Citrus Sinensis ID: 016863


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MLRLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSSFQKVPRSPTPSTGKTPKSDSEMRRKPLGMARDEGELPVRLLADIDSLFLTCQGLSVHYKLCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRSGRYFGP
ccccccEEHHHHHHHHHHccccccHHHHHHHHHHHHHHHHEEEHHHHHHHHHcccccccHHHHHHHccccccccccccccccccccccccHHHHHccccccccccccccccccccccccEEEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEEcccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccc
cccEEEEEEcHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccccHHHcccccEEEEEccEEEEEEEccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEEcccccHccHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccccEEEEEEEEEEEEEEccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccHHHcHHHHHHHccccccccc
MLRLYPMVLTLARQRLHlkkswgmpvLFLSSVVFALGHTVVAYRTSCRARRKLLfhrvdpeavlSCKNVFssfqkvprsptpstgktpksdsemrrkplgmardegelpVRLLADIDSLFLTCQGLsvhyklclpgspprslssttflepkstcntpqtavgrlkLDRQAFSALSktqyhhlprsysiqfhssslyaplldgsattttlsedipilnlddtvpdiemdsgaleqdvegngQFGIILVHGFGGGVFSWRHVMGVLARQIGCtvaafdrpgwgltsrlrqkdweekgsinpykleTQVAIRGVVLLNasfsrevvPGFARILMRTALGkkhlvrpllrTEITQVVNRRAWYDATKLTTEVLSLYKrsgryfgp
MLRLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVfssfqkvprsptpstgktpksdsemrrkplgmardegelpVRLLADIDSLFLTCQGLSVHYKLCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVaafdrpgwgltsrlrqkdweekgsinpykletqVAIRGVVLLNASFSREVVPGFARILMRTalgkkhlvrpllrteitqvvnrrawydatklttevlslykrsgryfgp
MLRLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSSFQKVPRSPTPSTGKTPKSDSEMRRKPLGMARDEGELPVRLLADIDSLFLTCQGLSVHYKLCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRSGRYFGP
***LYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSS***********************************LPVRLLADIDSLFLTCQGLSVHYKLCLP**************************GRLKLDRQAFSALSKTQYHHLPRSYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRS******
**RLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSSFQKV********************************PVRLLADIDSLFLTCQGLSVHYK***********************************************************H**SLYAPLLD***************NLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRSGRYF**
MLRLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSSF*********************RRKPLGMARDEGELPVRLLADIDSLFLTCQGLSVHYKLCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRSGRYFGP
MLRLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSSFQKVP*****************************ELPVRLLADIDSLFLTCQGLSVHYKLCLPG************************************************SYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRSGR****
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRLYPMVLTLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFSSFQKVPRSPTPSTGKTPKSDSEMRRKPLGMARDEGELPVRLLADIDSLFLTCQGLSVHYKLCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQFHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRGVVLLNASFSREVVPGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYKRSGRYFGP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
224058713 659 predicted protein [Populus trichocarpa] 0.950 0.549 0.690 1e-158
225442799 664 PREDICTED: uncharacterized protein LOC10 0.952 0.546 0.700 1e-158
449436102 654 PREDICTED: uncharacterized protein LOC10 0.950 0.553 0.672 1e-152
449519194 654 PREDICTED: uncharacterized protein LOC10 0.950 0.553 0.672 1e-152
224073772 659 predicted protein [Populus trichocarpa] 0.939 0.543 0.671 1e-150
356550586 646 PREDICTED: uncharacterized protein LOC10 0.923 0.544 0.628 1e-137
255553033446 hydrolase, putative [Ricinus communis] g 0.782 0.668 0.778 1e-137
356550588 646 PREDICTED: uncharacterized protein LOC10 0.923 0.544 0.628 1e-137
356557261 646 PREDICTED: uncharacterized protein LOC10 0.923 0.544 0.623 1e-136
356526177 652 PREDICTED: uncharacterized protein LOC10 0.950 0.555 0.612 1e-134
>gi|224058713|ref|XP_002299616.1| predicted protein [Populus trichocarpa] gi|222846874|gb|EEE84421.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 283/410 (69%), Positives = 322/410 (78%), Gaps = 48/410 (11%)

Query: 10  TLARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNV 69
           +++RQ+LHLKKSWGMPVLFLSSVVFALGH+VVAYRTS RARRKL+FHRVDPEAVLSCK+V
Sbjct: 145 SISRQKLHLKKSWGMPVLFLSSVVFALGHSVVAYRTSSRARRKLMFHRVDPEAVLSCKSV 204

Query: 70  FSSFQKVPRSPTPSTGKTPKSDSEMRRKPLGMARDEGELPVRLLADIDSLFLTCQGLSVH 129
           FS +QKVPRSPTP+ G+TPKSDSEM+R+P G  RDEGELPVRLLADIDSLF TC GL+VH
Sbjct: 205 FSGYQKVPRSPTPTAGRTPKSDSEMKRRPFGTTRDEGELPVRLLADIDSLFTTCLGLTVH 264

Query: 130 YKLCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQ 189
           YKLC PG+PPR LSSTT LE  S  ++P+  VGRL+L+RQ FSA++KTQ HHL RSYS Q
Sbjct: 265 YKLCFPGAPPRYLSSTTVLESSSCGSSPKLVVGRLRLERQPFSAVAKTQ-HHLCRSYSNQ 323

Query: 190 FHSSSLYAPLLDGSATTTTLSEDIPILNLDDTVPD---IEMDSGALEQDVEGNGQFGIIL 246
           F+SSSLYAPLL GS  T+ LSE+IP+LNLDD V +    E++S   + D+EGNGQ GI+L
Sbjct: 324 FYSSSLYAPLLGGSP-TSALSEEIPVLNLDDAVQEDGMCELNSVIPKLDMEGNGQLGIVL 382

Query: 247 VHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQ- 305
           VHGFGGGVFSWRHVMGVL+RQ+GC VAAFDRPGWGLTSRLR+KDWE+K   NPYKLETQ 
Sbjct: 383 VHGFGGGVFSWRHVMGVLSRQVGCAVAAFDRPGWGLTSRLRRKDWEDKELPNPYKLETQV 442

Query: 306 ------------------------------------------VAIRGVVLLNASFSREVV 323
                                                     V I+GVVLLN S SREVV
Sbjct: 443 DLLLSFCSEMGFSSVVLVGHDDGGLLALKATQRVQESMTSFNVTIKGVVLLNVSLSREVV 502

Query: 324 PGFARILMRTALGKKHLVRPLLRTEITQVVNRRAWYDATKLTTEVLSLYK 373
           P FARILMRT+LGKKHLVRPLL+TEI QVVNRRAWYDATKLTTE+LSLYK
Sbjct: 503 PAFARILMRTSLGKKHLVRPLLQTEIIQVVNRRAWYDATKLTTEILSLYK 552




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225442799|ref|XP_002285259.1| PREDICTED: uncharacterized protein LOC100242968 [Vitis vinifera] gi|297743373|emb|CBI36240.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436102|ref|XP_004135833.1| PREDICTED: uncharacterized protein LOC101203213 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449519194|ref|XP_004166620.1| PREDICTED: uncharacterized protein LOC101230739 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224073772|ref|XP_002304165.1| predicted protein [Populus trichocarpa] gi|222841597|gb|EEE79144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356550586|ref|XP_003543666.1| PREDICTED: uncharacterized protein LOC100778891 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|255553033|ref|XP_002517559.1| hydrolase, putative [Ricinus communis] gi|223543191|gb|EEF44723.1| hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356550588|ref|XP_003543667.1| PREDICTED: uncharacterized protein LOC100778891 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356557261|ref|XP_003546936.1| PREDICTED: uncharacterized protein LOC100775895 [Glycine max] Back     alignment and taxonomy information
>gi|356526177|ref|XP_003531696.1| PREDICTED: uncharacterized protein LOC100778209 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
TAIR|locus:2037828 648 AT1G15490 [Arabidopsis thalian 0.811 0.476 0.622 4.4e-126
TAIR|locus:2034220 647 AT1G80280 [Arabidopsis thalian 0.808 0.476 0.603 4.6e-120
TAIR|locus:2011476 633 AT1G52750 [Arabidopsis thalian 0.782 0.470 0.498 5.6e-88
TAIR|locus:2082043215 SUE4 "AT3G55880" [Arabidopsis 0.131 0.232 0.62 1.5e-11
TAIR|locus:504956035209 AT2G40095 "AT2G40095" [Arabido 0.131 0.239 0.62 1.9e-11
TAIR|locus:2103242 466 AT3G10840 [Arabidopsis thalian 0.162 0.133 0.461 9.9e-11
TAIR|locus:2037828 AT1G15490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 984 (351.4 bits), Expect = 4.4e-126, Sum P(2) = 4.4e-126
 Identities = 196/315 (62%), Positives = 237/315 (75%)

