..||+|..|+.+|+++|.++...+++++|||||||+|+|++++|++|+++|+|||.|+|++.
T Consensus        41 ~~~~d~~Yf~sY~~~~iH~~ML~D~~Rt~aY~~Ai~~~~~~~~~k~VLDvG~GtGiLs~~Aa~aGA~~V~ave~s~~~~~  120 (376)
T 4hc4_A           41 KRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQ  120 (376)
T ss_dssp             --------CCCHHHHHHHHHHHHCHHHHHHHHHHHHTTHHHHTTCEEEEETCTTSHHHHHHHHTTCSEEEEEECSTTHHH
T ss_pred             cccchhhhhhhccCcHHHHHHhCCHHHHHHHHHHHHhCHHhcCCCEEEEeCCCccHHHHHHHHhCCCEEEEEeChHHHHH
Confidence            34566789999999999999999999999999999987767889999999999999999999999999999999988999


Q ss_pred             HHHHHHHcCCCCcEEEEEcccccCCCCCcccEEEEccccccccCcchHHHHHHHHhccccCCeEEEcccceeEEeecccC
Q 016314          116 ARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSG  195 (391)
Q Consensus       116 a~~~~~~~~~~~~v~~~~~d~~~~~~~~~~D~Ivs~~~~~~l~~e~~~~~~l~~~~~~LkpgG~~i~~~~~~~~~~~~~~  195 (391)
                      |+++++.|++.++|++++++++++.+|+++|+||||++++++.+|.+++.++.++.++|+|||.++|..+++|++|+++.
T Consensus       121 a~~~~~~n~~~~~i~~i~~~~~~~~lpe~~DvivsE~~~~~l~~e~~l~~~l~a~~r~Lkp~G~~iP~~atly~apie~~  200 (376)
T 4hc4_A          121 AREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVPISDQ  200 (376)
T ss_dssp             HHHHHHHTTCTTTEEEEESCTTTCCCSSCEEEEECCCCBTTBTTTCSHHHHHHHHHHHEEEEEEEESCEEEEEEEEECCH
T ss_pred             HHHHHHHcCCCceEEEEeeeeeeecCCccccEEEeecccccccccchhhhHHHHHHhhCCCCceECCccceEEEEEeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999863


Q ss_pred             cCccchhhccccccchhhhhhcCccccccccccCCCcchhhhhhhhcccCceeecCCCCccccceeEEEEEcCCCCcccc
Q 016314          196 LGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDI  275 (391)
Q Consensus       196 ~~~~~~~~~~~~~~~w~~~~~~~~~~~g~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~p~~~~~~dl~~~~~~~~  275 (391)
                      .       ....+.+|...    ...|||||+++.......  .....++.++.+.+.+++++|+.+++|||.++..++.
T Consensus       201 ~-------l~~~i~~w~~v----~~~yGfd~s~~~~~~~~~--~~~~~e~~v~~~~~~~~Ls~p~~i~~~D~~~~~~~~~  267 (376)
T 4hc4_A          201 M-------LEWRLGFWSQV----KQHYGVDMSCLEGFATRC--LMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQE  267 (376)
T ss_dssp             H-------HHHHHHGGGGH----HHHHSCCCGGGHHHHHHH--HHSSCEEEEECCCGGGBCSCCEEEEEEETTCTTHHHH
T ss_pred             h-------hhhhhcchhcc----ccccCcCchhhhhhhhhh--hcccCceEEEeecccccccCCEEEEEEECCCCCcccc
Confidence            2       22345667532    345999999984322111  1111357788888899999999999999999876532


Q ss_pred             c--ceeeEEEEEEEecCceeEEEEEEEEeeecCCCCCCCCCcEEEecCCCCCCCCCccceEEecCCccccCCCCEEEEEE
Q 016314          276 R--EVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSF  353 (391)
Q Consensus       276 ~--~~~~~~~~~~~~~~g~~~g~~~wf~~~l~~~~~~~~~~~i~lst~P~~~~~~hW~q~~~~l~~p~~v~~g~~l~~~~  353 (391)
                      .  .+...|++++. ++|++|||++||++.|++..   ...++.|||+| ..+.|||+|++|+|++|+.|++||+|++++
T Consensus       268 ~~~~~~~~f~~~~~-~~g~vhg~~~WFd~~f~~~~---~~~~v~lST~P-~~~~THW~Q~v~~L~~Pi~V~~G~~I~g~i  342 (376)
T 4hc4_A          268 LEAGVGGRFRCSCY-GSAPMHGFAIWFQVTFPGGE---SEKPLVLSTSP-FHPATHWKQALLYLNEPVQVEQDTDVSGEI  342 (376)
T ss_dssp             HHHCEEEEEEEECC-SSEEEEEEEEEEEEEECCCC-----CCEEEECCT-TSCCCTTCEEEEEEEEEEEECTTCEEEEEE
T ss_pred             ccccceeEEEEEec-CCcEEEEEEEEEEEEecCCC---CCCceEEeCCC-CcCCCceeeEEEEeCCceEeCCCCEEEEEE
Confidence            1  45677888888 99999999999999996531   14569999999 588999999999999999999999999999


Q ss_pred             EEEeCCCCCeeeEEEEEEEEeccccc
Q 016314          354 SMTRSKENHRLLEVEFSCEIRESTGQ  379 (391)
Q Consensus       354 ~~~~~~~~~r~~~~~~~~~~~~~~~~  379 (391)
                      .+.++.+|+|.|+|+++|++.++.++
T Consensus       343 ~~~~~~~n~R~~~i~i~~~~~~~~~~  368 (376)
T 4hc4_A          343 TLLPSRDNPRRLRVLLRYKVGDQEEK  368 (376)
T ss_dssp             EEEECSSCTTSEEEEEEEEETTSCCE
T ss_pred             EEEECCCCCceeEEEEEEEeCCCCcc
Confidence            99999999999999999999887754
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 391
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 3e-76
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 4e-76
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 2e-73
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 2e-09
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 5e-09
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 1e-07
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 1e-07
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 2e-07
d2esra1152 c.66.1.46 (A:28-179) Putative methyltransferase SP 7e-07
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 4e-06
d1ne2a_197 c.66.1.32 (A:) Hypothetical protein Ta1320 {Archae 3e-05
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 3e-05
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 5e-05
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 5e-05
d2dula1375 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR 6e-05
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 1e-04
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 2e-04
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-04
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 3e-04
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 4e-04
d1wy7a1201 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {A 0.001
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 0.001
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 0.003
d2g72a1263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 0.003
d2h00a1250 c.66.1.54 (A:5-254) Methyltransferase 10 domain co 0.004
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 0.004
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arginine methyltransferase
domain: Arginine methyltransferase, HMT1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  237 bits (605), Expect = 3e-76
 Identities = 102/332 (30%), Positives = 165/332 (49%), Gaps = 28/332 (8%)

Query: 43  YFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGAR 102
           YF +Y      +EML D VR  +Y N+I QNK  F+ K VLDVG G+GIL++++A+ GA+
Sbjct: 3   YFDSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKDKIVLDVGCGTGILSMFAAKHGAK 62

Query: 103 KVYAVEATKMSDHARTLVKANNLQDVVEVIEGSVEDIVLPE-KVDVIISEWMGYFLLRES 161
            V  V+ + + + A+ LV+ N   D + ++ G +ED+ LP  KVD+IISEWMGYFLL ES
Sbjct: 63  HVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLPFPKVDIIISEWMGYFLLYES 122

Query: 162 MFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTY 221
           M D+V+ ARD +L   G+++P    + +A +         Q  +  L+ W          
Sbjct: 123 MMDTVLYARDHYLVEGGLIFPDKCSIHLAGLED------SQYKDEKLNYWQDV------- 169

Query: 222 YGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSK 281
           YG D S              L   +   +  + V  T+  +   D +T  + D+   +S 
Sbjct: 170 YGFDYSPF--------VPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDL-AFKSN 220

Query: 282 FLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSV 341
           F  + + +   + G   WFD+ F         + +E +T P     THW Q +F F   +
Sbjct: 221 FKLTAKRQDM-INGIVTWFDIVFPAPKGK---RPVEFSTGPHAPY-THWKQTIFYFPDDL 275

Query: 342 RVSEGDDLNVSFSMTRSKENHRLLEVEFSCEI 373
               GD +      + +++N+R L ++ S + 
Sbjct: 276 DAETGDTIEGELVCSPNEKNNRDLNIKISYKF 307
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Length = 152 Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 197 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 201 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 100.0
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 100.0
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 100.0
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.81
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.79
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.74
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.74
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.73
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.72
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.71
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.69
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.67
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.66
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.66
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.62
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.62
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.61
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.6
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.59
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.57
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.57
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.57
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.56
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.56
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.55
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.55
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.54
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.54
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.52
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.5
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.48
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.46
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.46
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.46
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.46
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.44
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.41
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.4
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.4
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.38
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.38
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.38
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.38
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.37
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.37
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.36
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.36
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.34
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.33
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.33
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.32
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.3
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.3
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.3
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.29
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.28
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.28
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.28
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.26
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.24
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.22
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.22
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.17
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.1
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.08
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.07
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.05
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.04
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.93
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.87
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.76
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.73
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.73
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.65
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.64
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.64
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.59
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.57
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.57
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.51
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.5
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.48
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.48
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.47
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.46
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.44
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.36
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.25
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.22
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.19
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.17
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.15
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.11
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.1
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.97
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.8
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.78
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.65
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.57
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.29
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.04
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.97
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.97
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.96
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.94
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.75
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.67
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.61
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.58
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.55
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.53
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.42
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.38
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.18
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 96.02
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.78
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.68
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.4
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 94.97
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 94.94
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.87
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.63
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.56
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 94.13
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.08
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.85
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.69
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 93.68
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.68
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 93.67
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 93.33
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 93.32
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.1
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 93.06
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 92.89
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.77
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.55
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.51
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 92.26
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 92.18
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.11
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 92.03
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 91.73
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 91.72
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 91.59
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 91.4
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.35
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 91.21
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 91.14
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.11
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 90.87
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 90.86
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.56
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.24
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 90.18
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.09
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.03
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 89.99
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 89.64
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 89.23
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 89.05
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 88.56
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 88.48
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 88.4
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 88.39
d1rjda_328 Leucine carboxy methyltransferase Ppm1 {Baker's ye 88.1
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 87.62
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 87.02
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 87.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 86.96
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 86.7
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 86.59
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 86.38
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 86.28
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 85.94
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 85.87
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 85.69
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 84.94
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 84.9
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 84.37
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 83.91
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 83.71
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 83.62
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 83.2
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 82.88
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 82.85
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 82.7
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 82.7
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 81.25
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 81.19
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 80.96
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.73
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 80.69
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 80.44
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arginine methyltransferase
domain: Arginine methyltransferase, HMT1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1e-55  Score=419.77  Aligned_cols=321  Identities=32%  Similarity=0.594  Sum_probs=281.3

Q ss_pred             hhhhhhhhhhhhHhhcCChHhHHHHHHHHHhcCCCCCCCEEEEECCcccHHHHHHHHcCCCeEEEEechHHHHHHHHHHH
Q 016314           42 NYFCTYAFLYHQKEMLSDRVRMDAYFNSIFQNKHHFQGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMSDHARTLVK  121 (391)
Q Consensus        42 ~y~~~~~~~~~~~~~l~d~~r~~~~~~~i~~~~~~~~~~~VLDlGcG~G~ls~~~a~~g~~~V~avD~s~~~~~a~~~~~  121 (391)
                      .||++|+++..|..||+|..|++.|.++|.++....++++|||||||+|.+++++|++|+++|+|+|.|+++..|+++++
T Consensus         2 ~yf~~y~~~~~h~~ml~D~~r~~~y~~aI~~~~~~~~~~~VLDlGcGtG~ls~~aa~~Ga~~V~avd~s~~~~~a~~~~~   81 (328)
T d1g6q1_           2 YYFDSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKDKIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVE   81 (328)
T ss_dssp             CCCCCCCCHHHHHHHHTCHHHHHHHHHHHHHHHHHHTTCEEEEETCTTSHHHHHHHHTCCSEEEEEESSTHHHHHHHHHH
T ss_pred             CcchhhcCchHHHHHhCCHHHHHHHHHHHHhccccCCcCEEEEeCCCCCHHHHHHHHhCCCEEEEEeCCHHHHHHHHHHH
Confidence            48999999999999999999999999999887666789999999999999999999999999999999988899999999


Q ss_pred             HcCCCCcEEEEEcccccCCCC-CcccEEEEccccccccCcchHHHHHHHHhccccCCeEEEcccceeEEeecccCcCccc
Q 016314          122 ANNLQDVVEVIEGSVEDIVLP-EKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAPIRSGLGDQK  200 (391)
Q Consensus       122 ~~~~~~~v~~~~~d~~~~~~~-~~~D~Ivs~~~~~~l~~e~~~~~~l~~~~~~LkpgG~~i~~~~~~~~~~~~~~~~~~~  200 (391)
                      .+++.++++++++++.+++++ +++|+|+++++.+.+.++..+..++.++.++|||||+++|..+++|++|+++..    
T Consensus        82 ~~~~~~~i~~i~~~~~~l~~~~~~~D~i~se~~~~~~~~e~~~~~~~~a~~r~LkpgG~iiP~~~~~~~~~v~~~~----  157 (328)
T d1g6q1_          82 LNGFSDKITLLRGKLEDVHLPFPKVDIIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLEDSQ----  157 (328)
T ss_dssp             HTTCTTTEEEEESCTTTSCCSSSCEEEEEECCCBTTBSTTCCHHHHHHHHHHHEEEEEEEESCEEEEEEEEECCHH----
T ss_pred             HhCccccceEEEeehhhccCcccceeEEEEEecceeeccchhHHHHHHHHHhccCCCeEEEeeecceeeecccCHH----
Confidence            999999999999999999887 799999999999999999999999999999999999999999999999997642    


Q ss_pred             hhhccccccchhhhhhcCccccccccccCCCcchhhhhhhhcccCceeecCCCCccccceeEEEEEcCCCCcccccceee
Q 016314          201 QQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRS  280 (391)
Q Consensus       201 ~~~~~~~~~~w~~~~~~~~~~~g~dl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~p~~~~~~dl~~~~~~~~~~~~~  280 (391)
                        .+......|       ++++|+|++++        ......++.+..+.+.++++.|..+..+||.+...+++ ....
T Consensus       158 --l~~~~~~~~-------~~~~G~d~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l-~~~~  219 (328)
T d1g6q1_         158 --YKDEKLNYW-------QDVYGFDYSPF--------VPLVLHEPIVDTVERNNVNTTSDKLIEFDLNTVKISDL-AFKS  219 (328)
T ss_dssp             --HHHHHHHHT-------TCBTTBCCTTH--------HHHHTTSCEEECCCGGGBCBCCEEEEEEETTTCCGGGG-SEEE
T ss_pred             --HHHHhcccc-------ccccccccchh--------hhhhccCcEEEEecCceeecCceeEEEecccccchhhc-ceee
Confidence              223334556       48899999988        33445567888888889999999999999999988887 7788


Q ss_pred             EEEEEEEecCceeEEEEEEEEeeecCCCCCCCCCcEEEecCCCCCCCCCccceEEecCCccccCCCCEEEEEEEEEeCCC
Q 016314          281 KFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSKE  360 (391)
Q Consensus       281 ~~~~~~~~~~g~~~g~~~wf~~~l~~~~~~~~~~~i~lst~P~~~~~~hW~q~~~~l~~p~~v~~g~~l~~~~~~~~~~~  360 (391)
                      .++++++ ++|+||||++||+++|++..   +..++.|||+|. .+.|||+|++|+|++|+.|++||+|++++.+.++.+
T Consensus       220 ~~~~~~~-~~g~~hg~~~wFd~~l~~~~---~~~~i~lST~P~-~~~thW~Q~v~~l~~pi~v~~gd~i~~~~~~~~~~~  294 (328)
T d1g6q1_         220 NFKLTAK-RQDMINGIVTWFDIVFPAPK---GKRPVEFSTGPH-APYTHWKQTIFYFPDDLDAETGDTIEGELVCSPNEK  294 (328)
T ss_dssp             EEEEEBC-SSCEEEEEEEEEEEECCCCT---TSCCCEEECSTT-SCCCTTCEEEEEEEEEEECCTTCEEEEEEEEEEETT
T ss_pred             eEEEEec-CCcEEEEEEEEEEEEccCCC---CCCceEEeCCCC-CCCCceeeEEEEeCCceEeCCCCEEEEEEEEEECCC
Confidence            8999988 99999999999999996531   145689999994 889999999999999999999999999999999999


Q ss_pred             CCeeeEEEEEEEEeccc--ccc-CCcccceee
Q 016314          361 NHRLLEVEFSCEIREST--GQI-LPPIKNKFY  389 (391)
Q Consensus       361 ~~r~~~~~~~~~~~~~~--~~~-~~~~~~~~~  389 (391)
                      ++|.++|+++|.++...  |+. .-++.++|.
T Consensus       295 ~~r~~~v~~~~~~~~~~~~~~~~~~~~~~~~~  326 (328)
T d1g6q1_         295 NNRDLNIKISYKFESNGIDGNSRSRKNEGSYL  326 (328)
T ss_dssp             EEEEEEEEEEEEEECCSSTHHHHCEEEEEEEE
T ss_pred             CCeeEEEEEEEEEEecCCCCcccceeccceEe
Confidence            99999999999876543  332 334444554
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure