Citrus Sinensis ID: 016451
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 389 | 2.2.26 [Sep-21-2011] | |||||||
| Q42671 | 337 | Glyceraldehyde-3-phosphat | N/A | no | 0.758 | 0.875 | 0.653 | 1e-122 | |
| Q39769 | 340 | Glyceraldehyde-3-phosphat | N/A | no | 0.766 | 0.876 | 0.650 | 1e-121 | |
| P26517 | 337 | Glyceraldehyde-3-phosphat | N/A | no | 0.760 | 0.878 | 0.657 | 1e-120 | |
| Q9Y796 | 337 | Glyceraldehyde-3-phosphat | N/A | no | 0.753 | 0.869 | 0.651 | 1e-120 | |
| P34924 | 340 | Glyceraldehyde-3-phosphat | N/A | no | 0.766 | 0.876 | 0.644 | 1e-119 | |
| P08735 | 337 | Glyceraldehyde-3-phosphat | N/A | no | 0.758 | 0.875 | 0.653 | 1e-119 | |
| Q8X1X3 | 338 | Glyceraldehyde-3-phosphat | N/A | no | 0.763 | 0.878 | 0.624 | 1e-119 | |
| P26519 | 336 | Glyceraldehyde-3-phosphat | N/A | no | 0.760 | 0.880 | 0.645 | 1e-119 | |
| Q09054 | 337 | Glyceraldehyde-3-phosphat | N/A | no | 0.758 | 0.875 | 0.650 | 1e-119 | |
| P34921 | 338 | Glyceraldehyde-3-phosphat | N/A | no | 0.750 | 0.863 | 0.653 | 1e-119 |
| >sp|Q42671|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 439 bits (1130), Expect = e-122, Method: Compositional matrix adjust.
Identities = 217/332 (65%), Positives = 250/332 (75%), Gaps = 37/332 (11%)
Query: 89 NTKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKG-TIN 147
K+GINGFGRIGRLV RVA RDDV++VAVNDPFI YMAYMFKYD+ HG +K +
Sbjct: 3 KVKIGINGFGRIGRLVARVALVRDDVELVAVNDPFITVDYMAYMFKYDTVHGQYKHHELK 62
Query: 148 VVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVV 207
V D+ TL K + VF R+P EIPW + G +YVVES+GVFT KA+AH+KGGAKKV+
Sbjct: 63 VKDEKTLLFGDKPVAVFGLRNPEEIPWAETGAEYVVESTGVFTEKEKAAAHLKGGAKKVI 122
Query: 208 ISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHA 267
ISAPS DAPMFVVGVNEKTY P++++VSNASCTTNCLAPLAKV+H+ FGI+EGLMTTVH+
Sbjct: 123 ISAPSKDAPMFVVGVNEKTYTPDIDVVSNASCTTNCLAPLAKVIHDRFGIVEGLMTTVHS 182
Query: 268 TTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKG------------------------ 303
TATQKTVDGPS KDWRGGR AS NIIPSSTGAAK
Sbjct: 183 ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMAFRVPTVDV 242
Query: 304 ------------ASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAG 351
ASY+++KAAIK SEG LKGILGYT+EDVVS+DFVGDSRSSIFDAKAG
Sbjct: 243 SVVDLTVTLAKEASYDEIKAAIKEESEGKLKGILGYTEEDVVSSDFVGDSRSSIFDAKAG 302
Query: 352 IGLSASFMKLVSWYDNEWGYSNRVLDLIEHMA 383
I LS F+K+V+WYDNEWGYS+RV+DLI HMA
Sbjct: 303 IALSKKFVKIVAWYDNEWGYSSRVVDLIRHMA 334
|
Craterostigma plantagineum (taxid: 4153) EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2 |
| >sp|Q39769|G3PC_GINBI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P26517|G3PC1_HORVU Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y796|G3P_CRYCU Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P34924|G3PC_PINSY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P08735|G3PC1_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Zea mays GN=GAPC1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8X1X3|G3P_PARBA Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P26519|G3PC_PETCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petroselinum crispum GN=GAPC PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q09054|G3PC2_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Zea mays GN=GAPC2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P34921|G3PC_DIACA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 389 | ||||||
| 118487867 | 422 | unknown [Populus trichocarpa] | 0.984 | 0.907 | 0.761 | 0.0 | |
| 224101329 | 422 | predicted protein [Populus trichocarpa] | 0.982 | 0.905 | 0.759 | 0.0 | |
| 224109070 | 422 | predicted protein [Populus trichocarpa] | 0.984 | 0.907 | 0.759 | 0.0 | |
| 225462254 | 429 | PREDICTED: glyceraldehyde-3-phosphate de | 0.987 | 0.895 | 0.744 | 1e-176 | |
| 255544534 | 426 | glyceraldehyde 3-phosphate dehydrogenase | 0.992 | 0.906 | 0.759 | 1e-176 | |
| 297844552 | 420 | GAPCP-2 [Arabidopsis lyrata subsp. lyrat | 0.976 | 0.904 | 0.727 | 1e-172 | |
| 449475837 | 425 | PREDICTED: glyceraldehyde-3-phosphate de | 0.994 | 0.910 | 0.733 | 1e-171 | |
| 297842739 | 422 | GAPCP-1 [Arabidopsis lyrata subsp. lyrat | 0.979 | 0.902 | 0.730 | 1e-171 | |
| 363814439 | 418 | uncharacterized protein LOC100804853 [Gl | 0.971 | 0.904 | 0.734 | 1e-170 | |
| 27754473 | 420 | putative glyceraldehyde-3-phosphate dehy | 0.976 | 0.904 | 0.722 | 1e-170 |
| >gi|118487867|gb|ABK95756.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 650 bits (1676), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 326/428 (76%), Positives = 356/428 (83%), Gaps = 45/428 (10%)
Query: 1 MAFSSLLRSTASASLV---RADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSS 57
MAFS LLRST +A LV R+D + SPSDR K S + +F+ + SIFGTS+P+GSSSS
Sbjct: 1 MAFSCLLRSTPAAPLVEASRSDFSPSPSDRFKVS-SVSFN---SLKSIFGTSIPTGSSSS 56
Query: 58 SLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVV 117
QTC+ + IQPI+ATATE+PPT+ KSR+DG TK+GINGFGRIGRLVLRVA FRDD+DVV
Sbjct: 57 --QTCSGRSIQPIKATATEMPPTVLKSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVV 114
Query: 118 AVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDY 177
AVNDPFIDA YMAYMFKYDSTHGVF GTI V+DDS LEINGK IK+ SKRDP EIPWGD+
Sbjct: 115 AVNDPFIDANYMAYMFKYDSTHGVFSGTIKVLDDSNLEINGKQIKITSKRDPTEIPWGDF 174
Query: 178 GVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA 237
G +YVVESSG+FTT+ KA+AHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNM+IVSNA
Sbjct: 175 GAEYVVESSGIFTTVEKAAAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMDIVSNA 234
Query: 238 SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS 297
SCTTNCLAPLAKVVHEEFGI+EGLMTTVHATTATQKTVDGPS KDWRGGRGA+QNIIPSS
Sbjct: 235 SCTTNCLAPLAKVVHEEFGIIEGLMTTVHATTATQKTVDGPSRKDWRGGRGAAQNIIPSS 294
Query: 298 TGAAKG------------------------------------ASYEDVKAAIKYASEGSL 321
TGAAK ASYEDVKAAIKYASEG L
Sbjct: 295 TGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKYASEGPL 354
Query: 322 KGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEH 381
KGILGYTD+DVVS+DF+GDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEH
Sbjct: 355 KGILGYTDDDVVSSDFLGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEH 414
Query: 382 MALVAAHN 389
MALVAAHN
Sbjct: 415 MALVAAHN 422
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224101329|ref|XP_002312235.1| predicted protein [Populus trichocarpa] gi|222852055|gb|EEE89602.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224109070|ref|XP_002315071.1| predicted protein [Populus trichocarpa] gi|222864111|gb|EEF01242.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225462254|ref|XP_002263263.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Vitis vinifera] gi|297736130|emb|CBI24168.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255544534|ref|XP_002513328.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223547236|gb|EEF48731.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297844552|ref|XP_002890157.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata] gi|297335999|gb|EFH66416.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449475837|ref|XP_004154566.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297842739|ref|XP_002889251.1| GAPCP-1 [Arabidopsis lyrata subsp. lyrata] gi|297335092|gb|EFH65510.1| GAPCP-1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|363814439|ref|NP_001242854.1| uncharacterized protein LOC100804853 [Glycine max] gi|255642130|gb|ACU21330.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|27754473|gb|AAO22684.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 389 | ||||||
| TAIR|locus:2206435 | 422 | GAPCP-1 "glyceraldehyde-3-phos | 0.719 | 0.663 | 0.665 | 4e-138 | |
| TAIR|locus:2032810 | 420 | GAPCP-2 "glyceraldehyde-3-phos | 0.737 | 0.683 | 0.649 | 4.5e-137 | |
| UNIPROTKB|G4NCH2 | 336 | MGG_01084 "Glyceraldehyde-3-ph | 0.542 | 0.627 | 0.622 | 2.3e-99 | |
| TAIR|locus:2010007 | 338 | GAPC2 "glyceraldehyde-3-phosph | 0.557 | 0.642 | 0.610 | 7.6e-99 | |
| TAIR|locus:2103085 | 338 | GAPC1 "glyceraldehyde-3-phosph | 0.557 | 0.642 | 0.600 | 1.6e-98 | |
| ASPGD|ASPL0000009927 | 336 | gpdA [Emericella nidulans (tax | 0.542 | 0.627 | 0.622 | 2.6e-98 | |
| UNIPROTKB|Q5R2J2 | 333 | GAPDH "Glyceraldehyde-3-phosph | 0.542 | 0.633 | 0.613 | 5.3e-98 | |
| POMBASE|SPBC32F12.11 | 336 | tdh1 "glyceraldehyde-3-phospha | 0.542 | 0.627 | 0.613 | 1.8e-97 | |
| UNIPROTKB|P17244 | 333 | GAPDH "Glyceraldehyde-3-phosph | 0.542 | 0.633 | 0.627 | 3.7e-97 | |
| UNIPROTKB|Q05025 | 333 | GAPDH "Glyceraldehyde-3-phosph | 0.542 | 0.633 | 0.622 | 3.7e-97 |
| TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 960 (343.0 bits), Expect = 4.0e-138, Sum P(2) = 4.0e-138
Identities = 191/287 (66%), Positives = 211/287 (73%)
Query: 17 RADLTSSP-SDRVKGSPTAAFSRNLNTXXXXXXXXXXXXXXXXLQTCAAKGIQPIRATAT 75
R D SSP SD K + FSRNL LQ A+ +QPI+ATAT
Sbjct: 19 RPDFFSSPASDHSKVLSSLGFSRNLKPSRFSSGISSS------LQNGNARSVQPIKATAT 72
Query: 76 EIPPTIQKSRSDGNTKVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKY 135
E+P +++S S G TKVGINGFGRIGRL NDPFIDAKYMAYM KY
Sbjct: 73 EVPSAVRRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMLKY 132
Query: 136 DSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKA 195
DSTHG FKG+INV+DDSTLEINGK + V SKRDP+EIPW D G DYVVESSGVFTT++KA
Sbjct: 133 DSTHGNFKGSINVIDDSTLEINGKKVNVVSKRDPSEIPWADLGADYVVESSGVFTTLSKA 192
Query: 196 SAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEF 255
++H+KGGAKKV+ISAPSADAPMFVVGVNE TY+PNM+IVSNASCTTNCLAPLAKVVHEEF
Sbjct: 193 ASHLKGGAKKVIISAPSADAPMFVVGVNEHTYQPNMDIVSNASCTTNCLAPLAKVVHEEF 252
Query: 256 GILEGLMXXXXXXXXXXXXXDGPSMKDWRGGRGASQNIIPSSTGAAK 302
GILEGLM DGPSMKDWRGGRGASQNIIPSSTGAAK
Sbjct: 253 GILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK 299
|
|
| TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NCH2 MGG_01084 "Glyceraldehyde-3-phosphate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000009927 gpdA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R2J2 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pelodiscus sinensis (taxid:13735)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC32F12.11 tdh1 "glyceraldehyde-3-phosphate dehydrogenase Tdh1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P17244 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05025 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Coturnix japonica (taxid:93934)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P20445 | G3P_EMENI | 1, ., 2, ., 1, ., 1, 2 | 0.6167 | 0.7634 | 0.8839 | yes | no |
| P0CN74 | G3P_CRYNJ | 1, ., 2, ., 1, ., 1, 2 | 0.6467 | 0.7609 | 0.8731 | yes | no |
| Q12552 | G3P_ASPNG | 1, ., 2, ., 1, ., 1, 2 | 0.6167 | 0.7634 | 0.8839 | yes | no |
| Q9HGY7 | G3P_ASPOR | 1, ., 2, ., 1, ., 1, 2 | 0.6295 | 0.7557 | 0.8698 | yes | no |
| P32637 | G3P_PODAS | 1, ., 2, ., 1, ., 1, 2 | 0.6382 | 0.7506 | 0.8664 | yes | no |
| Q6CCU7 | G3P_YARLI | 1, ., 2, ., 1, ., 1, 2 | 0.6545 | 0.7506 | 0.8639 | yes | no |
| Q6BMK0 | G3P_DEBHA | 1, ., 2, ., 1, ., 1, 2 | 0.6310 | 0.7480 | 0.8686 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 4th Layer | 1.2.1.12 | 0.946 |
| 4th Layer | 1.2.1.59 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.2.1 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 389 | |||
| PLN02272 | 421 | PLN02272, PLN02272, glyceraldehyde-3-phosphate deh | 0.0 | |
| PTZ00023 | 337 | PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh | 1e-150 | |
| COG0057 | 335 | COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog | 1e-146 | |
| PLN02358 | 338 | PLN02358, PLN02358, glyceraldehyde-3-phosphate deh | 1e-141 | |
| TIGR01534 | 326 | TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh | 1e-140 | |
| PRK15425 | 331 | PRK15425, gapA, glyceraldehyde-3-phosphate dehydro | 1e-123 | |
| PRK07729 | 343 | PRK07729, PRK07729, glyceraldehyde-3-phosphate deh | 1e-109 | |
| PTZ00434 | 361 | PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho | 1e-109 | |
| PLN02237 | 442 | PLN02237, PLN02237, glyceraldehyde-3-phosphate deh | 4e-93 | |
| PLN03096 | 395 | PLN03096, PLN03096, glyceraldehyde-3-phosphate deh | 2e-91 | |
| PRK07403 | 337 | PRK07403, PRK07403, glyceraldehyde-3-phosphate deh | 2e-91 | |
| PRK08955 | 334 | PRK08955, PRK08955, glyceraldehyde-3-phosphate deh | 2e-83 | |
| pfam00044 | 148 | pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh | 4e-80 | |
| smart00846 | 149 | smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de | 5e-80 | |
| PRK13535 | 336 | PRK13535, PRK13535, erythrose 4-phosphate dehydrog | 2e-77 | |
| TIGR01532 | 325 | TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de | 3e-71 | |
| PRK08289 | 477 | PRK08289, PRK08289, glyceraldehyde-3-phosphate deh | 3e-56 | |
| pfam02800 | 157 | pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh | 1e-55 | |
| PTZ00353 | 342 | PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph | 5e-43 | |
| cd12167 | 330 | cd12167, 2-Hacid_dh_8, Putative D-isomer specific | 9e-05 | |
| COG0136 | 334 | COG0136, Asd, Aspartate-semialdehyde dehydrogenase | 1e-04 | |
| cd05299 | 312 | cd05299, CtBP_dh, C-terminal binding protein (CtBP | 1e-04 | |
| pfam02826 | 175 | pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro | 0.002 | |
| TIGR01296 | 338 | TIGR01296, asd_B, aspartate-semialdehyde dehydroge | 0.002 |
| >gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
Score = 688 bits (1778), Expect = 0.0
Identities = 324/428 (75%), Positives = 345/428 (80%), Gaps = 46/428 (10%)
Query: 1 MAFSSLLRSTASASLV---RADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSS 57
MAFSSLLRS A+A +D +SS SD K S ++ SS S S +SS
Sbjct: 1 MAFSSLLRSAATAPAAAARGSDFSSSSSDPSKVS-------SVGFSSSLSFSGSSSGASS 53
Query: 58 SLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVV 117
SLQ+C+A+ +QPI+ATATE PP + KS S G TK+GINGFGRIGRLVLR+A RDD++VV
Sbjct: 54 SLQSCSARSVQPIKATATEAPPAVLKSSSSGKTKIGINGFGRIGRLVLRIATSRDDIEVV 113
Query: 118 AVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDY 177
AVNDPFIDAKYMAYMFKYDSTHG FKGTINVVDDSTLEINGK IKV SKRDPAEIPWGD+
Sbjct: 114 AVNDPFIDAKYMAYMFKYDSTHGNFKGTINVVDDSTLEINGKQIKVTSKRDPAEIPWGDF 173
Query: 178 GVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA 237
G +YVVESSGVFTT+ KASAH+KGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA
Sbjct: 174 GAEYVVESSGVFTTVEKASAHLKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA 233
Query: 238 SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS 297
SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS
Sbjct: 234 SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS 293
Query: 298 TGAA------------------------------------KGASYEDVKAAIKYASEGSL 321
TGAA K ASYEDVKAAIKYASEG L
Sbjct: 294 TGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKYASEGPL 353
Query: 322 KGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEH 381
KGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEH
Sbjct: 354 KGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSNRVLDLIEH 413
Query: 382 MALVAAHN 389
MALVAA +
Sbjct: 414 MALVAASH 421
|
Length = 421 |
| >gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor | Back alignment and domain information |
|---|
| >gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 389 | |||
| PTZ00434 | 361 | cytosolic glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PLN02272 | 421 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| PLN02237 | 442 | glyceraldehyde-3-phosphate dehydrogenase B | 100.0 | |
| PTZ00023 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PRK15425 | 331 | gapA glyceraldehyde-3-phosphate dehydrogenase A; P | 100.0 | |
| PRK07403 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| PRK07729 | 343 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 100.0 | |
| PTZ00353 | 342 | glycosomal glyceraldehyde-3-phosphate dehydrogenas | 100.0 | |
| PLN02358 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| COG0057 | 335 | GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt | 100.0 | |
| PRK08955 | 334 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| PRK13535 | 336 | erythrose 4-phosphate dehydrogenase; Provisional | 100.0 | |
| PRK08289 | 477 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| TIGR01534 | 327 | GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, | 100.0 | |
| TIGR01532 | 325 | E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas | 100.0 | |
| KOG0657 | 285 | consensus Glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PF00044 | 151 | Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 100.0 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| PF02800 | 157 | Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 99.96 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 99.94 | |
| PRK06901 | 322 | aspartate-semialdehyde dehydrogenase; Provisional | 99.93 | |
| COG0136 | 334 | Asd Aspartate-semialdehyde dehydrogenase [Amino ac | 99.9 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 99.89 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 99.86 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.83 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 99.82 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.81 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 99.81 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 99.76 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 99.73 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 99.57 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 99.49 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 99.48 | |
| KOG4777 | 361 | consensus Aspartate-semialdehyde dehydrogenase [Am | 99.42 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 99.42 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 99.42 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 99.23 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 99.21 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 98.63 | |
| COG0002 | 349 | ArgC Acetylglutamate semialdehyde dehydrogenase [A | 98.07 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 97.94 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 97.81 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 97.77 | |
| TIGR01921 | 324 | DAP-DH diaminopimelate dehydrogenase. This model r | 97.6 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 97.47 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 97.38 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 97.26 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 97.21 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 97.14 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 97.08 | |
| PRK08374 | 336 | homoserine dehydrogenase; Provisional | 97.01 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 96.99 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 96.87 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 96.8 | |
| PRK06392 | 326 | homoserine dehydrogenase; Provisional | 96.79 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 96.77 | |
| PRK06813 | 346 | homoserine dehydrogenase; Validated | 96.67 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 96.59 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 96.57 | |
| PLN02775 | 286 | Probable dihydrodipicolinate reductase | 96.57 | |
| COG0460 | 333 | ThrA Homoserine dehydrogenase [Amino acid transpor | 96.06 | |
| PLN02696 | 454 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | 96.0 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 95.96 | |
| PRK05447 | 385 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P | 95.84 | |
| PF03447 | 117 | NAD_binding_3: Homoserine dehydrogenase, NAD bindi | 95.74 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 95.4 | |
| PRK10206 | 344 | putative oxidoreductase; Provisional | 95.36 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 94.73 | |
| PLN02700 | 377 | homoserine dehydrogenase family protein | 94.67 | |
| PLN02477 | 410 | glutamate dehydrogenase | 94.58 | |
| COG4091 | 438 | Predicted homoserine dehydrogenase [Amino acid tra | 94.55 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 94.44 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 94.4 | |
| TIGR02130 | 275 | dapB_plant dihydrodipicolinate reductase. This nar | 94.36 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 94.18 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 94.15 | |
| KOG4354 | 340 | consensus N-acetyl-gamma-glutamyl-phosphate reduct | 93.61 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 93.61 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 93.15 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 92.62 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 92.51 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 92.47 | |
| COG4569 | 310 | MhpF Acetaldehyde dehydrogenase (acetylating) [Sec | 92.43 | |
| COG2344 | 211 | AT-rich DNA-binding protein [General function pred | 92.41 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 92.1 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 91.93 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 91.72 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 91.47 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 91.4 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 91.23 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 90.82 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 90.74 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 90.08 | |
| PLN02928 | 347 | oxidoreductase family protein | 90.07 | |
| PLN02712 | 667 | arogenate dehydrogenase | 90.0 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 89.9 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 89.87 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 89.72 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 89.53 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 89.33 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 89.22 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 89.16 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 89.15 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 89.12 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 88.91 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 88.87 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 88.76 | |
| PLN02712 | 667 | arogenate dehydrogenase | 88.62 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 88.47 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 88.4 | |
| PF02629 | 96 | CoA_binding: CoA binding domain; InterPro: IPR0037 | 88.31 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 88.3 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 88.23 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 88.12 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 88.07 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 87.97 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 87.95 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 87.82 | |
| PF02774 | 184 | Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer | 87.81 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 87.74 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 87.58 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 87.54 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 87.3 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 87.13 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 86.97 | |
| KOG1203 | 411 | consensus Predicted dehydrogenase [Carbohydrate tr | 86.91 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 86.89 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.64 | |
| PLN02256 | 304 | arogenate dehydrogenase | 86.54 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 86.34 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 85.64 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 85.62 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 85.15 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 84.73 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 84.6 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 84.02 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 84.0 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 83.89 | |
| COG3804 | 350 | Uncharacterized conserved protein related to dihyd | 83.35 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 83.27 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 83.11 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 83.02 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 82.81 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 82.47 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 81.85 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 81.71 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 80.65 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 80.27 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 80.2 |
| >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-115 Score=868.63 Aligned_cols=299 Identities=57% Similarity=0.946 Sum_probs=286.3
Q ss_pred cceeEEEeccChhHHHHHHHHHcC----CCCcEEEEeCCCCCHHHHhhhhcccccccccCceEEE--------ecCCeeE
Q 016451 88 GNTKVGINGFGRIGRLVLRVAAFR----DDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINV--------VDDSTLE 155 (389)
Q Consensus 88 m~ikVgINGfGrIGr~vlR~l~~r----~~~~iVaINd~~~~~~~layLlkyDSthGkf~~~v~~--------~~~~~L~ 155 (389)
|++||||||||||||+++|+++++ ++++||||||++.++++|+|||||||+||+|+++++. ++ +.|.
T Consensus 2 m~ikVgINGFGRIGR~v~R~~~~~~~~~~~ievVAINd~~~~~~~~ayLlkyDS~hG~~~~~v~~~~~~~~~~~~-~~l~ 80 (361)
T PTZ00434 2 APIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPKYTVETTKSSPSVKTD-DVLV 80 (361)
T ss_pred CceEEEEECcChHHHHHHHHHHHcccCCCCeEEEEEeCCCCChhheeeeeeeecCCCCcCCceeecccccccccC-CEEE
Confidence 678999999999999999999875 5799999999878999999999999999999999997 54 6899
Q ss_pred ECCEEEEEE-ecCCCCCCCCCccCccEEEeccCCCCCHHHHHHHHHCCCCEEEEcCCCCC-CCeEEeecCccCCCC-CCC
Q 016451 156 INGKLIKVF-SKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSAD-APMFVVGVNEKTYKP-NMN 232 (389)
Q Consensus 156 inGk~I~v~-~~~dp~~i~W~~~gvD~VvEsTG~f~t~e~a~~hl~aGaKkVIISaps~D-~pt~V~GVN~~~y~~-~~~ 232 (389)
+||++|.++ +++||+++||+++|+||||||||.|++++++++||++||||||||||++| .|||||||||+.|++ .++
T Consensus 81 ing~~I~~~~~~~dP~~ipW~~~gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d~~~t~V~GVN~~~y~~~~~~ 160 (361)
T PTZ00434 81 VNGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEHH 160 (361)
T ss_pred ECCEEEEEEEecCChhhCchhhcCCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCCCCceEEEcCChHHcCcccCc
Confidence 999999986 99999999999999999999999999999999999999999999999887 689999999999998 588
Q ss_pred eEecCChhhhhhHHHHHHH-HhhcCceEEeeecccccCCCcccccCCCCCCCCCCcccccccccCCCCCCC---------
Q 016451 233 IVSNASCTTNCLAPLAKVV-HEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK--------- 302 (389)
Q Consensus 233 IISnaSCTTncLAPvlkvL-~d~fGI~~g~mTTVHA~T~tQ~lvD~p~~kd~R~~Raaa~NIIPtsTGaak--------- 302 (389)
||||||||||||||++|+| ||+|||++|+|||||+||++|+++|+||+|||||+|+|++||||++|||||
T Consensus 161 IiSnASCTTNcLAP~~kvL~~~~fGI~~g~mTTVHayT~~Q~~~D~~~~kD~Rr~Raaa~nIIPtsTGAAkAv~~VlP~L 240 (361)
T PTZ00434 161 VVSNASCTTNCLAPIVHVLTKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPST 240 (361)
T ss_pred EEECCChHHHhhHHHHHHhhcCCcceEEEEEEEEecccCCcccccCcCcccccccccccccCccCCcchhhhhceecccc
Confidence 9999999999999999999 799999999999999999999999999659999999999999999999999
Q ss_pred ---------------------------CCCHHHHHHHHHHhhcCCCCcccCccccceEeccCCCCCcceEEeCCCccccc
Q 016451 303 ---------------------------GASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLS 355 (389)
Q Consensus 303 ---------------------------~~~~e~In~~~k~as~g~lkgil~yte~~~VS~Df~g~~~Ssi~D~~~t~~~~ 355 (389)
++++||||++||+|++++|||||+|+|+|+||+||+|++||+|||+.+|++++
T Consensus 241 ~GKl~G~a~RVPt~nvS~vDLt~~l~k~~t~eein~a~k~aa~~~lkgIl~y~~~plVS~Df~g~~~Ssi~D~~~t~v~~ 320 (361)
T PTZ00434 241 KGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDAAIKRASQTYMKGILGFTDDELVSADFINDNRSSIYDSKATLQNN 320 (361)
T ss_pred CCceeeEEEecccCcEeEEEEEEEeCCCCCHHHHHHHHHHhhhccccCcccccCCCccccccCCCCCCeEEEhhhCeEec
Confidence 89999999999999999999999999999999999999999999999999996
Q ss_pred ----CCeEEEEEEeCCCCchhhhHHHHHHHHHHhhh
Q 016451 356 ----ASFMKLVSWYDNEWGYSNRVLDLIEHMALVAA 387 (389)
Q Consensus 356 ----~~~vKl~~WYDNE~GYs~R~vdl~~~~~~~~~ 387 (389)
++|+|+++||||||||||||+||+.||.+..+
T Consensus 321 ~~~~~~~vKv~~WYDNEwGys~Rl~dl~~~~~~~~~ 356 (361)
T PTZ00434 321 LPGERRFFKIVSWYDNEWGYSHRVVDLVRYMAAKDA 356 (361)
T ss_pred cCCCCCEEEEEEEecCchHHHHHHHHHHHHHHhccc
Confidence 48999999999999999999999999987654
|
|
| >PLN02272 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02358 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK06901 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01921 DAP-DH diaminopimelate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08374 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06392 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06813 homoserine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PLN02775 Probable dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10206 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02700 homoserine dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >TIGR02130 dapB_plant dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2344 AT-rich DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 389 | ||||
| 1gpd_G | 334 | Studies Of Asymmetry In The Three-Dimensional Struc | 1e-105 | ||
| 4gpd_1 | 333 | The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho | 1e-105 | ||
| 1ihx_A | 333 | Crystal Structure Of Two D-Glyceraldehyde-3-Phospha | 1e-105 | ||
| 1szj_G | 333 | Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr | 1e-104 | ||
| 3e6a_O | 336 | Crystal Structure And Functional Analysis Of Glycer | 1e-104 | ||
| 3e5r_O | 337 | Crystal Structure And Functional Analysis Of Glycer | 1e-104 | ||
| 1dss_G | 333 | Structure Of Active-Site Carboxymethylated D-Glycer | 1e-102 | ||
| 1znq_O | 338 | Crsytal Structure Of Human Liver Gapdh Length = 338 | 1e-100 | ||
| 1u8f_O | 335 | Crystal Structure Of Human Placental Glyceraldehyde | 1e-100 | ||
| 1j0x_O | 332 | Crystal Structure Of The Rabbit Muscle Glyceraldehy | 1e-100 | ||
| 3gpd_R | 334 | Twinning In Crystals Of Human Skeletal Muscle D-Gly | 1e-100 | ||
| 3pym_A | 332 | Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res | 1e-92 | ||
| 4iq8_A | 340 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 2e-92 | ||
| 2i5p_O | 342 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-92 | ||
| 2vyn_D | 334 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 8e-92 | ||
| 3h9e_B | 346 | Crystal Structure Of Human Sperm-Specific Glycerald | 6e-91 | ||
| 1gad_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 2e-89 | ||
| 1s7c_A | 331 | Crystal Structure Of Mes Buffer Bound Form Of Glyce | 2e-89 | ||
| 1gae_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 1e-88 | ||
| 2vyn_A | 331 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 3e-88 | ||
| 1vsu_A | 359 | Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate | 1e-87 | ||
| 3cps_A | 354 | Crystal Structure Of Cryptosporidium Parvum Glycera | 1e-87 | ||
| 2b4r_O | 345 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 3e-86 | ||
| 1ywg_O | 337 | The Structure Of Glyceraldehyde-3-Phosphate Dehydro | 3e-86 | ||
| 3cif_A | 359 | Crystal Structure Of C153s Mutant Glyceraldehyde 3- | 1e-85 | ||
| 1dc4_A | 330 | Structural Analysis Of Glyceraldehyde 3-Phosphate D | 1e-84 | ||
| 3sth_A | 361 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 5e-83 | ||
| 2x0n_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 2e-76 | ||
| 1k3t_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 5e-75 | ||
| 3dmt_C | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 1e-73 | ||
| 1gyp_A | 358 | Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph | 1e-71 | ||
| 1a7k_A | 360 | Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase | 1e-71 | ||
| 2ep7_A | 342 | Structural Study Of Project Id Aq_1065 From Aquifex | 2e-65 | ||
| 1gd1_O | 334 | Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr | 3e-65 | ||
| 1hdg_O | 332 | The Crystal Structure Of Holo-glyceraldehyde-3-phos | 4e-65 | ||
| 1dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 5e-64 | ||
| 1npt_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 6e-64 | ||
| 1nq5_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 7e-64 | ||
| 3dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 2e-63 | ||
| 1cer_O | 331 | Determinants Of Enzyme Thermostability Observed In | 3e-59 | ||
| 1nbo_O | 337 | The Dual Coenzyme Specificity Of Photosynthetic Gly | 3e-58 | ||
| 1rm3_O | 337 | Crystal Structure Of Mutant T33a Of Photosynthetic | 4e-58 | ||
| 2pkr_O | 365 | Crystal Structure Of (A+cte)4 Chimeric Form Of Phot | 4e-58 | ||
| 2g82_O | 331 | High Resolution Structures Of Thermus Aquaticus Gly | 6e-58 | ||
| 1rm5_O | 337 | Crystal Structure Of Mutant S188a Of Photosynthetic | 7e-58 | ||
| 1vc2_A | 331 | Crystal Structure Of Glyceraldehyde 3-Phosphate Deh | 8e-58 | ||
| 3l0d_A | 356 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 9e-58 | ||
| 4dib_A | 345 | The Crystal Structure Of Glyceraldehyde-3-Phosphate | 2e-56 | ||
| 1jn0_O | 335 | Crystal Structure Of The Non-Regulatory A4 Isoform | 2e-56 | ||
| 3hja_A | 356 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 3e-56 | ||
| 3gnq_A | 344 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 3e-56 | ||
| 2pkq_O | 368 | Crystal Structure Of The Photosynthetic A2b2-Glycer | 8e-56 | ||
| 2d2i_A | 380 | Crystal Structure Of Nadp-Dependent Glyceraldehyde- | 8e-55 | ||
| 3b1j_A | 339 | Crystal Structure Of Dehydrogenese Length = 339 | 1e-54 | ||
| 3doc_A | 335 | Crystal Structure Of Trka Glyceraldehyde-3-Phosphat | 6e-53 | ||
| 1obf_O | 335 | The Crystal Structure Of Glyceraldehyde 3-Phosphate | 7e-53 | ||
| 3k2b_A | 337 | Crystal Structure Of Photosynthetic A4 Isoform Glyc | 1e-51 | ||
| 3lc1_P | 336 | Crystal Structure Of H178n Mutant Of Glyceraldehyde | 3e-51 | ||
| 3k73_Q | 336 | Crystal Structure Of Phosphate Bound Holo Glycerald | 3e-51 | ||
| 3lc7_O | 339 | Crystal Structure Of Apo Glyceraldehyde-3-Phosphate | 3e-51 | ||
| 3vaz_P | 344 | Crystal Structure Of Staphylococcal Gapdh1 In A Hex | 3e-51 | ||
| 3lvf_P | 338 | Crystal Structure Of Holo Glyceraldehyde-3-Phosphat | 3e-51 | ||
| 3ksd_Q | 336 | Crystal Structure Of C151s+h178n Mutant Of Glyceral | 5e-50 | ||
| 3hq4_R | 336 | Crystal Structure Of C151s Mutant Of Glyceraldehyde | 6e-50 | ||
| 3k9q_Q | 336 | Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde | 9e-50 | ||
| 2xf8_A | 338 | Structure Of The D-Erythrose-4-Phosphate Dehydrogen | 2e-40 | ||
| 2x5j_O | 339 | Crystal Structure Of The Apoform Of The D-Erythrose | 2e-40 | ||
| 2x5k_O | 339 | Structure Of An Active Site Mutant Of The D-Erythro | 7e-38 |
| >pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
|
| >pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 | Back alignment and structure |
| >pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 | Back alignment and structure |
| >pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 | Back alignment and structure |
| >pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 | Back alignment and structure |
| >pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 | Back alignment and structure |
| >pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 | Back alignment and structure |
| >pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 | Back alignment and structure |
| >pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 | Back alignment and structure |
| >pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 | Back alignment and structure |
| >pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 | Back alignment and structure |
| >pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 | Back alignment and structure |
| >pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 | Back alignment and structure |
| >pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 | Back alignment and structure |
| >pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 | Back alignment and structure |
| >pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 | Back alignment and structure |
| >pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 | Back alignment and structure |
| >pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 | Back alignment and structure |
| >pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 | Back alignment and structure |
| >pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 | Back alignment and structure |
| >pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 | Back alignment and structure |
| >pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 | Back alignment and structure |
| >pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 | Back alignment and structure |
| >pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 | Back alignment and structure |
| >pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 | Back alignment and structure |
| >pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 | Back alignment and structure |
| >pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 | Back alignment and structure |
| >pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 | Back alignment and structure |
| >pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 | Back alignment and structure |
| >pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 | Back alignment and structure |
| >pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 | Back alignment and structure |
| >pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 | Back alignment and structure |
| >pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 | Back alignment and structure |
| >pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 | Back alignment and structure |
| >pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 | Back alignment and structure |
| >pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 | Back alignment and structure |
| >pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 | Back alignment and structure |
| >pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 | Back alignment and structure |
| >pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 | Back alignment and structure |
| >pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 | Back alignment and structure |
| >pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 | Back alignment and structure |
| >pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 | Back alignment and structure |
| >pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 | Back alignment and structure |
| >pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 | Back alignment and structure |
| >pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 | Back alignment and structure |
| >pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 | Back alignment and structure |
| >pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 | Back alignment and structure |
| >pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 | Back alignment and structure |
| >pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
| >pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 | Back alignment and structure |
|---|
Score = 597 bits (1541), Expect = 0.0
Identities = 189/329 (57%), Positives = 235/329 (71%), Gaps = 37/329 (11%)
Query: 91 KVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVD 150
+V INGFGRIGRLV+R+A R +V+VVA+NDPFI Y AYMFKYDSTHG + G ++ D
Sbjct: 3 RVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSH-D 61
Query: 151 DSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISA 210
D + ++GK I + +RDPA +PWG VD ++S+GVF + A H+ GAKKVVI+A
Sbjct: 62 DKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITA 121
Query: 211 PSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTA 270
PS+ APMFV+GVNE+ Y ++ IVSNASCTTNCLAPLAKV+++ FGI EGLMTTVH+ TA
Sbjct: 122 PSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTA 181
Query: 271 TQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK---------------------------- 302
TQKTVDGPS KDWRGGR AS NIIPSSTGAAK
Sbjct: 182 TQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVV 241
Query: 303 --------GASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGL 354
+Y+++K +K A+EG LKG+LGYT++ VVS+DF+GDS SSIFDA AGI L
Sbjct: 242 DLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQL 301
Query: 355 SASFMKLVSWYDNEWGYSNRVLDLIEHMA 383
S F+KLVSWYDNE+GYS RV+DL+EH+A
Sbjct: 302 SPKFVKLVSWYDNEYGYSTRVVDLVEHVA 330
|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 389 | |||
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 3v1y_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 100.0 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 100.0 | |
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 100.0 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 100.0 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 100.0 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 100.0 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 100.0 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 100.0 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 100.0 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 100.0 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 100.0 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 100.0 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 100.0 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 100.0 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 100.0 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 100.0 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 100.0 | |
| 2yv3_A | 331 | Aspartate-semialdehyde dehydrogenase; aspartate pa | 100.0 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 100.0 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 100.0 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 100.0 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 100.0 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 100.0 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 100.0 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 100.0 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 99.97 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 99.97 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 99.96 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 99.93 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 99.93 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 99.93 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 99.92 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 99.91 | |
| 3uw3_A | 377 | Aspartate-semialdehyde dehydrogenase; structural g | 99.91 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 99.91 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 99.91 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 99.87 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 99.73 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 98.07 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 97.88 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 97.6 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 97.58 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 97.5 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 97.44 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 97.41 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 97.4 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 97.4 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 97.33 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 97.33 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 97.3 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 97.29 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 97.27 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 97.27 | |
| 3ing_A | 325 | Homoserine dehydrogenase; NP_394635.1, structural | 97.24 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 97.24 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 97.24 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 97.23 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.2 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 97.19 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 97.18 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 97.18 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 97.17 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 97.13 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 97.1 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 97.1 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 97.1 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 97.07 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 97.06 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 97.06 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 97.04 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 97.03 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 97.02 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 96.99 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 96.98 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 96.97 | |
| 3do5_A | 327 | HOM, homoserine dehydrogenase; NP_069768.1, putati | 96.94 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 96.93 | |
| 3c8m_A | 331 | Homoserine dehydrogenase; structural genomics, APC | 96.89 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 96.88 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 96.85 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 96.83 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 96.82 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 96.8 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 96.78 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 96.65 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 96.62 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 96.62 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 96.6 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 96.56 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 96.35 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 96.33 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 96.32 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 96.23 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 96.23 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 96.22 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 96.19 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 96.16 | |
| 1r0k_A | 388 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 96.06 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 96.03 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 95.82 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 95.78 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 95.73 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 95.23 | |
| 2vt3_A | 215 | REX, redox-sensing transcriptional repressor REX; | 94.59 | |
| 2dt5_A | 211 | AT-rich DNA-binding protein; REX, NADH, NAD, rossm | 94.45 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 94.02 | |
| 1ebf_A | 358 | Homoserine dehydrogenase; dinucleotide, NAD, dimer | 93.95 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 93.63 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 93.61 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.49 | |
| 3a06_A | 376 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M | 93.27 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 93.17 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 92.68 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 92.56 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 92.53 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 92.46 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 92.2 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 92.06 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 92.03 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 91.89 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 91.46 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 91.34 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 91.04 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 90.75 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 90.54 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 90.49 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 90.46 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 90.37 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 90.31 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 90.18 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 90.11 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 90.1 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 90.06 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 90.05 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 89.95 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 89.85 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 89.83 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 89.8 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 89.65 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 89.64 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 89.57 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 89.56 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 89.56 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 89.53 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 89.5 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 89.45 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 89.34 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 89.33 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 89.31 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 89.14 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 89.07 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 88.97 | |
| 1vm6_A | 228 | DHPR, dihydrodipicolinate reductase; TM1520, struc | 88.92 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 88.88 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 88.85 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 88.67 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 88.65 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 88.49 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 88.35 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 88.33 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 88.29 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 88.27 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 88.03 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 87.98 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 87.98 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 87.92 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 87.89 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 87.88 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 87.86 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 87.83 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 87.68 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 87.67 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 87.55 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 87.5 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 87.4 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 87.29 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 87.25 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 87.23 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 87.18 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 87.12 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 87.02 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 86.8 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 86.72 | |
| 2i76_A | 276 | Hypothetical protein; NADP, dehydrogenase, TM1727, | 86.7 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 86.35 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 86.31 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 86.19 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 86.11 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 86.03 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 86.0 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 85.9 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 85.69 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 85.56 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 85.46 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 85.4 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 85.36 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 85.2 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 85.1 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 85.09 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 85.08 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 84.97 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 85.0 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 84.54 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 84.24 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 84.17 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 83.94 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 83.94 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 83.78 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 83.63 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 83.41 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 83.19 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 83.12 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 82.94 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 82.94 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 82.88 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 82.76 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 82.67 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 82.64 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 82.62 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 82.48 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 82.44 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 81.78 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 81.58 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 81.56 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 81.34 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 81.25 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 81.11 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 80.94 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 80.54 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 80.2 |
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-115 Score=859.79 Aligned_cols=294 Identities=64% Similarity=1.072 Sum_probs=288.3
Q ss_pred eeEEEeccChhHHHHHHHHHcCCCCcEEEEeCCCCCHHHHhhhhcccccccccCceEEEecCCeeEECCEEEEEEecCCC
Q 016451 90 TKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDP 169 (389)
Q Consensus 90 ikVgINGfGrIGr~vlR~l~~r~~~~iVaINd~~~~~~~layLlkyDSthGkf~~~v~~~~~~~L~inGk~I~v~~~~dp 169 (389)
+||||||||||||+++|+++++++++|||||||++|+++|+|||||||+||+|+++|++++ ++|.|||++|++++++||
T Consensus 2 ~kv~INGfGrIGr~v~R~~~~~~~~~ivaiNd~~~d~~~~a~l~kyDS~hG~f~~~v~~~~-~~l~i~Gk~I~v~~e~dp 80 (332)
T 3pym_A 2 VRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDD-KHIIVDGKKIATYQERDP 80 (332)
T ss_dssp CEEEEECCSHHHHHHHHHHHHSTTCEEEEEECTTCCHHHHHHHHHCCTTTCSCSSCEEECS-SEEEETTEEEEEECCSSG
T ss_pred eEEEEECCCcHHHHHHHHHHhCCCcEEEEEeCCCCCHHHHHHHhcccCCCCCCCCcEEEcC-CEEEECCEEEEEEeeccc
Confidence 7999999999999999999999899999999998999999999999999999999999975 699999999999999999
Q ss_pred CCCCCCccCccEEEeccCCCCCHHHHHHHHHCCCCEEEEcCCCCCCCeEEeecCccCCCCCCCeEecCChhhhhhHHHHH
Q 016451 170 AEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAK 249 (389)
Q Consensus 170 ~~i~W~~~gvD~VvEsTG~f~t~e~a~~hl~aGaKkVIISaps~D~pt~V~GVN~~~y~~~~~IISnaSCTTncLAPvlk 249 (389)
+++||+++|+||||||||.|+++|+|++|+++||||||||+|++|+|||||||||++|+++++||||||||||||+|++|
T Consensus 81 ~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d~p~vV~gVN~~~~~~~~~IISnasCTTn~Lap~lk 160 (332)
T 3pym_A 81 ANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAK 160 (332)
T ss_dssp GGSCTTTTTCSEEEECSSSSCSHHHHHHHHHTTCSEEEESSCCSSSCBCCTTTTGGGCCTTCCEEECCCHHHHHHHHHHH
T ss_pred ccCCccccCccEEEEecccccCHHHHHHHHHcCCCEEEECCCCCCCCeEeeccchhhcCccccEEecCcchhhhhHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999888999999999999999999
Q ss_pred HHHhhcCceEEeeecccccCCCcccccCCCCCCCCCCcccccccccCCCCCCC---------------------------
Q 016451 250 VVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK--------------------------- 302 (389)
Q Consensus 250 vL~d~fGI~~g~mTTVHA~T~tQ~lvD~p~~kd~R~~Raaa~NIIPtsTGaak--------------------------- 302 (389)
+|||+|||++++||||||+|++|+++|+|+++||||+|++++||||++||++|
T Consensus 161 vL~d~fGI~~g~mTTvha~T~~Q~~vDg~~~kd~r~~r~aa~NiIP~~tGaakav~kVlPeL~gkltg~avRVPv~~~s~ 240 (332)
T 3pym_A 161 VINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSV 240 (332)
T ss_dssp HHHHHHCEEEEEEEEEEECCTTSCSSSCCCTTCTGGGSCGGGCCEEEECSHHHHHHHHSGGGTTSEEEEEEEESCSSCEE
T ss_pred HHHHhcCeEEEEEEEEeeccccchhccCCCcccCccccchhhcccCCCCChHHHHHHhhhhhcCCEEEEEEEcCCCCcEe
Confidence 99999999999999999999999999999879999999999999999999988
Q ss_pred ---------CCCHHHHHHHHHHhhcCCCCcccCccccceEeccCCCCCcceEEeCCCcccccCCeEEEEEEeCCCCchhh
Q 016451 303 ---------GASYEDVKAAIKYASEGSLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNEWGYSN 373 (389)
Q Consensus 303 ---------~~~~e~In~~~k~as~g~lkgil~yte~~~VS~Df~g~~~Ssi~D~~~t~~~~~~~vKl~~WYDNE~GYs~ 373 (389)
++++||||++||+|+||+|||||+|||||+||+||+||+||||||+.+|++++++|+||++||||||||||
T Consensus 241 ~dlt~~lek~~t~eei~~~lk~a~~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~~~~~~~~~vk~~~WYDNE~gys~ 320 (332)
T 3pym_A 241 VDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYST 320 (332)
T ss_dssp EEEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCCSEEEEGGGCEEEETTEEEEEEEECTTHHHHH
T ss_pred eEEEEEECCcCCHHHHHHHHHHhccCccCceeEEEcCCeEeeccCCCCcceEEccccccccCCCEEEEEEEECCccchHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHH
Q 016451 374 RVLDLIEHMAL 384 (389)
Q Consensus 374 R~vdl~~~~~~ 384 (389)
||+||+.||++
T Consensus 321 r~~dl~~~~~~ 331 (332)
T 3pym_A 321 RVVDLVEHVAK 331 (332)
T ss_dssp HHHHHHHHHHH
T ss_pred HHHHHHHHHhc
Confidence 99999999975
|
| >3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* | Back alignment and structure |
|---|
| >2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 389 | ||||
| d1dssg1 | 169 | c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp | 1e-75 | |
| d1u8fo1 | 169 | c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp | 4e-74 | |
| d1rm4a1 | 172 | c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp | 4e-68 | |
| d1hdgo1 | 169 | c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp | 1e-66 | |
| d1gado1 | 166 | c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp | 1e-66 | |
| d2b4ro1 | 166 | c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp | 2e-61 | |
| d1k3ta1 | 190 | c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp | 5e-61 | |
| d1u8fo2 | 164 | d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de | 3e-59 | |
| d3cmco1 | 171 | c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp | 1e-58 | |
| d3cmco2 | 163 | d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de | 9e-57 | |
| d1rm4a2 | 163 | d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de | 1e-56 | |
| d2g82a2 | 162 | d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de | 4e-53 | |
| d1cf2o1 | 171 | c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp | 1e-52 | |
| d2g82a1 | 168 | c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp | 3e-51 | |
| d1obfo1 | 173 | c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp | 1e-49 | |
| d1obfo2 | 162 | d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de | 7e-49 | |
| d1k3ta2 | 169 | d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de | 5e-48 | |
| d2czca2 | 172 | c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp | 2e-46 | |
| d1b7go1 | 178 | c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp | 8e-42 | |
| d1cf2o2 | 165 | d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de | 3e-18 | |
| d1b7go2 | 162 | d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de | 3e-16 | |
| d1nvmb1 | 157 | c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge | 6e-04 | |
| d1f06a1 | 170 | c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid de | 0.001 | |
| d1ydwa1 | 184 | c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductas | 0.004 |
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: South China Sea lobster (Palinurus versicolor) [TaxId: 150436]
Score = 229 bits (586), Expect = 1e-75
Identities = 97/168 (57%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
Query: 90 TKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVV 149
+K+GINGFGRIGRLVLR AA VVAVNDPFI +YM YMFKYDSTHG+FKG +
Sbjct: 1 SKIGINGFGRIGRLVLR-AALEMGAQVVAVNDPFIALEYMVYMFKYDSTHGMFKGEVKA- 58
Query: 150 DDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVIS 209
+D L ++GK I VF++ P IPW G +Y+VES+GVFTTI KASAH KGGAKKV+IS
Sbjct: 59 EDGALVVDGKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIIS 118
Query: 210 APSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGI 257
APSADAPMFV GVN + Y +M +VSNAS + ++ +
Sbjct: 119 APSADAPMFVCGVNLEKYSKDMKVVSNASNEFGYSQRVIDLIKHMQKV 166
|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 | Back information, alignment and structure |
|---|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 184 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 389 | |||
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d3cmco1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1gado1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1u8fo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1k3ta1 | 190 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1rm4a1 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2b4ro1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2g82a1 | 168 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1hdgo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1obfo1 | 173 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d3cmco2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1u8fo2 | 164 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1rm4a2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2g82a2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1k3ta2 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1obfo2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1cf2o2 | 165 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.64 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 99.6 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 99.56 | |
| d1b7go2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.53 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 99.4 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 99.18 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 99.09 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.08 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.03 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 98.94 | |
| d1t4ba2 | 221 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 98.63 | |
| d2hjsa2 | 190 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 98.62 | |
| d1mb4a2 | 222 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 98.57 | |
| d2gz1a2 | 202 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 98.46 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 98.26 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 97.79 | |
| d2czca1 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 97.68 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 97.61 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 97.61 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 97.26 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 97.25 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 97.18 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 97.17 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 96.56 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 96.38 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 96.06 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 95.11 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 94.88 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 94.69 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 94.27 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 94.09 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 94.03 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 93.91 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 93.59 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 93.07 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 92.48 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 92.36 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 92.34 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 92.3 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 91.85 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 91.82 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 91.57 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 91.52 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 90.81 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 90.55 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 90.25 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 90.22 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 89.81 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 89.38 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 89.36 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 89.33 | |
| d1q0qa2 | 151 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 89.07 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 89.02 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 88.36 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 88.31 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 88.28 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 88.02 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 87.94 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 87.91 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 87.78 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 86.99 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 86.92 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 86.91 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 86.23 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 86.15 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 86.1 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 85.87 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 85.73 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 85.67 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 85.55 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 85.17 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 84.99 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 84.74 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 84.6 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 84.29 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 83.83 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 83.46 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 82.91 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 82.9 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 82.27 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 81.91 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 81.75 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 81.41 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 81.23 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 80.55 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 80.02 |
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: South China Sea lobster (Palinurus versicolor) [TaxId: 150436]
Probab=100.00 E-value=1.3e-61 Score=437.38 Aligned_cols=167 Identities=57% Similarity=0.920 Sum_probs=162.3
Q ss_pred eEEEeccChhHHHHHHHHHcCCCCcEEEEeCCCCCHHHHhhhhcccccccccCceEEEecCCeeEECCEEEEEEecCCCC
Q 016451 91 KVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPA 170 (389)
Q Consensus 91 kVgINGfGrIGr~vlR~l~~r~~~~iVaINd~~~~~~~layLlkyDSthGkf~~~v~~~~~~~L~inGk~I~v~~~~dp~ 170 (389)
||||||||||||+++|++++++ +++|+|||+..++++++|||+|||+||+|++++++++ +.|.+||++|+++++++|+
T Consensus 2 kIgINGfGRIGR~~~R~~~~~~-~~ivaINd~~~~~~~~~yLlkyDS~hG~~~~~i~~~~-~~l~ing~~I~~~~~~~p~ 79 (169)
T d1dssg1 2 KIGINGFGRIGRLVLRAALEMG-AQVVAVNDPFIALEYMVYMFKYDSTHGMFKGEVKAED-GALVVDGKKITVFNEMKPE 79 (169)
T ss_dssp CEEEECCSHHHHHHHHHHHHHT-CCEEEEECTTSCHHHHHHHHHCCTTTCCCSSCEEEET-TEEEETTEEEEEECCSSGG
T ss_pred eEEEECCcHHHHHHHHHHHhCC-CcEEEECCCCcCHHHHHHHHhcccccCCcCCeEEEeC-CEEEECCEEEEEEecCChH
Confidence 8999999999999999999985 9999999988899999999999999999999999975 6999999999999999999
Q ss_pred CCCCCccCccEEEeccCCCCCHHHHHHHHHCCCCEEEEcCCCCCCCeEEeecCccCCCCCCCeEecCChhhhhhHHHHHH
Q 016451 171 EIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKV 250 (389)
Q Consensus 171 ~i~W~~~gvD~VvEsTG~f~t~e~a~~hl~aGaKkVIISaps~D~pt~V~GVN~~~y~~~~~IISnaSCTTncLAPvlkv 250 (389)
++||+++|+||||||||.|.+.+.+++|+++||||||||||++|+|+||+||||++|+++++||||+|||||||||++|+
T Consensus 80 ~i~W~~~gvD~ViEcTG~f~~~~~~~~hl~~gakkViisaP~~d~~~iV~GVN~~~~~~~~~IIS~aSCTtn~laP~~k~ 159 (169)
T d1dssg1 80 NIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSADAPMFVCGVNLEKYSKDMKVVSNASNEFGYSQRVIDL 159 (169)
T ss_dssp GCCHHHHTCCEEEECSSSCCSHHHHGGGGTTTCSEEEESSCCSSSCBCCTTTSGGGCCTTCCEEECCCTTHHHHHHHHHH
T ss_pred HCCccccCCCEEEecCceEcCHHHHHHHHhcCCceEeecCCccccceeeecccccccCCCCCEEEChhHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999998889999999999999999999
Q ss_pred HHhhcCceE
Q 016451 251 VHEEFGILE 259 (389)
Q Consensus 251 L~d~fGI~~ 259 (389)
||++|||++
T Consensus 160 l~~~fgIe~ 168 (169)
T d1dssg1 160 IKHMQKVDS 168 (169)
T ss_dssp HHHHHHHHT
T ss_pred HHHhcCccc
Confidence 999999985
|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|