Query:    12 ARQRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKLLFHRVDPEAVLSCKNVFS 71
             +R+RLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRK+L+HRVDPEAVLSCK++FS
Sbjct:   141 SRKRLHLKKSWGMPVLFLSSVVFALGHTVVAYRTSCRARRKILYHRVDPEAVLSCKSIFS 200

Query:    72 SFQKVPRSPTPSTGKTPKSDSEMRRKPLGMARDEGELPVRLLADIDSLFLTCQGLSVHYK 131
               QKVPRSPTP  GK  K D E RRKPL  + DEGELPVRLLAD+DSLF+T +GL+VHYK
Sbjct:   201 GHQKVPRSPTPVVGKASKFDGEARRKPL--SHDEGELPVRLLADVDSLFVTIRGLTVHYK 258

Query:   132 LCLPGSPPRSLSSTTFLEPKSTCNTPQTAVGRLKLDRQAFSALSKTQYHHLPRSYSIQFH 191
             LC PGSP +S+SS   LE  S+ NTP+   GR K DR+  S ++K+Q+HH  RSY+  F+
Sbjct:   259 LCSPGSPRQSISSNV-LEANSSYNTPEIMAGRSKFDRKVLSMVTKSQHHHHHRSYNSLFN 317

Query:   192 SSSLYAPLLDGSATTTTLSEDIPILNLDDTVPDIEM-DSGALEQDVEGNGQFGIILVHGF 250
             +SSL+ PLLDGS T+  L ++I        V D+ + + GA EQD+  +GQFG++LVHGF
Sbjct:   318 NSSLHDPLLDGSPTSPLLFKEIK--EGTGLVDDMNVFNFGAEEQDLGESGQFGVVLVHGF 375

Query:   251 GGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEKGSINPYKLETQVAIRG 310
             GGGVFSWRHVMG LA+Q+GC V AFDRPGWGLT+R  + D EE+  +NPY LE QV +  
Sbjct:   376 GGGVFSWRHVMGSLAQQLGCVVTAFDRPGWGLTARPHKNDLEERQLLNPYSLENQVEMLI 435

Query:   311 VVLLNASFSREVVPG 325
                    FS  V  G
Sbjct:   436 AFCYEMGFSSVVFVG 450


GO:0005737 "cytoplasm" evidence=ISM
GO:0016787 "hydrolase activity" evidence=ISS
TAIR|locus:2034220 AT1G80280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011476 AT1G52750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082043 SUE4 "AT3G55880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956035 AT2G40095 "AT2G40095" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103242 AT3G10840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 7e-07
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 4e-04
PRK14875 371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 0.002
PLN02578 354 PLN02578, PLN02578, hydrolase 0.002
COG0596 282 COG0596, MhpC, Predicted hydrolases or acyltransfe 0.003
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
 Score = 48.6 bits (116), Expect = 7e-07
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 244 IILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDW 291
           ++L+HG GG   SWR +   LA   G  V A D PG G +    +  +
Sbjct: 1   VVLLHGAGGSAESWRPLAEALAA--GYRVLAPDLPGHGDSDGPPRTPY 46


This family contains alpha/beta hydrolase enzymes of diverse specificity. Length = 187

>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215315 PLN02578, PLN02578, hydrolase Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 381
PLN02824 294 hydrolase, alpha/beta fold family protein 99.48
PRK00870 302 haloalkane dehalogenase; Provisional 99.45
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.43
PRK03592 295 haloalkane dehalogenase; Provisional 99.42
PRK10349 256 carboxylesterase BioH; Provisional 99.41
PLN02679 360 hydrolase, alpha/beta fold family protein 99.38
KOG4178 322 consensus Soluble epoxide hydrolase [Lipid transpo 99.35
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 99.34
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.31
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 99.31
PRK03204 286 haloalkane dehalogenase; Provisional 99.3
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.27
PLN02965 255 Probable pheophorbidase 99.26
PLN02578 354 hydrolase 99.25
PRK10673 255 acyl-CoA esterase; Provisional 99.25
KOG4409 365 consensus Predicted hydrolase/acyltransferase (alp 99.24
PRK06489 360 hypothetical protein; Provisional 99.23
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.23
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 99.23
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 99.18
PLN02211 273 methyl indole-3-acetate methyltransferase 99.15
PRK10749 330 lysophospholipase L2; Provisional 99.14
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.12
PRK05855 582 short chain dehydrogenase; Validated 99.11
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.11
PLN02385 349 hydrolase; alpha/beta fold family protein 99.1
PRK08775 343 homoserine O-acetyltransferase; Provisional 99.08
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.07
PHA02857 276 monoglyceride lipase; Provisional 99.06
PRK07581 339 hypothetical protein; Validated 99.06
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.05
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.03
PLN02298 330 hydrolase, alpha/beta fold family protein 99.01
KOG1454 326 consensus Predicted hydrolase/acyltransferase (alp 98.97
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.96
PLN02894 402 hydrolase, alpha/beta fold family protein 98.9
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.87
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 98.84
PLN02652 395 hydrolase; alpha/beta fold family protein 98.81
KOG2564 343 consensus Predicted acetyltransferases and hydrola 98.81
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.79
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 98.76
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.75
PLN02511 388 hydrolase 98.72
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.7
COG1647243 Esterase/lipase [General function prediction only] 98.68
PRK10985 324 putative hydrolase; Provisional 98.58
PRK10566249 esterase; Provisional 98.54
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 98.53
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.52
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.49
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.49
PRK11071190 esterase YqiA; Provisional 98.49
KOG2984277 consensus Predicted hydrolase [General function pr 98.42
KOG2382 315 consensus Predicted alpha/beta hydrolase [General 98.37
PRK05077414 frsA fermentation/respiration switch protein; Revi 98.37
PLN00021 313 chlorophyllase 98.34
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.3
PRK13604 307 luxD acyl transferase; Provisional 98.27
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.2
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 98.16
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 98.15
PLN02872 395 triacylglycerol lipase 98.02
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.97
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.9
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 97.83
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 97.81
PRK07868 994 acyl-CoA synthetase; Validated 97.75
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 97.69
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 97.65
PRK11460232 putative hydrolase; Provisional 97.5
KOG2565 469 consensus Predicted hydrolases or acyltransferases 97.46
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.24
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.22
PRK10162318 acetyl esterase; Provisional 97.21
PRK06765 389 homoserine O-acetyltransferase; Provisional 97.15
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.08
KOG1552258 consensus Predicted alpha/beta hydrolase [General 97.06
PLN02442283 S-formylglutathione hydrolase 97.01
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 96.95
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 96.95
KOG1838 409 consensus Alpha/beta hydrolase [General function p 96.88
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 96.75
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.74
KOG4667269 consensus Predicted esterase [Lipid transport and 96.69
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 96.56
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 96.06
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 96.02
COG4188 365 Predicted dienelactone hydrolase [General function 96.02
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 96.01
COG3319 257 Thioesterase domains of type I polyketide synthase 95.87
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 95.8
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 95.77
COG4757 281 Predicted alpha/beta hydrolase [General function p 95.74
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 95.5
COG0412236 Dienelactone hydrolase and related enzymes [Second 95.44
COG2021 368 MET2 Homoserine acetyltransferase [Amino acid tran 95.37
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 95.23
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 94.91
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 94.75
COG3208244 GrsT Predicted thioesterase involved in non-riboso 94.47
KOG3975 301 consensus Uncharacterized conserved protein [Funct 94.43
COG0657312 Aes Esterase/lipase [Lipid metabolism] 94.11
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 93.89
COG0400207 Predicted esterase [General function prediction on 93.59
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 93.54
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 93.34
COG2945210 Predicted hydrolase of the alpha/beta superfamily 93.3
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 93.15
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 93.09
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 93.04
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 92.82
KOG1553 517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 92.56
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 92.47
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 92.42
KOG3847 399 consensus Phospholipase A2 (platelet-activating fa 92.13
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 91.82
PF06441112 EHN: Epoxide hydrolase N terminus; InterPro: IPR01 91.78
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 91.72
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 91.37
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 91.09
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 90.3
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 89.84
KOG2931 326 consensus Differentiation-related gene 1 protein ( 89.69
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 89.61
KOG2624 403 consensus Triglyceride lipase-cholesterol esterase 89.61
PF03096 283 Ndr: Ndr family; InterPro: IPR004142 This family c 88.82
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 88.8
PF10503220 Esterase_phd: Esterase PHB depolymerase 87.32
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 86.97
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 86.0
PRK10115686 protease 2; Provisional 85.95
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 85.55
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 85.43
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 85.28
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 83.78
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 83.69
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 83.27
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 82.23
COG2936 563 Predicted acyl esterases [General function predict 82.17
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
Probab=99.48  E-value=5.8e-14  Score=134.26  Aligned_cols=101  Identities=22%  Similarity=0.272  Sum_probs=78.5

Q ss_pred             cccceEEEEEEcCCCCceEEEeCCCCCChHHHHHHHHHhhccCCcEEEEEcCCCCCCCCCCCCC------Cccccc-ccC
Q 016863          226 EMDSGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQK------DWEEKG-SIN  298 (381)
Q Consensus       226 ~~~~v~l~y~~~G~~~ppVVLLHG~~~s~~~w~~l~~~La~~~G~rVia~DlpG~G~S~~p~~~------d~~~~~-l~d  298 (381)
                      ...+++++|...|+++++|||+||++++...|+.+++.|+++  ++||++|+||||.|+.+...      .+..++ ..+
T Consensus        14 ~~~~~~i~y~~~G~~~~~vlllHG~~~~~~~w~~~~~~L~~~--~~vi~~DlpG~G~S~~~~~~~~~~~~~~~~~~~a~~   91 (294)
T PLN02824         14 RWKGYNIRYQRAGTSGPALVLVHGFGGNADHWRKNTPVLAKS--HRVYAIDLLGYGYSDKPNPRSAPPNSFYTFETWGEQ   91 (294)
T ss_pred             EEcCeEEEEEEcCCCCCeEEEECCCCCChhHHHHHHHHHHhC--CeEEEEcCCCCCCCCCCccccccccccCCHHHHHHH
Confidence            345678999999965679999999999999999999999987  89999999999999876422      121111 223


Q ss_pred             ccChhhhcCcccEEEEcCCCCCccHHHHHH
Q 016863          299 PYKLETQVAIRGVVLLNASFSREVVPGFAR  328 (381)
Q Consensus       299 ~~~l~~~v~V~~lVLVG~S~GG~iap~~a~  328 (381)
                      ..++.+.+.+++++|+|+|+||.++..++.
T Consensus        92 l~~~l~~l~~~~~~lvGhS~Gg~va~~~a~  121 (294)
T PLN02824         92 LNDFCSDVVGDPAFVICNSVGGVVGLQAAV  121 (294)
T ss_pred             HHHHHHHhcCCCeEEEEeCHHHHHHHHHHH
Confidence            334455558899999999999988766653



>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF06441 EHN: Epoxide hydrolase N terminus; InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 7e-09
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 7e-08
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 4e-07
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 6e-07
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 7e-07
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 7e-07
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 1e-06
1iup_A 282 META-cleavage product hydrolase; aromatic compound 1e-06
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 2e-06
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 3e-06
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 4e-06
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 5e-06
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 7e-06
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 7e-06
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 8e-06
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 1e-05
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 1e-05
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 1e-05
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 2e-05
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 2e-05
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 2e-05
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 2e-05
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 4e-05
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 5e-05
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 5e-05
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 6e-05
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 8e-05
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 9e-05
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 1e-04
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 1e-04
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 2e-04
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 2e-04
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 2e-04
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 3e-04
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 3e-04
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 3e-04
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 4e-04
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 4e-04
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 4e-04
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 5e-04
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 6e-04
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 6e-04
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 7e-04
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 8e-04
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
 Score = 55.1 bits (133), Expect = 7e-09
 Identities = 10/44 (22%), Positives = 14/44 (31%)

Query: 244 IILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLR 287
           II +HG      S       L+          D PG G +  + 
Sbjct: 24  IIFLHGLSLDKQSTCLFFEPLSNVGQYQRIYLDLPGMGNSDPIS 67


>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.63
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.58
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.56
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.56
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 99.55
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 99.55
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 99.55
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.55
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.54
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.54
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.54
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.53
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.53
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 99.52
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.52
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.52
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 99.51
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.51
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.49
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.49
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.48
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.48
1iup_A 282 META-cleavage product hydrolase; aromatic compound 99.48
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 99.47
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.46
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 99.46
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.46
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.45
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.45
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.44
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.44
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.43
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.41
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 99.39
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.39
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.39
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.39
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.38
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.38
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 99.38
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.37
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.37
1r3d_A 264 Conserved hypothetical protein VC1974; structural 99.37
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.36
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.35
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.33
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 99.32
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 99.32
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.32
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.31
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.3
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.29
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.29
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.96
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.28
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.28
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.28
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.28
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.27
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 99.27
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.27
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.27
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 99.26
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.25
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.25
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.25
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 99.24
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.21
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 99.21
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.21
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.2
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 99.19
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.19
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.19
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 99.19
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 99.17
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.17
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.16
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.15
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 99.15
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.14
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.13
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.12
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.09
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.08
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.06
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.03
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.03
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.03
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.01
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.0
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.98
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 98.98
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.97
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.97
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.95
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.92
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 98.89
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.85
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.84
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.8
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 98.8
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.74
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 98.72
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 98.7
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.69
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.68
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.66
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.66
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.64
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.64
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 98.64
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.63
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.62
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.62
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.6
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.59
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.58
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.56
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.56
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.56
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.54
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 98.53
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.53
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.53
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.53
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.52
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.52
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.51
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.51
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.51
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.5
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.48
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.47
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.47
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.44
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 98.44
3h04_A 275 Uncharacterized protein; protein with unknown func 98.44
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.43
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.43
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.42
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.41
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.4
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.4
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.4
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.38
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.38
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.38
3lp5_A250 Putative cell surface hydrolase; structural genom 98.37
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.36
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.35
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.34
3ain_A323 303AA long hypothetical esterase; carboxylesterase 98.34
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.34
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.33
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.33
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.32
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.3
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.29
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.27
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.26
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.26
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.25
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.23
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 98.23
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.21
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.2
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.12
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.12
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 98.12
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 98.1
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 98.1
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.09
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 98.09
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.09
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.08
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.07
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 98.05
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.04
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.04
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.01
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.01
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.99
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 97.99
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 97.97
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.94
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.94
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.93
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.92
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 97.92
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.91
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 97.89
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 97.89
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.89
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 97.84
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 97.78
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.59
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.57
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.51
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.51
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 97.51
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.49
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 97.45
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 97.45
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.43
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 97.39
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 97.37
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 97.3
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.26
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.26
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.23
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.23
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.18
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.12
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 96.79
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.74
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 96.72
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 96.69
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 96.24
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 96.23
4f21_A246 Carboxylesterase/phospholipase family protein; str 95.71
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 95.59
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 95.54
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 94.32
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 94.16
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 93.67
1ivy_A 452 Human protective protein; carboxypeptidase, serine 92.04
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 90.03
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 89.94
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 87.75
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 86.23
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 85.01
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 84.47
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 83.88
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 83.47
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 82.18
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 82.11
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 81.23
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 80.61
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 80.18
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
Probab=99.63  E-value=1.8e-16  Score=148.14  Aligned_cols=99  Identities=13%  Similarity=0.135  Sum_probs=80.8

Q ss_pred             ccceEEEEEEc--CCCCceEEEeCCCCCChHHHHHHHHHhhccCCcEEEEEcCCCCCCCCCCCCCCcccc-cccCccChh
Q 016863          227 MDSGALEQDVE--GNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDWEEK-GSINPYKLE  303 (381)
Q Consensus       227 ~~~v~l~y~~~--G~~~ppVVLLHG~~~s~~~w~~l~~~La~~~G~rVia~DlpG~G~S~~p~~~d~~~~-~l~d~~~l~  303 (381)
                      ..+++++|...  |.++|+||||||++++...|+.+++.|+++  |+||++|+||||.|+.+.. .|... ...|...+.
T Consensus        11 ~~g~~l~y~~~~~G~~~p~vvllHG~~~~~~~w~~~~~~L~~~--~rvia~DlrGhG~S~~~~~-~~~~~~~a~dl~~ll   87 (276)
T 2wj6_A           11 VFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDAD--FRVIVPNWRGHGLSPSEVP-DFGYQEQVKDALEIL   87 (276)
T ss_dssp             ETTEEEEEEECCCCCSSCEEEEECCTTCCGGGGHHHHHHHTTT--SCEEEECCTTCSSSCCCCC-CCCHHHHHHHHHHHH
T ss_pred             eCCeEEEEEEecCCCCCCeEEEECCCCCcHHHHHHHHHHHhcC--CEEEEeCCCCCCCCCCCCC-CCCHHHHHHHHHHHH
Confidence            45678999998  877789999999999999999999999876  9999999999999987643 23221 223445666


Q ss_pred             hhcCcccEEEEcCCCCCccHHHHHH
Q 016863          304 TQVAIRGVVLLNASFSREVVPGFAR  328 (381)
Q Consensus       304 ~~v~V~~lVLVG~S~GG~iap~~a~  328 (381)
                      +.+++++++|+|||+||.++..++.
T Consensus        88 ~~l~~~~~~lvGhSmGG~va~~~A~  112 (276)
T 2wj6_A           88 DQLGVETFLPVSHSHGGWVLVELLE  112 (276)
T ss_dssp             HHHTCCSEEEEEEGGGHHHHHHHHH
T ss_pred             HHhCCCceEEEEECHHHHHHHHHHH
Confidence            6779999999999999988877774



>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 381
d1xkla_ 258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 7e-08
d3c70a1 256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 9e-08
d1m33a_ 256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 1e-07
d1pjaa_ 268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 2e-07
d1brta_ 277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 9e-07
d1tqha_242 c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea 3e-06
d1mj5a_ 298 c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona 3e-06
d1a8qa_ 274 c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au 1e-05
d1hkha_ 279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 1e-05
d1uk8a_ 271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 4e-05
d1mtza_ 290 c.69.1.7 (A:) Tricorn interacting factor F1 {Archa 5e-05
d1q0ra_ 297 c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { 6e-05
d1bn7a_ 291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 6e-05
d1va4a_ 271 c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce 7e-05
d1cvla_ 319 c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T 7e-05
d1a8sa_ 273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 1e-04
d1ehya_ 293 c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba 1e-04
d1r3da_ 264 c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio 1e-04
d1ex9a_ 285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 2e-04
d2rhwa1 283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 3e-04
d1xkta_ 286 c.69.1.22 (A:) Fatty acid synthase {Human (Homo sa 3e-04
d1a88a_ 275 c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li 5e-04
d1wm1a_ 313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 5e-04
d1ispa_179 c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 5e-04
d1zd3a2 322 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, 6e-04
d1c4xa_ 281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 0.001
d1azwa_ 313 c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas 0.002
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Hydroxynitrile lyase-like
domain: Salicylic acid-binding protein 2 (SABP2)
species: Common tobacco (Nicotiana tabacum) [TaxId: 4097]
 Score = 50.7 bits (119), Expect = 7e-08
 Identities = 14/48 (29%), Positives = 20/48 (41%), Gaps = 1/48 (2%)

Query: 244 IILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKDW 291
            +LVHG   G +SW  +  +L    G  V A D    G   R  ++  
Sbjct: 5   FVLVHGACHGGWSWYKLKPLLEAA-GHKVTALDLAASGTDLRKIEELR 51


>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274 Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290 Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 286 Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.56
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.56
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.55
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.54
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.52
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.52
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.52
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.52
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.52
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.51
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.5
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.5
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 99.49
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.48
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.47
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.46
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.45
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.44
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.43
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 99.43
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 99.41
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.39
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 99.38
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.38
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.35
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.34
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.31
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.29
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.19
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.99
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.88
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.87
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.86
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.74
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.73
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.72
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.65
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.61
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.44
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.41
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.35
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.33
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.29
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.05
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.96
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 97.79
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.7
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 97.48
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.44
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.39
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.35
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.33
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.22
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.0
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 96.87
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 96.75
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 96.73
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 96.64
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 96.58
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 96.52
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 96.29
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 96.03
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 96.01
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 95.99
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 95.63
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 95.54
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 95.31
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 95.08
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 94.85
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 94.8
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 94.71
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 94.56
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 94.5
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 93.36
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 93.16
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 88.96
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 86.78
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 84.78
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 82.48
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Epoxide hydrolase
domain: Mammalian epoxide hydrolase, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.56  E-value=8.3e-16  Score=139.43  Aligned_cols=98  Identities=22%  Similarity=0.304  Sum_probs=78.5

Q ss_pred             ceEEEEEEcCCCCceEEEeCCCCCChHHHHHHHHHhhccCCcEEEEEcCCCCCCCCCCCCCC-ccccc-ccCccChhhhc
Q 016863          229 SGALEQDVEGNGQFGIILVHGFGGGVFSWRHVMGVLARQIGCTVAAFDRPGWGLTSRLRQKD-WEEKG-SINPYKLETQV  306 (381)
Q Consensus       229 ~v~l~y~~~G~~~ppVVLLHG~~~s~~~w~~l~~~La~~~G~rVia~DlpG~G~S~~p~~~d-~~~~~-l~d~~~l~~~v  306 (381)
                      ++++||.+.|+| |+|||+||++++...|+.+++.|+++ ||+||++|+||||.|+.+.... +..+. ..+...+.+.+
T Consensus        21 g~~i~y~~~G~g-p~vlllHG~~~~~~~~~~~~~~L~~~-g~~vi~~D~~G~G~S~~~~~~~~~~~~~~~~~i~~l~~~l   98 (322)
T d1zd3a2          21 RVRLHFVELGSG-PAVCLCHGFPESWYSWRYQIPALAQA-GYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKL   98 (322)
T ss_dssp             TEEEEEEEECCS-SEEEEECCTTCCGGGGTTHHHHHHHT-TCEEEEEECTTSTTSCCCSCGGGGSHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEEEcCC-CeEEEECCCCCCHHHHHHHHHHHHHC-CCEEEEeccccccccccccccccccccccchhhhhhhhcc
Confidence            678999999965 69999999999999999999999986 8999999999999998865432 22111 12223455566


Q ss_pred             CcccEEEEcCCCCCccHHHHHH
Q 016863          307 AIRGVVLLNASFSREVVPGFAR  328 (381)
Q Consensus       307 ~V~~lVLVG~S~GG~iap~~a~  328 (381)
                      .+++++++|+|+||.++..++.
T Consensus        99 ~~~~~~lvGhS~Gg~va~~~a~  120 (322)
T d1zd3a2          99 GLSQAVFIGHDWGGMLVWYMAL  120 (322)
T ss_dssp             TCSCEEEEEETHHHHHHHHHHH
T ss_pred             cccccccccccchHHHHHHHHH
Confidence            8999999999999987766664



>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure