Citrus Sinensis ID: 016866


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MFVLRETAWCRMINVKTTFREDYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEccccHHHHHHHHHHccccEEEEEEcccccEEEEccHHHHHHHHHHHccccccccHHHHHHcHHHHHHHHHHHHHHcccccccccccccccEEccccccHHHHHHHHHHccccEEEEEccccccccccEEEEEEcHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEcccHHHHHccccccccccccccHHHHHHHcccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEHHHHHHHHHcc
ccEEEHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEcccccEEEEEEccHHHHHHHHHHHHcccEEcccccccccEEEEEEEHHHHHHHHHHHHcccccccHHHHHHccHHHHHHHHHHHccHHHHHHHcccccccEEEEccccHHHHHHHHHHHHccccccEEcccccccccccEEEEEcHHHHHHHHHHHHHccccccHHHcccHHHcccccEcccccccccccEEEEccccHHHHHHHHHHHHcccEcEEEccccEEEEHHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHcccEEEEEEEccccEEEEEEEHHHHHHHHHcc
MFVLRETAWCRMINVKTTFREDYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYEllpdsgkvtaLDVNLAVKQAFHVLYeqglpmvplwddfkgRFVGVLSALDFILILRElgtngsnlteeeLETHTISAWKVGKLQLNLKrqmdgngrpcprplvqagpydsLKEVALKILQnkvatvpiihstgpagscqEILYLASLSDILKCICRhfkhsssslpilqqpvssiqlgtwvprigeangrpfamlrPTASLGSALALLVQadvssipivddndslldiysrsDITALAKDKAYAQIHLDEMNIHQALqlgqdanpslgfngqrcqmclrsdpLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
mfvlretawcrminvkttfredYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSsipivddndslLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMErlanpgvrRLVIVEagskrvegiislsdVFRFLLGV
MFVLRETAWCRMINVKTTFREDYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
*FVLRETAWCRMINVKTTFREDYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKR**********RPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLL**
MFVLR**************************************DRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQ*********GFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
MFVLRETAWCRMINVKTTFREDYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
MFVLRETAWCRMINVKTTFREDYLDRT*EGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVLRETAWCRMINVKTTFREDYLDRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query381 2.2.26 [Sep-21-2011]
Q944A6487 Sucrose nonfermenting 4-l yes no 0.931 0.728 0.768 1e-155
P58108330 5'-AMP-activated protein yes no 0.769 0.887 0.320 4e-33
P54619331 5'-AMP-activated protein yes no 0.769 0.885 0.320 4e-33
Q09138330 5'-AMP-activated protein yes no 0.769 0.887 0.320 4e-33
O54950330 5'-AMP-activated protein yes no 0.769 0.887 0.320 5e-33
P80385330 5'-AMP-activated protein yes no 0.769 0.887 0.317 1e-32
Q8T277577 5'-AMP-activated protein yes no 0.818 0.540 0.292 2e-30
Q91WG5566 5'-AMP-activated protein no no 0.763 0.514 0.301 9e-30
Q9UGJ0569 5'-AMP-activated protein no no 0.763 0.511 0.301 2e-29
Q5R4S0524 5'-AMP-activated protein no no 0.763 0.555 0.298 8e-29
>sp|Q944A6|SNF4_ARATH Sucrose nonfermenting 4-like protein OS=Arabidopsis thaliana GN=SNF4 PE=1 SV=1 Back     alignment and function desciption
 Score =  548 bits (1413), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/358 (76%), Positives = 310/358 (86%), Gaps = 3/358 (0%)

Query: 25  DRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQ 84
           D + E   + S  DL+LSR RIS  LST T YELLP+SGKV ALDVNL VKQAFH+LYEQ
Sbjct: 132 DPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVNLPVKQAFHILYEQ 191

Query: 85  GLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNL 144
           G+P+ PLWD  KG+FVGVL  LDFILILRELGT+GSNLTEEELETHTI+AWK GK  ++ 
Sbjct: 192 GIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHTIAAWKEGKAHIS- 250

Query: 145 KRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASL 204
            RQ DG+GRP PRPLVQ GPYD+LK+VALKILQNKVA VP+I+S+   GS  ++L+LASL
Sbjct: 251 -RQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSLQDGSYPQLLHLASL 309

Query: 205 SDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALAL 264
           S ILKCICR+F+HSSSSLPILQQP+ SI LGTWVPRIGE++ +P A LRP ASLGSALAL
Sbjct: 310 SGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALAL 369

Query: 265 LVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSL 324
           LVQA+VSSIP+VDDNDSL+DIYSRSDITALAKDKAYAQIHLD+M +HQALQLGQDA+P  
Sbjct: 370 LVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDASPPY 429

Query: 325 G-FNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV 381
           G FNGQRC MCLRSD L KVMERLANPGVRRLVIVEAGSKRVEGIISLSDVF+FLLG+
Sbjct: 430 GIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLGL 487




Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.
Arabidopsis thaliana (taxid: 3702)
>sp|P58108|AAKG1_BOVIN 5'-AMP-activated protein kinase subunit gamma-1 OS=Bos taurus GN=PRKAG1 PE=2 SV=2 Back     alignment and function description
>sp|P54619|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens GN=PRKAG1 PE=1 SV=1 Back     alignment and function description
>sp|Q09138|AAKG1_PIG 5'-AMP-activated protein kinase subunit gamma-1 OS=Sus scrofa GN=PRKAG1 PE=1 SV=2 Back     alignment and function description
>sp|O54950|AAKG1_MOUSE 5'-AMP-activated protein kinase subunit gamma-1 OS=Mus musculus GN=Prkag1 PE=1 SV=2 Back     alignment and function description
>sp|P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 OS=Rattus norvegicus GN=Prkag1 PE=1 SV=3 Back     alignment and function description
>sp|Q8T277|PRKAG_DICDI 5'-AMP-activated protein kinase subunit gamma OS=Dictyostelium discoideum GN=prkag PE=3 SV=3 Back     alignment and function description
>sp|Q91WG5|AAKG2_MOUSE 5'-AMP-activated protein kinase subunit gamma-2 OS=Mus musculus GN=Prkag2 PE=1 SV=2 Back     alignment and function description
>sp|Q9UGJ0|AAKG2_HUMAN 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4S0|AAKG2_PONAB 5'-AMP-activated protein kinase subunit gamma-2 OS=Pongo abelii GN=PRKAG2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
225450904 488 PREDICTED: sucrose nonfermenting 4-like 0.916 0.715 0.810 1e-161
359487759 482 PREDICTED: sucrose nonfermenting 4-like 0.916 0.724 0.810 1e-161
224123152 488 predicted protein [Populus trichocarpa] 0.926 0.723 0.767 1e-155
9965729382 putative activator subunit of SNF1-relat 0.931 0.929 0.768 1e-154
255542654 540 AMP-activated protein kinase, gamma regu 0.968 0.683 0.752 1e-154
224123752475 predicted protein [Populus trichocarpa] 0.905 0.726 0.775 1e-154
18390971 487 sucrose nonfermenting 4-like protein [Ar 0.931 0.728 0.768 1e-153
312281727 487 unnamed protein product [Thellungiella h 0.931 0.728 0.762 1e-153
297849192479 hypothetical protein ARALYDRAFT_470981 [ 0.934 0.743 0.763 1e-152
449450664 491 PREDICTED: sucrose nonfermenting 4-like 0.926 0.718 0.726 1e-143
>gi|225450904|ref|XP_002284480.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 314/353 (88%), Gaps = 4/353 (1%)

Query: 29  EGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPM 88
           E   + SEADL++SR R+S FLSTH  YELLP+SGKV ALDVNL VKQAFH LYEQG+P+
Sbjct: 139 EVIPRISEADLEVSRHRVSEFLSTHIAYELLPESGKVIALDVNLPVKQAFHTLYEQGIPV 198

Query: 89  VPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQM 148
            PLWD  KG+FVGVLSALDFILILRELG +GSNLTEEELETHTISAWK GKL L   RQ+
Sbjct: 199 APLWDFCKGQFVGVLSALDFILILRELGNHGSNLTEEELETHTISAWKEGKLHL---RQI 255

Query: 149 DGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDIL 208
           DG+GR CPR LV AGPYDSLK+V LKILQNKVATVPIIHS    GS  ++L+LASLS IL
Sbjct: 256 DGSGRLCPRHLVHAGPYDSLKDVTLKILQNKVATVPIIHSASQDGSFPQLLHLASLSGIL 315

Query: 209 KCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQA 268
           KCICRHF+HSSSSLPILQQP+ SI +GTWVP+IGE+NG+PFAMLRP ASLG+AL+LLVQA
Sbjct: 316 KCICRHFRHSSSSLPILQQPICSIPVGTWVPKIGESNGQPFAMLRPNASLGAALSLLVQA 375

Query: 269 DVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGF-N 327
           +VSSIPIVDDNDSLLDIYSRSDITALAKD+AYAQIHLD M+IHQALQLGQDAN   GF +
Sbjct: 376 EVSSIPIVDDNDSLLDIYSRSDITALAKDRAYAQIHLDNMSIHQALQLGQDANSPYGFIS 435

Query: 328 GQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLG 380
           GQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEG+ISLSDVFRFLLG
Sbjct: 436 GQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGVISLSDVFRFLLG 488




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359487759|ref|XP_003633645.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform 2 [Vitis vinifera] gi|296088362|emb|CBI36807.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123152|ref|XP_002319007.1| predicted protein [Populus trichocarpa] gi|222857383|gb|EEE94930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|9965729|gb|AAG10141.1|AF250335_1 putative activator subunit of SNF1-related protein kinase SNF4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255542654|ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223548351|gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224123752|ref|XP_002330199.1| predicted protein [Populus trichocarpa] gi|222871655|gb|EEF08786.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18390971|ref|NP_563834.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] gi|75249553|sp|Q944A6.1|SNF4_ARATH RecName: Full=Sucrose nonfermenting 4-like protein; Short=SNF4; AltName: Full=CBS domain-containing protein CBSCBS3; AltName: Full=SNF1-related protein kinase regulatory subunit betagamma; Short=AKIN subunit betagamma; Short=AKINbetagamma gi|16612255|gb|AAL27498.1|AF439826_1 At1g09020/F7G19_11 [Arabidopsis thaliana] gi|23308443|gb|AAN18191.1| At1g09020/F7G19_11 [Arabidopsis thaliana] gi|75037070|gb|ABA12450.1| AKINbetagamma [Arabidopsis thaliana] gi|332190262|gb|AEE28383.1| sucrose nonfermenting 4-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312281727|dbj|BAJ33729.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|297849192|ref|XP_002892477.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. lyrata] gi|297338319|gb|EFH68736.1| hypothetical protein ARALYDRAFT_470981 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449450664|ref|XP_004143082.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] gi|449523153|ref|XP_004168589.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
TAIR|locus:2036079487 SNF4 "homolog of yeast sucrose 0.931 0.728 0.768 2.6e-141
RGD|727782326 Prkag2 "protein kinase, AMP-ac 0.514 0.601 0.285 3.5e-30
UNIPROTKB|F1LLY5528 Prkag2 "Protein Prkag2" [Rattu 0.514 0.371 0.285 1e-28
MGI|MGI:1336153566 Prkag2 "protein kinase, AMP-ac 0.514 0.346 0.285 1.7e-28
UNIPROTKB|Q9UGJ0569 PRKAG2 "5'-AMP-activated prote 0.514 0.344 0.285 4.1e-28
UNIPROTKB|F1NXL4565 PRKAG2 "Uncharacterized protei 0.511 0.345 0.284 4.3e-28
ZFIN|ZDB-GENE-060421-6938342 zgc:136850 "zgc:136850" [Danio 0.506 0.564 0.291 2.7e-27
DICTYBASE|DDB_G0272542577 prkag "AMP-activated protein k 0.433 0.285 0.311 3.1e-26
UNIPROTKB|F1P1P1382 PRKAG3 "Uncharacterized protei 0.514 0.513 0.258 1.4e-24
CGD|CAL0001497336 SNF4 [Candida albicans (taxid: 0.501 0.568 0.262 4.7e-18
TAIR|locus:2036079 SNF4 "homolog of yeast sucrose nonfermenting 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1382 (491.5 bits), Expect = 2.6e-141, P = 2.6e-141
 Identities = 275/358 (76%), Positives = 310/358 (86%)

Query:    25 DRTFEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQ 84
             D + E   + S  DL+LSR RIS  LST T YELLP+SGKV ALDVNL VKQAFH+LYEQ
Sbjct:   132 DPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVNLPVKQAFHILYEQ 191

Query:    85 GLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNL 144
             G+P+ PLWD  KG+FVGVL  LDFILILRELGT+GSNLTEEELETHTI+AWK GK  ++ 
Sbjct:   192 GIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHTIAAWKEGKAHIS- 250

Query:   145 KRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASL 204
              RQ DG+GRP PRPLVQ GPYD+LK+VALKILQNKVA VP+I+S+   GS  ++L+LASL
Sbjct:   251 -RQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSLQDGSYPQLLHLASL 309

Query:   205 SDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALAL 264
             S ILKCICR+F+HSSSSLPILQQP+ SI LGTWVPRIGE++ +P A LRP ASLGSALAL
Sbjct:   310 SGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALAL 369

Query:   265 LVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSL 324
             LVQA+VSSIP+VDDNDSL+DIYSRSDITALAKDKAYAQIHLD+M +HQALQLGQDA+P  
Sbjct:   370 LVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDASPPY 429

Query:   325 G-FNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLLGV 381
             G FNGQRC MCLRSD L KVMERLANPGVRRLVIVEAGSKRVEGIISLSDVF+FLLG+
Sbjct:   430 GIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLGL 487




GO:0005634 "nucleus" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0030295 "protein kinase activator activity" evidence=ISS
GO:0042149 "cellular response to glucose starvation" evidence=IDA
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
RGD|727782 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LLY5 Prkag2 "Protein Prkag2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1336153 Prkag2 "protein kinase, AMP-activated, gamma 2 non-catalytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UGJ0 PRKAG2 "5'-AMP-activated protein kinase subunit gamma-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXL4 PRKAG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060421-6938 zgc:136850 "zgc:136850" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272542 prkag "AMP-activated protein kinase gamma subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1P1 PRKAG3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
CGD|CAL0001497 SNF4 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q944A6SNF4_ARATHNo assigned EC number0.76810.93170.7289yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
cd04641120 cd04641, CBS_pair_28, The CBS domain, named after 7e-37
cd0461898 cd04618, CBS_pair_5, The CBS domain, named after h 1e-19
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 6e-11
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-07
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 3e-07
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 8e-06
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 1e-05
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 2e-05
pfam0057157 pfam00571, CBS, CBS domain 2e-05
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 2e-05
cd04593115 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con 4e-05
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 5e-05
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after h 9e-05
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 2e-04
cd04627123 cd04627, CBS_pair_14, The CBS domain, named after 4e-04
cd04642126 cd04642, CBS_pair_29, The CBS domain, named after 7e-04
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 8e-04
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 0.001
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 0.001
pfam0057157 pfam00571, CBS, CBS domain 0.002
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after h 0.002
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 0.003
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co 0.003
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con 0.003
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after 0.003
cd04635122 cd04635, CBS_pair_22, The CBS domain, named after 0.003
>gnl|CDD|240012 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
 Score =  129 bits (326), Expect = 7e-37
 Identities = 52/134 (38%), Positives = 72/134 (53%), Gaps = 17/134 (12%)

Query: 247 RPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDIYSRSDITALAKDKAYAQIHLD 306
           +  A  RP   L   L +LV+  VS++PIVD+N  ++D+YSR D+  LAK+ AY  + L 
Sbjct: 1   KNIATARPDTPLIDVLDMLVERRVSALPIVDENGKVVDVYSRFDVINLAKEGAYNNLDLT 60

Query: 307 EMNIHQALQLGQDANPSLGFNG-QRCQ--MCLRSDPLHKVMERLANPGVRRLVIVEAGSK 363
                +AL+          F G + C    CLR+     V  R     V RLV+V+   K
Sbjct: 61  VG---EALERRSQ-----DFEGVRTCSPDDCLRTIFDLIVKAR-----VHRLVVVDEN-K 106

Query: 364 RVEGIISLSDVFRF 377
           RVEGIISLSD+ +F
Sbjct: 107 RVEGIISLSDILQF 120


CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 120

>gnl|CDD|239990 cd04618, CBS_pair_5, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 381
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 100.0
COG2524294 Predicted transcriptional regulator, contains C-te 99.79
COG2524294 Predicted transcriptional regulator, contains C-te 99.7
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.69
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.66
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.65
COG3620187 Predicted transcriptional regulator with C-termina 99.65
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.62
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.61
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.61
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.58
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.58
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.58
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.57
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.57
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.57
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.57
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.56
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.55
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.54
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.54
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.54
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.53
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.53
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.53
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.53
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.53
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.53
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.53
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.53
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.52
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.52
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.52
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.52
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.52
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.51
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.51
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.51
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.51
COG2905 610 Predicted signal-transduction protein containing c 99.51
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.5
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.5
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.5
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.5
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.49
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.49
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.49
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.49
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.49
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.49
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.49
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.49
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.49
COG3620187 Predicted transcriptional regulator with C-termina 99.48
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 99.48
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.48
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.48
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.48
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.48
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.48
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.47
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.47
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.47
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.47
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.47
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 99.47
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.47
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.46
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.46
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.46
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.45
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.44
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.44
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.44
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.43
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.43
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.43
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.43
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.43
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.42
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.42
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.42
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.42
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.42
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.41
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.41
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.41
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.41
COG4109 432 Predicted transcriptional regulator containing CBS 99.41
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.4
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.4
COG0517117 FOG: CBS domain [General function prediction only] 99.39
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.39
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.39
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.39
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.38
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.38
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.38
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.38
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.38
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.37
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.37
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.37
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.37
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.37
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.36
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.36
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.36
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.36
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.36
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.35
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.35
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.35
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.35
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.34
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.34
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.34
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.34
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.34
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.34
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.33
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.33
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.33
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.33
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.33
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.33
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.32
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.32
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.32
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.32
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.32
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.31
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.31
COG0517117 FOG: CBS domain [General function prediction only] 99.31
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.3
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.3
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.3
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.29
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.29
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.29
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.29
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.28
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.28
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.28
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.27
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.27
COG2905 610 Predicted signal-transduction protein containing c 99.27
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.27
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.26
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.26
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.26
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.25
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.25
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.25
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.25
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.25
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.25
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.24
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.24
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.24
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.23
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.22
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.22
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.19
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.19
PRK11573413 hypothetical protein; Provisional 99.19
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.19
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.17
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.16
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.15
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.13
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.08
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.06
COG4109432 Predicted transcriptional regulator containing CBS 99.06
COG1253429 TlyC Hemolysins and related proteins containing CB 99.06
PRK11573413 hypothetical protein; Provisional 99.04
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.03
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.01
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.99
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.98
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.97
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.81
COG1253429 TlyC Hemolysins and related proteins containing CB 98.76
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.66
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.65
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.61
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.59
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.55
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.49
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.46
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.45
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.28
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.07
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.06
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 97.96
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.95
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.86
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.81
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 97.63
COG4175386 ProV ABC-type proline/glycine betaine transport sy 97.32
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 96.89
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.81
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 96.14
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 95.39
COG4175386 ProV ABC-type proline/glycine betaine transport sy 94.4
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 93.88
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 91.6
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 86.43
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=6.5e-37  Score=293.10  Aligned_cols=303  Identities=30%  Similarity=0.543  Sum_probs=259.9

Q ss_pred             HHHHHHHHhhhCcccccCCCCccEEEEcCCCCHHHHHHHHHHcCCCeeecccCCCCcEEEEeehHHHHHHHHHhccCCCC
Q 016866           42 SRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSN  121 (381)
Q Consensus        42 ~~~~~~~~l~~~~~~d~~p~s~~vi~ld~~~~v~~A~~~l~~~~i~~~pV~d~~~~~~vGilt~~D~~~il~~~~~~~~~  121 (381)
                      +...++.|+..++||+.+|.+++++.+|..+++.+||++|..++.+++|+||....+++|+++..||+.++..++..+..
T Consensus        55 ~~~~~~~~~~~~~~~~~~p~~~~l~~~d~~~~v~~a~~~l~~~~~~~~p~~~~~~~~~~g~~~~~d~i~~~~~~~~~~~~  134 (381)
T KOG1764|consen   55 AVDTLSKFMKSHTCYDLLPTSSKLVVFDTKLSVKKAFNALVQNGVRAAPLWDSKKQQFVGMLTITDFITVLLRYYKSKSS  134 (381)
T ss_pred             hhHHHHHHHhccCcccccCCcceeEEeeCCCcHHHHHHHHHhhceeeeccccCccceeEEEEEHHHHHHHHHHhhccCCc
Confidence            66899999999999999999999999999999999999999999999999999999999999999999998877764221


Q ss_pred             C-ChhHHhhccHHHHHHHHHhhhccccCCCCCCCCCCCceEeCCCCCHHHHHHHHHhCCcceEEEEecCCCCCCccceEE
Q 016866          122 L-TEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILY  200 (381)
Q Consensus       122 ~-~~~~l~~~~i~~~~~~~~~~~~~~~~~~~g~~~~~~~i~v~~~~sl~~a~~~m~~~~i~~lpVvd~d~~~g~~~~~~g  200 (381)
                      . ..+.++...+..|++.....+         ....++++.+.|..++.++...+.+++++++||.|  .+.+   .+.+
T Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~i~p~~s~l~~~~~l~~~~~~rvpv~d--~~~~---~v~~  200 (381)
T KOG1764|consen  135 LDNIEVLEDSQLSKRREVECLLK---------ETLKPPFVSISPESSLLDAVLLLIKSRIHRVPVID--PETG---EVLY  200 (381)
T ss_pred             HHHHhhhhhhhccccchhhhhhc---------cccCCCceeecCcHHHHHHHHHHHhCCccceeeec--cccc---ceee
Confidence            1 223444444555554422221         12344559999999999999999999999999996  4567   8999


Q ss_pred             EeehhhHHHHHhhhcccCCCCCccccCccccccccccccccccccCCCceEecCCCCHHHHHHHHHhCCCcEEEEEcCCC
Q 016866          201 LASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDND  280 (381)
Q Consensus       201 ils~~dil~~l~~~~~~~~~~~~~~~~~i~~l~ig~~~~~v~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lpVvd~~g  280 (381)
                      ++|++.|++++..+.+..+ ...++..++.++.+|+|.         .+..+..++++.+|+++|.+.+++++||||+.|
T Consensus       201 ilt~~rIl~~l~~~~~~~~-~~~~l~~s~~dl~ig~~~---------~i~~i~~~~~v~~al~~m~~~~is~lpvV~~~g  270 (381)
T KOG1764|consen  201 ILTQRRILKFLWLNGRLLP-LPSLLSKSLSDLGIGTWS---------NIASISEDTPVIEALKIMSERRISALPVVDENG  270 (381)
T ss_pred             ehhHHHHHHHHHHhhcccc-cHHHhhCCHHHhCcchhh---------hheeecCCCcHHHHHHHHHhcCcCcceEEcCCC
Confidence            9999999999999887766 567889999999999997         688999999999999999999999999999999


Q ss_pred             cEEEEEeHHHHHHHHhhhhhccccccccc-HHHHHhcCCCCCCCcccCCCcceEEcCCCCHHHHHHHHHhCCCCEEEEEe
Q 016866          281 SLLDIYSRSDITALAKDKAYAQIHLDEMN-IHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRRLVIVE  359 (381)
Q Consensus       281 ~lvGiis~~Di~~l~~~~~~~~~~~~~~~-v~~~l~~~~~~~~~~~~m~~~~~~v~~~~tl~~~~~~m~~~~~~~l~Vvd  359 (381)
                      ..+|+++..|+..+...+.|....   .+ +.+++..+.       .-..++++|++++||.+++++|..+++||+||||
T Consensus       271 ~~v~~~s~~Dv~~l~~~~~~~~~~---~~~l~~~~~~~~-------~~~~~vvtc~~~ssL~~vi~~lv~~~vHRl~VVd  340 (381)
T KOG1764|consen  271 KKVGNYSRFDVIHLAREGTYNNLD---LSCLSEALSHRP-------IRFEGVVTCRPTSTLAEVIDKLVAHRVHRLWVVD  340 (381)
T ss_pred             ceecceehhhhhhhhhcCccCccc---hhHHHHHhhhcc-------cccCccEEEeecchHHHHHHHHHhcCceEEEEEc
Confidence            999999999999999888776654   45 777776543       2234589999999999999999999999999999


Q ss_pred             CCCCeEEEEEehHHHHHHhh
Q 016866          360 AGSKRVEGIISLSDVFRFLL  379 (381)
Q Consensus       360 ~~~~~liGiIs~~DIl~~l~  379 (381)
                      + +|+++|+||++||+.++.
T Consensus       341 ~-~~~l~GvvSLsDil~~l~  359 (381)
T KOG1764|consen  341 E-DGVLVGVISLSDILSYLV  359 (381)
T ss_pred             C-CCcEEEEeeHHHHHHHHH
Confidence            4 799999999999999985



>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
2v8q_E330 Crystal Structure Of The Regulatory Fragment Of Mam 8e-34
2oox_G333 Crystal Structure Of The Adenylate Sensor From Amp- 6e-24
2qr1_G334 Crystal Structure Of The Adenylate Sensor From Amp- 6e-24
3t4n_C323 Structure Of The Regulatory Fragment Of Saccharomyc 4e-23
2qlv_C315 Crystal Structure Of The Heterotrimer Core Of The S 4e-23
2uv5_A152 Crystal Structure Of A Cbs Domain Pair From The Reg 1e-13
2uv6_A152 Crystal Structure Of A Cbs Domain Pair From The Reg 6e-13
2uv7_A152 Crystal Structure Of A Cbs Domain Pair From The Reg 2e-12
2nyc_A144 Crystal Structure Of The Bateman2 Domain Of Yeast S 2e-08
2nye_A144 Crystal Structure Of The Bateman2 Domain Of Yeast S 6e-07
3fhm_A165 Crystal Structure Of The Cbs-Domain Containing Prot 6e-04
>pdb|2V8Q|E Chain E, Crystal Structure Of The Regulatory Fragment Of Mammalian Ampk In Complexes With Amp Length = 330 Back     alignment and structure

Iteration: 1

Score = 140 bits (354), Expect = 8e-34, Method: Compositional matrix adjust. Identities = 106/334 (31%), Positives = 166/334 (49%), Gaps = 41/334 (12%) Query: 47 SSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSAL 106 ++F+ +H Y+L+P S K+ D +L VK+AF L G+ PLWD K FVG+L+ Sbjct: 29 TTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTIT 88 Query: 107 DFILILRELGTNGSNLTE-EELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPY 165 DFI IL S L + ELE H I W+ LQ + K PLV P Sbjct: 89 DFINILHRY--YKSALVQIYELEEHKIETWREVYLQDSFK------------PLVCISPN 134 Query: 166 DSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSSSSLPIL 225 SL + +++NK+ +P+I +G+ IL + LK F + Sbjct: 135 ASLFDAVSSLIRNKIHRLPVI--DPESGNTLYILTHKRILKFLKLFITEFPKPE----FM 188 Query: 226 QQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIPIVDDNDSLLDI 285 + + +Q+GT+ AN AM+R T + AL + VQ VS++P+VD+ ++DI Sbjct: 189 SKSLEELQIGTY------AN---IAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI 239 Query: 286 YSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVME 345 YS+ D+ LA +K Y + ++++ +ALQ + S F G C + L ++ Sbjct: 240 YSKFDVINLAAEKTYNNL---DVSVTKALQ-----HRSHYFEG--VLKCYLHETLEAIIN 289 Query: 346 RLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLL 379 RL V RLV+V+ V+GI+SLSD+ + L+ Sbjct: 290 RLVEAEVHRLVVVDEHD-VVKGIVSLSDILQALV 322
>pdb|2OOX|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-activated Protein Kinase Complexed With Amp Length = 333 Back     alignment and structure
>pdb|2QR1|G Chain G, Crystal Structure Of The Adenylate Sensor From Amp-Activated Protein Kinase In Complex With Adp Length = 334 Back     alignment and structure
>pdb|3T4N|C Chain C, Structure Of The Regulatory Fragment Of Saccharomyces Cerevisiae Ampk In Complex With Adp Length = 323 Back     alignment and structure
>pdb|2QLV|C Chain C, Crystal Structure Of The Heterotrimer Core Of The S. Cerevisiae Ampk Homolog Snf1 Length = 315 Back     alignment and structure
>pdb|2NYC|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 Back     alignment and structure
>pdb|2NYE|A Chain A, Crystal Structure Of The Bateman2 Domain Of Yeast Snf4 Length = 144 Back     alignment and structure
>pdb|3FHM|A Chain A, Crystal Structure Of The Cbs-Domain Containing Protein Atu1752 From Agrobacterium Tumefaciens Length = 165 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 5e-73
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 4e-66
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 2e-65
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 1e-35
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 1e-05
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 3e-31
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 3e-05
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 2e-04
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 7e-28
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 5e-07
3ddj_A296 CBS domain-containing protein; structural genomics 1e-20
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 6e-12
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 2e-10
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 3e-10
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 7e-10
1pvm_A184 Conserved hypothetical protein TA0289; structural 7e-10
1pvm_A184 Conserved hypothetical protein TA0289; structural 3e-04
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 8e-10
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 3e-05
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 8e-10
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 1e-09
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 2e-09
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 8e-04
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 1e-08
4fry_A157 Putative signal-transduction protein with CBS DOM; 1e-08
1o50_A157 CBS domain-containing predicted protein TM0935; CB 3e-08
1o50_A157 CBS domain-containing predicted protein TM0935; CB 3e-05
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 1e-07
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 9e-05
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 1e-07
2o16_A160 Acetoin utilization protein ACUB, putative; struct 1e-07
1pbj_A125 Hypothetical protein; structural genomics, domain, 2e-07
1pbj_A125 Hypothetical protein; structural genomics, domain, 3e-05
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 3e-07
1vr9_A213 CBS domain protein/ACT domain protein; structural 1e-06
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 2e-06
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 5e-06
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 3e-04
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 7e-06
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 1e-05
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 4e-05
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3lqn_A150 CBS domain protein; csgid, structural genomics, un 2e-05
3lqn_A150 CBS domain protein; csgid, structural genomics, un 2e-04
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 4e-05
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 6e-05
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 8e-05
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 1e-04
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 3e-04
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 9e-04
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
 Score =  229 bits (586), Expect = 5e-73
 Identities = 73/345 (21%), Positives = 155/345 (44%), Gaps = 36/345 (10%)

Query: 36  EADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDF 95
           +   + +   I +F+ + T Y++LP S ++   DV L VK +  +L    +   PLWD  
Sbjct: 5   QETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSE 64

Query: 96  KGRFVGVLSALDFILILRELGTNGSNLTE-EELETHTISAWKVGKLQLNLKRQMDGNGRP 154
             +F G+L+  DF+ +++    + S      E++   +   +  + ++            
Sbjct: 65  ANKFAGLLTMADFVNVIKYYYQSSSFPEAIAEIDKFRLLGLREVERKIGAI--------- 115

Query: 155 CPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRH 214
            P   +   P  SL +  L + +++   +P+I   G  GS + I+ + +   ILK I  +
Sbjct: 116 -PPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGETGS-EMIVSVLTQYRILKFISMN 173

Query: 215 FKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP 274
            K       +L+ P++ + +GTW                    +   + +L + ++S++P
Sbjct: 174 CKE----TAMLRVPLNQMTIGTWSNLA---------TASMETKVYDVIKMLAEKNISAVP 220

Query: 275 IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMC 334
           IV+   +LL++Y   D+  L +D  Y+ + L   ++ +AL                   C
Sbjct: 221 IVNSEGTLLNVYESVDVMHLIQDGDYSNLDL---SVGEALLKRPANFD-------GVHTC 270

Query: 335 LRSDPLHKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFRFLL 379
             +D L  + + + +  V RL +V+  + ++EGI+SL+D+  +++
Sbjct: 271 RATDRLDGIFDAIKHSRVHRLFVVDE-NLKLEGILSLADILNYII 314


>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 100.0
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 100.0
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 100.0
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 100.0
3ddj_A296 CBS domain-containing protein; structural genomics 100.0
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.97
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.92
3ddj_A296 CBS domain-containing protein; structural genomics 99.9
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.88
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.88
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.86
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.86
4esy_A170 CBS domain containing membrane protein; structural 99.84
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.8
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.8
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.79
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.78
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.78
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.78
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.78
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.77
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.77
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.77
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.76
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.76
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.76
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.76
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.76
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.76
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.76
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.76
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.75
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.75
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.75
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.75
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.75
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.75
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.74
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.74
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.74
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.73
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.73
4esy_A170 CBS domain containing membrane protein; structural 99.73
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.73
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.73
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.72
3ocm_A173 Putative membrane protein; structural genomics, PS 99.72
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.72
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.72
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.72
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.71
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.7
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.69
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.69
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.68
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.68
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.68
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.68
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.67
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.67
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.66
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.65
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.64
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.64
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.64
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.63
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.63
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.63
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.63
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.62
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.62
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.62
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.62
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.61
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.61
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.61
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.61
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.61
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.61
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.6
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.6
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.59
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.59
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.59
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.59
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.59
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.59
3ocm_A173 Putative membrane protein; structural genomics, PS 99.59
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.58
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.58
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.57
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.57
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.56
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.54
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.54
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.54
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.53
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.53
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.53
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.53
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.52
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.52
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.5
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.49
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.46
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.4
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.4
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.38
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.37
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.35
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.33
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.31
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.29
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.29
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.26
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.25
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.24
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.21
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.19
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.19
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.14
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.12
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 99.04
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.99
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 98.98
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.84
3fio_A70 A cystathionine beta-synthase domain protein fused 98.74
3fio_A70 A cystathionine beta-synthase domain protein fused 98.58
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
Probab=100.00  E-value=2.1e-42  Score=327.74  Aligned_cols=309  Identities=25%  Similarity=0.445  Sum_probs=248.4

Q ss_pred             cHHHHHHHHHHHHHHhhhCcccccCCCCccEEEEcCCCCHHHHHHHHHHcCCCeeecccCCCCcEEEEeehHHHHHHHHH
Q 016866           35 SEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRE  114 (381)
Q Consensus        35 ~~~~~~~~~~~~~~~l~~~~~~d~~p~s~~vi~ld~~~~v~~A~~~l~~~~i~~~pV~d~~~~~~vGilt~~D~~~il~~  114 (381)
                      .+.+.+...+++.+||++++|||+||.+.++++++.+.|+.+|++.|.+++++++||||++.++++|++|..|++.++..
T Consensus        12 ~~~~~~~~~~~i~~~l~~~~~~d~m~~~~~~v~v~~~~sv~~a~~~m~~~~~~~~pV~d~~~~~lvGilt~~Dl~~~l~~   91 (323)
T 3t4n_C           12 VSIEQQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQY   91 (323)
T ss_dssp             HHHHHHHHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHHHHHHHHHHTTCSCEEEEETTTTEEEEEECHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHHHHHHhCchHhhCCCCCcEEEEcCCCcHHHHHHHHHHcCCceEEEEeCCCCeEEEEEEHHHHHHHHHH
Confidence            34555668899999999999999999999999999999999999999999999999999887789999999999998876


Q ss_pred             hccCCCCCChhHHhhccHHHHHHHHHhhhccccCCCCCCCCCCCceEeCCCCCHHHHHHHHHhCCcceEEEEecCCCCCC
Q 016866          115 LGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGS  194 (381)
Q Consensus       115 ~~~~~~~~~~~~l~~~~i~~~~~~~~~~~~~~~~~~~g~~~~~~~i~v~~~~sl~~a~~~m~~~~i~~lpVvd~d~~~g~  194 (381)
                      +...+..  .+.++.+....|++.....+          .|.++++++.+++++.+|++.|.+++++++||++++..++ 
T Consensus        92 ~~~~~~~--~~~l~~~~~~~v~~i~~~~~----------~~~~~~v~v~~~~~l~~a~~~m~~~~~~~lpVvd~~~~~~-  158 (323)
T 3t4n_C           92 YFSNPDK--FELVDKLQLDGLKDIERALG----------VDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETH-  158 (323)
T ss_dssp             HHHCGGG--GGGGGGCBHHHHHHHHHHTT----------C----CCCBCTTSBHHHHHHHHHHHTCSEEEEEEECTTTC-
T ss_pred             HHcCcch--hHHHHHHHHHHHHHHHHHhC----------CCCCCceEeCCCCcHHHHHHHHHhCCeeEEEEEecCCCCC-
Confidence            6553322  23555556666776655433          6788999999999999999999999999999998732222 


Q ss_pred             ccceEEEeehhhHHHHHhhhcccCCCCCccccCccccccccccccccccccCCCceEecCCCCHHHHHHHHHhCCCcEEE
Q 016866          195 CQEILYLASLSDILKCICRHFKHSSSSLPILQQPVSSIQLGTWVPRIGEANGRPFAMLRPTASLGSALALLVQADVSSIP  274 (381)
Q Consensus       195 ~~~~~gils~~dil~~l~~~~~~~~~~~~~~~~~i~~l~ig~~~~~v~~~~~~~~~~v~~~~~l~~a~~~m~~~~~~~lp  274 (381)
                      .+.++|++|.+|+++++..+...    ......+++++.++         |.++++++.+++++.+|++.|.+++++++|
T Consensus       159 ~~~l~Givt~~di~~~l~~~~~~----~~~~~~~v~~~~~~---------m~~~~~~v~~~~~~~~~~~~m~~~~~~~~p  225 (323)
T 3t4n_C          159 REIVVSVLTQYRILKFVALNCRE----THFLKIPIGDLNII---------TQDNMKSCQMTTPVIDVIQMLTQGRVSSVP  225 (323)
T ss_dssp             CEEEEEEEEHHHHHHHHHHHCGG----GGGCCSBGGGTTCS---------BCTTCCCBCTTSBHHHHHHHHHHHTCSEEE
T ss_pred             ccceEEEecHHHHHHHHHhcCCc----hhhhhCcHHHcCCC---------CCCCcEEECCCCcHHHHHHHHHHcCCCEEE
Confidence            11299999999999998766533    12233344443221         667899999999999999999999999999


Q ss_pred             EEcCCCcEEEEEeHHHHHHHHhhhhhcccccccccHHHHHhcCCCCCCCcccCCCcceEEcCCCCHHHHHHHHHhCCCCE
Q 016866          275 IVDDNDSLLDIYSRSDITALAKDKAYAQIHLDEMNIHQALQLGQDANPSLGFNGQRCQMCLRSDPLHKVMERLANPGVRR  354 (381)
Q Consensus       275 Vvd~~g~lvGiis~~Di~~l~~~~~~~~~~~~~~~v~~~l~~~~~~~~~~~~m~~~~~~v~~~~tl~~~~~~m~~~~~~~  354 (381)
                      |+|++|+++|++|.+|+++++..+.+...   +.++.+++.....       ...++++|.+++++.+|++.|.++++++
T Consensus       226 Vvd~~~~~~Giit~~dl~~~~~~~~~~~~---~~~v~~~m~~~~~-------~~~~~~~v~~~~~l~~~~~~m~~~~~~~  295 (323)
T 3t4n_C          226 IIDENGYLINVYEAYDVLGLIKGGIYNDL---SLSVGEALMRRSD-------DFEGVYTCTKNDKLSTIMDNIRKARVHR  295 (323)
T ss_dssp             EECTTCBEEEEEETTHHHHHHHTTHHHHT---TSBHHHHGGGSCT-------TCCCCEEECTTCBHHHHHHHHHHSCCCE
T ss_pred             EECCCCeEEEEEeHHHHHHHHhhchhhhc---cCCHHHHHhhccc-------cCCCCEEECCCCCHHHHHHHHHHhCCCE
Confidence            99999999999999999998775543332   4678885543110       0026899999999999999999999999


Q ss_pred             EEEEeCCCCeEEEEEehHHHHHHhhc
Q 016866          355 LVIVEAGSKRVEGIISLSDVFRFLLG  380 (381)
Q Consensus       355 l~Vvd~~~~~liGiIs~~DIl~~l~~  380 (381)
                      +||+| ++|+++|+||.+||++++++
T Consensus       296 l~Vvd-~~~~l~Giit~~Dil~~l~~  320 (323)
T 3t4n_C          296 FFVVD-DVGRLVGVLTLSDILKYILL  320 (323)
T ss_dssp             EEEEC-TTSBEEEEEEHHHHHHHHHH
T ss_pred             EEEEC-CCCcEEEEEEHHHHHHHHHh
Confidence            99999 47999999999999999975



>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 381
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 4e-15
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 1e-05
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 3e-13
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 1e-09
d2ooxe2153 d.37.1.1 (E:182-334) Uncharacterized protein C1556 1e-09
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 2e-09
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 0.004
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 3e-09
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 0.002
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 5e-09
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 0.001
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 1e-08
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 3e-08
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 8e-05
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 6e-08
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 7e-04
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 1e-07
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 8e-07
d1pbja3120 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A 3e-06
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 1e-05
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 2e-05
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 1e-04
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 4e-04
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 0.003
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 6e-04
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 8e-04
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 0.001
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Uncharacterized protein C1556.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
 Score = 70.8 bits (172), Expect = 4e-15
 Identities = 42/175 (24%), Positives = 80/175 (45%), Gaps = 10/175 (5%)

Query: 45  RISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLS 104
            I +F+ + T Y++LP S ++   DV L VK +  +L    +   PLWD    +F G+L+
Sbjct: 12  EIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSEANKFAGLLT 71

Query: 105 ALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGP 164
             DF+ +++    + S               ++ K +L   R+++      P   +   P
Sbjct: 72  MADFVNVIKYYYQSSSFPEAI---------AEIDKFRLLGLREVERKIGAIPPETIYVHP 122

Query: 165 YDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCICRHFKHSS 219
             SL +  L + +++   +P+I   G  GS   I+ + +   ILK I  + K ++
Sbjct: 123 MHSLMDACLAMSKSRARRIPLIDVDGETGSEM-IVSVLTQYRILKFISMNCKETA 176


>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.94
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.91
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.86
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.86
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.84
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.84
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.84
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.83
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.83
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.83
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.82
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.81
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.81
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.81
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.8
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.8
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.8
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.8
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.8
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.79
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.78
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.78
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.76
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.76
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.75
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.75
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.75
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.75
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.75
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.74
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.73
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.73
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.73
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.73
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.72
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.72
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.72
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.72
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.71
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.7
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.7
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.7
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.7
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.69
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.69
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.68
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.67
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.67
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.67
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.66
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.64
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.58
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Uncharacterized protein C1556.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
Probab=99.94  E-value=4.5e-26  Score=195.26  Aligned_cols=167  Identities=23%  Similarity=0.425  Sum_probs=136.6

Q ss_pred             HHHHHHHHHhhhCcccccCCCCccEEEEcCCCCHHHHHHHHHHcCCCeeecccCCCCcEEEEeehHHHHHHHHHhccCCC
Q 016866           41 LSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGS  120 (381)
Q Consensus        41 ~~~~~~~~~l~~~~~~d~~p~s~~vi~ld~~~~v~~A~~~l~~~~i~~~pV~d~~~~~~vGilt~~D~~~il~~~~~~~~  120 (381)
                      -+.+.+.+||++++|||+||.|+++++++.+.|+.+|++.|.++++.++||||+++++++|++|..|++.++........
T Consensus         8 ~~~~~i~~fl~~~~~~dvm~~s~~vv~i~~~~~v~~A~~~m~~~~i~~lpVvd~~~~~~vGiis~~Di~~~l~~~~~~~~   87 (179)
T d2ooxe1           8 GALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVKTSLSLLTLNNIVSAPLWDSEANKFAGLLTMADFVNVIKYYYQSSS   87 (179)
T ss_dssp             HHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHHHHHHHHHHHTCSCEEEEETTTTEEEEEECHHHHHHHHHHHHHHCS
T ss_pred             HHHHHHHHHHcCCEeeeeCCCCCcEEEEECcchHHHHHHHHHHcCCCeEEEEeCCCCeeEEEEeechHHHHHHhcccccc
Confidence            37799999999999999999999999999999999999999999999999999888889999999999998765544321


Q ss_pred             -CCChhHHhhccHHHHHHHHHhhhccccCCCCCCCCCCCceEeCCCCCHHHHHHHHHhCCcceEEEEecCCCCCCccceE
Q 016866          121 -NLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEIL  199 (381)
Q Consensus       121 -~~~~~~l~~~~i~~~~~~~~~~~~~~~~~~~g~~~~~~~i~v~~~~sl~~a~~~m~~~~i~~lpVvd~d~~~g~~~~~~  199 (381)
                       .....+........+........          .|..+++++.+++++.+|+..|.+++++++||+|++...+ ..+++
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~~i~v~~~~sl~~~~~~m~~~~~~~lpVvd~~g~~~-~~~vv  156 (179)
T d2ooxe1          88 FPEAIAEIDKFRLLGLREVERKIG----------AIPPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGETG-SEMIV  156 (179)
T ss_dssp             CGGGGGGGGGSBHHHHHHHHHHTT----------CSCSSCCCBCTTSBHHHHHHHHHHTTCSEEEEEEECTTTC-CEEEE
T ss_pred             chhhhhhhhccchhhhcccceeee----------ecccCceEECCCCcHHHHHHHhhhcCceEEEEEecCCCcC-CCcEE
Confidence             11223333344444444433322          6889999999999999999999999999999998743222 22799


Q ss_pred             EEeehhhHHHHHhhhcccC
Q 016866          200 YLASLSDILKCICRHFKHS  218 (381)
Q Consensus       200 gils~~dil~~l~~~~~~~  218 (381)
                      |++|++||++|++.++++.
T Consensus       157 giiT~~dIlk~l~~~~~~~  175 (179)
T d2ooxe1         157 SVLTQYRILKFISMNCKET  175 (179)
T ss_dssp             EEEEHHHHHHHHHTTCGGG
T ss_pred             EEEeHHHHHHHHHHhhhHh
Confidence            9999999999999887663



>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure