Citrus Sinensis ID: 016909

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380

MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI

ccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccEEEcccccHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccEEEccccccccccHHHHHccccccccccEEccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccc

cccccccccccccEEEEEcccccEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHcccccEEEccccHccEEEEccccHHHHHHHHHcccccccccccccEEEccccccEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEcccEEEEccHHHHHccccHHHccccccccEEEEccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHccccccc

mrfisesseeripcyrvldddgqpfpdssfvKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAaiknddfvvpqyrepgvllwRGFSMQEFAnqcfgnkadygkgrqmpihygsnkhnyftVSSTIATQLPHAVGAAYALkmdrkdacavtyfgdggtsegdfHAALnfsavteaPVIFIcrnngwaistpisdqfrsdgavvkgrAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYrvghhttsddstkyrpvdeiewwrttqdpvTRFRKWIesngwwngdieSELRSSVRKQILHALQEaekaekppisdlftdvydvspsnlrEQEHSLRETIKkhpqdypsnvpi

mrfisesseeriPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTpisdqfrsdgAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGhhttsddstkyrpvdeiewwrttqdpvtrfRKWIESNGWWNGDIESELRSSVRKQILHALQeaekaekppisdlFTDVYDVSPSNLREQEHSLretikkhpqdypsnvpi

MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEainiasaaaiKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI

************PCYRVLDD****F*DSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESEL*******IL*****************F***********************************

*******SEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQD*P*****

*********ERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRV**********KYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKH**********

*RF*SESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVP*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		380	2.2.26 [Sep-21-2011]
Q54M22		441	2-oxoisovalerate dehydrog	yes	no	0.955	0.823	0.502	1e-111
O45924		431	2-oxoisovalerate dehydrog	yes	no	0.955	0.842	0.509	1e-109
A5A6H9		445	2-oxoisovalerate dehydrog	yes	no	0.986	0.842	0.485	1e-107
Q8HXY4		445	2-oxoisovalerate dehydrog	N/A	no	0.986	0.842	0.482	1e-107
P12694		445	2-oxoisovalerate dehydrog	yes	no	0.986	0.842	0.48	1e-106
P11960		441	2-oxoisovalerate dehydrog	yes	no	0.986	0.850	0.48	1e-106
P50136		442	2-oxoisovalerate dehydrog	yes	no	0.986	0.848	0.477	1e-106
P11178		455	2-oxoisovalerate dehydrog	yes	no	0.986	0.824	0.48	1e-105
Q72GU1		367	2-oxoisovalerate dehydrog	yes	no	0.857	0.888	0.415	2e-64
Q5SLR4		367	2-oxoisovalerate dehydrog	yes	no	0.857	0.888	0.415	1e-63

>sp\|Q54M22\|ODBA_DICDI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=bkdA PE=3 SV=1	Back alignment and function desciption

 Score =  402 bits (1032), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 255/370 (68%), Gaps = 7/370 (1%)

Query: 12  IPCYRVLDDDG---QPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRISFYL 68
           IPCY ++D +G   +P  D +F   S+   IKMY  M+TL  MD+I Y+ QRQGRISFY+
Sbjct: 64  IPCYTIMDQEGVVSKPDQDPNF---SKEEVIKMYTTMLTLNVMDSILYDVQRQGRISFYM 120

Query: 69  TTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMP 128
           T+ GEEAI+I SAAA++  D +  QYRE GV +WRGF++ +  NQC  N+ D GKGRQMP
Sbjct: 121 TSFGEEAIHIGSAAALEMSDTIFAQYRETGVFMWRGFTINDIINQCCTNEHDLGKGRQMP 180

Query: 129 IHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNF 188
           +H+GS K N  T+SS + TQLP AVG++YA K+  +  C + YFG+G  SEGDFHAA+NF
Sbjct: 181 MHFGSRKINLQTISSPLTTQLPQAVGSSYAQKLAGEKNCTIVYFGEGAASEGDFHAAMNF 240

Query: 189 SAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKG-RAYGVRSIRVDGNDALAIYSAVH 247
           +A    P IF CRNN WAISTP  +Q++ DG   +G   YG+++IRVDGND  A+Y+   
Sbjct: 241 AAALSTPTIFFCRNNKWAISTPSKEQYKGDGIAGRGPNGYGMKTIRVDGNDIWAVYNVTK 300

Query: 248 AAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESN 307
            AR++A+ E  P+LIEA+TYRVGHH+TSDDS++YR V+EI  W+  ++P++R R ++   
Sbjct: 301 LARKIAVEEQVPVLIEAMTYRVGHHSTSDDSSRYRTVEEINAWKEGKNPISRLRNYMNHK 360

Query: 308 GWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETI 367
           GWW+   E E  ++ R  +  +L  AEK  KP I+++FTDVYD    NL EQ+  L E +
Sbjct: 361 GWWSDAQEKETIANARTTVRESLVNAEKQYKPSINEIFTDVYDKPTPNLIEQQKELIEHL 420

Query: 368 KKHPQDYPSN 377
           K +P +YP N
Sbjct: 421 KLYPDEYPLN 430

The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Dictyostelium discoideum (taxid: 44689)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 4

>sp\|O45924\|ODBA_CAEEL 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=Y39E4A.3 PE=1 SV=2	Back alignment and function description

>sp\|A5A6H9\|ODBA_PANTR 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Pan troglodytes GN=BCKDHA PE=2 SV=1	Back alignment and function description

>sp\|Q8HXY4\|ODBA_MACFA 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Macaca fascicularis GN=BCKDHA PE=2 SV=1	Back alignment and function description

>sp\|P12694\|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2	Back alignment and function description

>sp\|P11960\|ODBA_RAT 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus GN=Bckdha PE=1 SV=1	Back alignment and function description

>sp\|P50136\|ODBA_MOUSE 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Mus musculus GN=Bckdha PE=1 SV=1	Back alignment and function description

>sp\|P11178\|ODBA_BOVIN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Bos taurus GN=BCKDHA PE=2 SV=1	Back alignment and function description

>sp\|Q72GU1\|ODBA_THET2 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C1757 PE=3 SV=1	Back alignment and function description

>sp\|Q5SLR4\|ODBA_THET8 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0229 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		380
449461865		481	PREDICTED: 2-oxoisovalerate dehydrogenas	1.0	0.790	0.765	0.0
449507480		481	PREDICTED: 2-oxoisovalerate dehydrogenas	1.0	0.790	0.763	0.0
356508967		474	PREDICTED: 2-oxoisovalerate dehydrogenas	1.0	0.801	0.773	0.0
357464693		449	2-oxoisovalerate dehydrogenase subunit a	1.0	0.846	0.763	1e-180
224083452		378	predicted protein [Populus trichocarpa]	0.994	1.0	0.789	1e-180
297811017		472	hypothetical protein ARALYDRAFT_350155 [	1.0	0.805	0.765	1e-179
255558474		380	2-oxoisovalerate dehydrogenase, putative	0.997	0.997	0.757	1e-179
218186540		479	hypothetical protein OsI_37710 [Oryza sa	1.0	0.793	0.768	1e-179
222616745		512	hypothetical protein OsJ_35450 [Oryza sa	1.0	0.742	0.765	1e-179
108862263		487	2-oxoisovalerate dehydrogenase alpha sub	1.0	0.780	0.765	1e-179

>gi\|449461865\|ref\|XP_004148662.1\| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/380 (76%), Positives = 340/380 (89%)

Query: 1   MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
           + FI +  EERIPC+RVLDD+G+P   S+F +VS+ VA+K+Y+DMVTLQTMDTIFYEAQR
Sbjct: 102 LSFIPDREEERIPCFRVLDDNGRPCMYSNFTQVSKEVAMKIYHDMVTLQTMDTIFYEAQR 161

Query: 61  QGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
           QGRISFY+T+ GEEAIN+ASAAA+  DD +VPQYRE GVL+WRGF+++EFA+QCFGNK D
Sbjct: 162 QGRISFYVTSLGEEAINVASAAALSLDDLIVPQYREAGVLIWRGFTLKEFASQCFGNKYD 221

Query: 121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
           Y KGRQMP+HYGS +HNYFTV+STIA+Q+PHAVGAAY++KMD+KDACAVTYFGDGGTSEG
Sbjct: 222 YCKGRQMPVHYGSKRHNYFTVASTIASQIPHAVGAAYSMKMDKKDACAVTYFGDGGTSEG 281

Query: 181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
           DFHAALNF+AV EAPVIFICRNNGWAISTPISDQFRSDG VVKG+AYGVRSIRVDGNDAL
Sbjct: 282 DFHAALNFAAVLEAPVIFICRNNGWAISTPISDQFRSDGVVVKGQAYGVRSIRVDGNDAL 341

Query: 241 AIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRF 300
           A+Y+AV AAREMAI E RPILIEALTYR GHHTTSDDST+YRP  E+EWWR   DPV+RF
Sbjct: 342 AVYNAVRAAREMAIQEQRPILIEALTYRAGHHTTSDDSTRYRPAQEMEWWRVAMDPVSRF 401

Query: 301 RKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQE 360
           RKWIESNGWW+ + E+ELRS +RKQ+L  +Q AE++EKPP++D FTDVYDV PSNL+EQE
Sbjct: 402 RKWIESNGWWSNEAEAELRSRLRKQLLEEIQLAERSEKPPVADAFTDVYDVPPSNLQEQE 461

Query: 361 HSLRETIKKHPQDYPSNVPI 380
             LR+TIK HPQDYPSN P+
Sbjct: 462 KWLRKTIKTHPQDYPSNFPL 481

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449507480\|ref\|XP_004163044.1\| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356508967\|ref\|XP_003523224.1\| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|357464693\|ref\|XP_003602628.1\| 2-oxoisovalerate dehydrogenase subunit alpha [Medicago truncatula] gi\|355491676\|gb\|AES72879.1\| 2-oxoisovalerate dehydrogenase subunit alpha [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224083452\|ref\|XP_002307033.1\| predicted protein [Populus trichocarpa] gi\|222856482\|gb\|EEE94029.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297811017\|ref\|XP_002873392.1\| hypothetical protein ARALYDRAFT_350155 [Arabidopsis lyrata subsp. lyrata] gi\|297319229\|gb\|EFH49651.1\| hypothetical protein ARALYDRAFT_350155 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|255558474\|ref\|XP_002520262.1\| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis] gi\|223540481\|gb\|EEF42048.1\| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|218186540\|gb\|EEC68967.1\| hypothetical protein OsI_37710 [Oryza sativa Indica Group]	Back alignment and taxonomy information

>gi\|222616745\|gb\|EEE52877.1\| hypothetical protein OsJ_35450 [Oryza sativa Japonica Group]	Back alignment and taxonomy information

>gi\|108862263\|gb\|ABA95968.2\| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi\|108862264\|gb\|ABA95969.2\| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		380
TAIR\|locus:2184702		472	AT5G09300 "AT5G09300" [Arabido	1.0	0.805	0.736	1.6e-157
TAIR\|locus:2027072		472	AT1G21400 "AT1G21400" [Arabido	0.986	0.794	0.706	1.2e-150
WB\|WBGene00012713		432	Y39E4A.3 [Caenorhabditis elega	0.984	0.865	0.484	3.5e-98
DICTYBASE\|DDB_G0286335		441	bkdA "branched-chain alpha-ket	0.955	0.823	0.489	9.4e-98
UNIPROTKB\|F1RHA0		411	LOC100738911 "Uncharacterized	0.986	0.912	0.472	1.2e-97
UNIPROTKB\|I3LNR4		447	LOC100738911 "Uncharacterized	0.986	0.838	0.472	1.2e-97
UNIPROTKB\|E2RPW4		530	B3GNT8 "Uncharacterized protei	0.986	0.707	0.469	1.5e-97
UNIPROTKB\|F1PI86		480	B3GNT8 "Uncharacterized protei	0.986	0.781	0.469	1.5e-97
UNIPROTKB\|F5H5P2		479	BCKDHA "Uncharacterized protei	0.986	0.782	0.469	2.5e-97
UNIPROTKB\|P12694		445	BCKDHA "2-oxoisovalerate dehyd	0.986	0.842	0.469	2.5e-97

TAIR\|locus:2184702 AT5G09300 "AT5G09300" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1535 (545.4 bits), Expect = 1.6e-157, P = 1.6e-157
 Identities = 280/380 (73%), Positives = 325/380 (85%)

Query:     1 MRFISESSEERIPCYRVLDDDGQPFPDSSFVKVSEGVAIKMYNDMVTLQTMDTIFYEAQR 60
             ++FISES +ER+PCYRVLDD+GQ   +S FV+VSE VA+K+Y+DMVTLQ MD IFYEAQR
Sbjct:    93 IQFISESDKERVPCYRVLDDNGQLITNSQFVQVSEEVAVKIYSDMVTLQIMDNIFYEAQR 152

Query:    61 QGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD 120
             QGR+SFY T  GEE             D + PQYREPGVLLWRGF++QEFANQCFGNK+D
Sbjct:   153 QGRLSFYATAIGEEAINIASAAALTPQDVIFPQYREPGVLLWRGFTLQEFANQCFGNKSD 212

Query:   121 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEG 180
             YGKGRQMP+HYGSNK NYFTVS+TIATQLP+AVGAAY+LKMD+KDACAVTYFGDGGTSEG
Sbjct:   213 YGKGRQMPVHYGSNKLNYFTVSATIATQLPNAVGAAYSLKMDKKDACAVTYFGDGGTSEG 272

Query:   181 DFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDAL 240
             DFHAALN +AV EAPV+FICRNNGWAISTP SDQFRSDG VVKGRAYG+RSIRVDGNDAL
Sbjct:   273 DFHAALNIAAVMEAPVLFICRNNGWAISTPTSDQFRSDGVVVKGRAYGIRSIRVDGNDAL 332

Query:   241 AIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRF 300
             A+YSAVH AREMAI E RPILIEALTYRVGHH+TSDDST+YR   EIEWW   ++P++RF
Sbjct:   333 AMYSAVHTAREMAIREQRPILIEALTYRVGHHSTSDDSTRYRSAGEIEWWNKARNPLSRF 392

Query:   301 RKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQE 360
             R WIESNGWW+   ES+LRS ++K++L AL+ AEK EKP + ++F+DVYDV PSNLREQE
Sbjct:   393 RTWIESNGWWSDKTESDLRSRIKKEMLEALRVAEKTEKPNLQNMFSDVYDVPPSNLREQE 452

Query:   361 HSLRETIKKHPQDYPSNVPI 380
               +R+TI  HPQDYPS+VP+
Sbjct:   453 LLVRQTINSHPQDYPSDVPL 472

GO:0003863 "3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity" evidence=ISS

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0008152 "metabolic process" evidence=IEA;ISS

GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA

TAIR\|locus:2027072 AT1G21400 "AT1G21400" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

WB\|WBGene00012713 Y39E4A.3 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0286335 bkdA "branched-chain alpha-keto acid dehydrogenase E1 alpha chain" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RHA0 LOC100738911 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LNR4 LOC100738911 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RPW4 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PI86 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F5H5P2 BCKDHA "Uncharacterized protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P12694 BCKDHA "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
O45924	ODBA_CAEEL	1, ., 2, ., 4, ., 4	0.5095	0.9552	0.8422	yes	no
P11960	ODBA_RAT	1, ., 2, ., 4, ., 4	0.48	0.9868	0.8503	yes	no
Q5HQ76	ODPA_STAEQ	1, ., 2, ., 4, ., 1	0.3626	0.9236	0.9486	yes	no
Q5SLR4	ODBA_THET8	1, ., 2, ., 4, ., 4	0.4151	0.8578	0.8882	yes	no
Q72GU1	ODBA_THET2	1, ., 2, ., 4, ., 4	0.4151	0.8578	0.8882	yes	no
Q54M22	ODBA_DICDI	1, ., 2, ., 4, ., 4	0.5027	0.9552	0.8231	yes	no
P35485	ODPA_ACHLA	1, ., 2, ., 4, ., 1	0.3314	0.8763	0.9652	yes	no
P60090	ODPA_STAAW	1, ., 2, ., 4, ., 1	0.3681	0.9236	0.9486	yes	no
Q6GAC1	ODPA_STAAS	1, ., 2, ., 4, ., 1	0.3681	0.9236	0.9486	yes	no
P12694	ODBA_HUMAN	1, ., 2, ., 4, ., 4	0.48	0.9868	0.8426	yes	no
Q5HGZ1	ODPA_STAAC	1, ., 2, ., 4, ., 1	0.3681	0.9236	0.9486	yes	no
O06161	BKDA_MYCTU	1, ., 2, ., 4, ., 4	0.3547	0.8973	0.9291	yes	no
P11178	ODBA_BOVIN	1, ., 2, ., 4, ., 4	0.48	0.9868	0.8241	yes	no
A5A6H9	ODBA_PANTR	1, ., 2, ., 4, ., 4	0.4853	0.9868	0.8426	yes	no
Q9I1M2	ODBA_PSEAE	1, ., 2, ., 4, ., 4	0.3692	0.9263	0.8585	yes	no
Q6GHZ2	ODPA_STAAR	1, ., 2, ., 4, ., 1	0.3653	0.9236	0.9486	yes	no
Q4MTG0	ODPA_BACCE	1, ., 2, ., 4, ., 1	0.3549	0.8947	0.9164	yes	no
P60089	ODPA_STAAM	1, ., 2, ., 4, ., 1	0.3681	0.9236	0.9486	yes	no
Q8CPN3	ODPA_STAES	1, ., 2, ., 4, ., 1	0.3626	0.9236	0.9486	yes	no
P50136	ODBA_MOUSE	1, ., 2, ., 4, ., 4	0.4773	0.9868	0.8484	yes	no
P21881	ODPA_BACSU	1, ., 2, ., 4, ., 1	0.3569	0.8947	0.9164	yes	no
Q820A6	ODPA_STAAN	1, ., 2, ., 4, ., 1	0.3681	0.9236	0.9486	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.2.4	0.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		380
cd02000		293	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph	1e-144
COG1071		358	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena	1e-128
TIGR03181		341	TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E	1e-124
pfam00676		303	pfam00676, E1_dh, Dehydrogenase E1 component	1e-111
TIGR03182		315	TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E	3e-70
PLN02269		362	PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp	6e-44
CHL00149		341	CHL00149, odpA, pyruvate dehydrogenase E1 componen	3e-42
PLN02374		433	PLN02374, PLN02374, pyruvate dehydrogenase (acetyl	2e-35
cd00568		168	cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP)	1e-11
cd02012		255	cd02012, TPP_TK, Thiamine pyrophosphate (TPP) fami	2e-10
PRK05899		586	PRK05899, PRK05899, transketolase; Reviewed	8e-08
COG3959		243	COG3959, COG3959, Transketolase, N-terminal subuni	3e-06
cd02002		178	cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa	5e-05
COG0021		663	COG0021, TktA, Transketolase [Carbohydrate transpo	4e-04
cd02007		195	cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) fam	0.002

>gnl\|CDD\|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC)	Back alignment and domain information

 Score =  409 bits (1054), Expect = e-144
 Identities = 124/294 (42%), Positives = 178/294 (60%), Gaps = 2/294 (0%)

Query: 41  MYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKNDDFVVPQYREPGV 99
           +Y  MV ++  D    E  RQG+I  FY  + G+EA+ +  AAA++  D+V P YR+ G 
Sbjct: 1   LYRTMVLIRRFDERLLELYRQGKIGGFYHLSIGQEAVAVGVAAALRPGDWVFPTYRDHGH 60

Query: 100 LLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYAL 159
            L RG  ++E   + FG +    KGR   +H G  + N+F  +  +  Q+P A GAA AL
Sbjct: 61  ALARGVDLKEMLAELFGKETGPCKGRGGSMHIGDKEKNFFGGNGIVGGQVPLAAGAALAL 120

Query: 160 KMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDG 219
           K   +D  AV +FGDG T+EGDFH ALNF+A+ + PVIF+C NNG+AISTP S Q     
Sbjct: 121 KYRGEDRVAVCFFGDGATNEGDFHEALNFAALWKLPVIFVCENNGYAISTPTSRQTAGTS 180

Query: 220 AVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDST 279
              +  AYG+  IRVDGND LA+Y A   A E A   G P LIEA+TYR+G H+TSDD +
Sbjct: 181 IADRAAAYGIPGIRVDGNDVLAVYEAAKEAVERARAGGGPTLIEAVTYRLGGHSTSDDPS 240

Query: 280 KYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEA 333
           +YR  +E+E W+  +DP+ R RK++   G    +  + + + V+ ++  A++ A
Sbjct: 241 RYRTKEEVEEWK-KRDPILRLRKYLIEAGILTEEELAAIEAEVKAEVEEAVEFA 293

PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine). Length = 293

>gnl\|CDD\|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>gnl\|CDD\|201386 pfam00676, E1_dh, Dehydrogenase E1 component	Back alignment and domain information

>gnl\|CDD\|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>gnl\|CDD\|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha	Back alignment and domain information

>gnl\|CDD\|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring)	Back alignment and domain information

>gnl\|CDD\|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor	Back alignment and domain information

>gnl\|CDD\|238970 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates	Back alignment and domain information

>gnl\|CDD\|235639 PRK05899, PRK05899, transketolase; Reviewed	Back alignment and domain information

>gnl\|CDD\|226468 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC)	Back alignment and domain information

>gnl\|CDD\|223100 COG0021, TktA, Transketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238965 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		380
COG1071		358	AcoA Pyruvate/2-oxoglutarate dehydrogenase complex	100.0
KOG1182		432	consensus Branched chain alpha-keto acid dehydroge	100.0
PLN02269		362	Pyruvate dehydrogenase E1 component subunit alpha	100.0
CHL00149		341	odpA pyruvate dehydrogenase E1 component alpha sub	100.0
TIGR03181		341	PDH_E1_alph_x pyruvate dehydrogenase E1 component,	100.0
TIGR03182		315	PDH_E1_alph_y pyruvate dehydrogenase E1 component,	100.0
PLN02374		433	pyruvate dehydrogenase (acetyl-transferring)	100.0
KOG0225		394	consensus Pyruvate dehydrogenase E1, alpha subunit	100.0
PF00676		300	E1_dh: Dehydrogenase E1 component; InterPro: IPR00	100.0
cd02000		293	TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP)	100.0
PRK09404		924	sucA 2-oxoglutarate dehydrogenase E1 component; Re	100.0
TIGR00239		929	2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon	100.0
cd02016		265	TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami	100.0
PRK12270		1228	kgd alpha-ketoglutarate decarboxylase; Reviewed	100.0
PRK12315		581	1-deoxy-D-xylulose-5-phosphate synthase; Provision	100.0
COG3959		243	Transketolase, N-terminal subunit [Carbohydrate tr	100.0
KOG0450		1017	consensus 2-oxoglutarate dehydrogenase, E1 subunit	99.97
KOG0451		913	consensus Predicted 2-oxoglutarate dehydrogenase,	99.97
COG0567		906	SucA 2-oxoglutarate dehydrogenase complex, dehydro	99.97
PRK12754		663	transketolase; Reviewed	99.96
TIGR00232		653	tktlase_bact transketolase, bacterial and yeast. T	99.96
PF00456		332	Transketolase_N: Transketolase, thiamine diphospha	99.96
PRK12753		663	transketolase; Reviewed	99.96
cd02012		255	TPP_TK Thiamine pyrophosphate (TPP) family, Transk	99.96
PTZ00089		661	transketolase; Provisional	99.96
PRK05899		624	transketolase; Reviewed	99.96
cd02007		195	TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s	99.95
cd02017		386	TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam	99.95
PLN02790		654	transketolase	99.95
PRK05444		580	1-deoxy-D-xylulose-5-phosphate synthase; Provision	99.94
COG0021		663	TktA Transketolase [Carbohydrate transport and met	99.93
TIGR00759		885	aceE pyruvate dehydrogenase E1 component, homodime	99.93
cd02011		227	TPP_PK Thiamine pyrophosphate (TPP) family, Phosph	99.93
TIGR00204		617	dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s	99.93
TIGR03186		889	AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S	99.92
PRK12571		641	1-deoxy-D-xylulose-5-phosphate synthase; Provision	99.91
PLN02234		641	1-deoxy-D-xylulose-5-phosphate synthase	99.91
PRK13012		896	2-oxoacid dehydrogenase subunit E1; Provisional	99.91
KOG0523		632	consensus Transketolase [Carbohydrate transport an	99.9
PRK09405		891	aceE pyruvate dehydrogenase subunit E1; Reviewed	99.9
PLN02582		677	1-deoxy-D-xylulose-5-phosphate synthase	99.88
PRK05261		785	putative phosphoketolase; Provisional	99.82
PRK11864		300	2-ketoisovalerate ferredoxin oxidoreductase subuni	99.8
cd02004		172	TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam	99.77
cd00568		168	TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa	99.76
cd02013		196	TPP_Xsc_like Thiamine pyrophosphate (TPP) family,	99.76
PF13292		270	DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn	99.75
cd02006		202	TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s	99.74
cd02002		178	TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC	99.73
COG1154		627	Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m	99.72
cd02014		178	TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv	99.72
PRK06163		202	hypothetical protein; Provisional	99.71
cd02015		186	TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet	99.7
cd03372		179	TPP_ComE Thiamine pyrophosphate (TPP) family, ComE	99.7
cd02003		205	TPP_IolD Thiamine pyrophosphate (TPP) family, IolD	99.69
cd02008		178	TPP_IOR_alpha Thiamine pyrophosphate (TPP) family,	99.69
TIGR03846		181	sulfopy_beta sulfopyruvate decarboxylase, beta sub	99.69
cd03371		188	TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp	99.69
cd02001		157	TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil	99.69
cd02010		177	TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto	99.69
PLN02225		701	1-deoxy-D-xylulose-5-phosphate synthase	99.67
cd02005		183	TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family,	99.66
PRK07524		535	hypothetical protein; Provisional	99.64
PF02775		153	TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter	99.64
PRK08327		569	acetolactate synthase catalytic subunit; Validated	99.63
cd02009		175	TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa	99.63
TIGR01504		588	glyox_carbo_lig glyoxylate carboligase. Glyoxylate	99.61
PRK07092		530	benzoylformate decarboxylase; Reviewed	99.6
PRK06154		565	hypothetical protein; Provisional	99.6
PRK08266		542	hypothetical protein; Provisional	99.59
PRK12474		518	hypothetical protein; Provisional	99.59
COG0028		550	IlvB Thiamine pyrophosphate-requiring enzymes [ace	99.59
cd03375		193	TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o	99.58
PRK06725		570	acetolactate synthase 3 catalytic subunit; Validat	99.58
PRK06546		578	pyruvate dehydrogenase; Provisional	99.58
PRK09107		595	acetolactate synthase 3 catalytic subunit; Validat	99.57
cd03376		235	TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam	99.57
PRK11269		591	glyoxylate carboligase; Provisional	99.57
PRK07586		514	hypothetical protein; Validated	99.57
PRK05858		542	hypothetical protein; Provisional	99.56
PRK06882		574	acetolactate synthase 3 catalytic subunit; Validat	99.56
PRK07064		544	hypothetical protein; Provisional	99.56
PRK07979		574	acetolactate synthase 3 catalytic subunit; Validat	99.56
TIGR03297		361	Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi	99.56
TIGR02418		539	acolac_catab acetolactate synthase, catabolic. Ace	99.55
PRK08199		557	thiamine pyrophosphate protein; Validated	99.55
PRK09124		574	pyruvate dehydrogenase; Provisional	99.55
PRK06112		578	acetolactate synthase catalytic subunit; Validated	99.55
PRK07418		616	acetolactate synthase 3 catalytic subunit; Reviewe	99.55
PLN02573		578	pyruvate decarboxylase	99.55
PRK07710		571	acetolactate synthase catalytic subunit; Reviewed	99.54
PRK06965		587	acetolactate synthase 3 catalytic subunit; Validat	99.54
PRK08979		572	acetolactate synthase 3 catalytic subunit; Validat	99.54
TIGR02720		575	pyruv_oxi_spxB pyruvate oxidase. Members of this f	99.53
PRK06457		549	pyruvate dehydrogenase; Provisional	99.53
TIGR03393		539	indolpyr_decarb indolepyruvate decarboxylase, Erwi	99.53
PRK06466		574	acetolactate synthase 3 catalytic subunit; Validat	99.52
PRK08617		552	acetolactate synthase; Reviewed	99.52
TIGR03254		554	oxalate_oxc oxalyl-CoA decarboxylase. In a number	99.52
PRK07525		588	sulfoacetaldehyde acetyltransferase; Validated	99.52
PRK08155		564	acetolactate synthase catalytic subunit; Validated	99.52
TIGR03457		579	sulphoacet_xsc sulfoacetaldehyde acetyltransferase	99.52
cd02018		237	TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru	99.52
PRK08527		563	acetolactate synthase 3 catalytic subunit; Validat	99.52
PRK08273		597	thiamine pyrophosphate protein; Provisional	99.52
PRK08322		547	acetolactate synthase; Reviewed	99.51
CHL00099		585	ilvB acetohydroxyacid synthase large subunit	99.51
PRK05778		301	2-oxoglutarate ferredoxin oxidoreductase subunit b	99.51
PRK09628		277	oorB 2-oxoglutarate-acceptor oxidoreductase subuni	99.51
TIGR00118		558	acolac_lg acetolactate synthase, large subunit, bi	99.51
PRK06048		561	acetolactate synthase 3 catalytic subunit; Reviewe	99.5
PRK08611		576	pyruvate oxidase; Provisional	99.5
PLN02470		585	acetolactate synthase	99.5
TIGR03394		535	indol_phenyl_DC indolepyruvate/phenylpyruvate deca	99.5
PRK06456		572	acetolactate synthase catalytic subunit; Reviewed	99.49
PRK09259		569	putative oxalyl-CoA decarboxylase; Validated	99.49
PRK08978		548	acetolactate synthase 2 catalytic subunit; Reviewe	99.49
COG2609		887	AceE Pyruvate dehydrogenase complex, dehydrogenase	99.49
PRK11869		280	2-oxoacid ferredoxin oxidoreductase subunit beta;	99.46
PRK06276		586	acetolactate synthase catalytic subunit; Reviewed	99.46
PRK07282		566	acetolactate synthase catalytic subunit; Reviewed	99.46
PRK07789		612	acetolactate synthase 1 catalytic subunit; Validat	99.45
TIGR02177		287	PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta	99.44
PRK07449		568	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1	99.43
PRK11866		279	2-oxoacid ferredoxin oxidoreductase subunit beta;	99.42
PRK11867		286	2-oxoglutarate ferredoxin oxidoreductase subunit b	99.41
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	99.33
COG3961		557	Pyruvate decarboxylase and related thiamine pyroph	99.32
PRK11865		299	pyruvate ferredoxin oxidoreductase subunit beta; P	99.29
PF09364		379	XFP_N: XFP N-terminal domain; InterPro: IPR018970	99.2
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	99.2
KOG1185		571	consensus Thiamine pyrophosphate-requiring enzyme	99.17
KOG4166		675	consensus Thiamine pyrophosphate-requiring enzyme	98.95
COG3960		592	Glyoxylate carboligase [General function predictio	98.93
KOG1184		561	consensus Thiamine pyrophosphate-requiring enzyme	98.93
COG3962		617	Acetolactate synthase [Amino acid transport and me	98.7
COG3957		793	Phosphoketolase [Carbohydrate transport and metabo	98.5
COG1013		294	PorB Pyruvate:ferredoxin oxidoreductase and relate	98.46
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	97.99
COG1165		566	MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car	97.7
cd03377		365	TPP_PFOR_PNO Thiamine pyrophosphate (TPP family),	97.33
cd06586		154	TPP_enzyme_PYR Pyrimidine (PYR) binding domain of	96.94
cd07039		164	TPP_PYR_POX Pyrimidine (PYR) binding domain of POX	96.92
cd07035		155	TPP_PYR_POX_like Pyrimidine (PYR) binding domain o	96.85
PRK13030		1159	2-oxoacid ferredoxin oxidoreductase; Provisional	96.78
TIGR03845		157	sulfopyru_alph sulfopyruvate decarboxylase, alpha	96.69
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	96.66
cd07034		160	TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi	96.55
PF02776		172	TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter	96.52
PRK09193		1165	indolepyruvate ferredoxin oxidoreductase; Validate	96.49
cd07038		162	TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom	96.47
PRK13029		1186	2-oxoacid ferredoxin oxidoreductase; Provisional	95.83
cd07037		162	TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-	95.6
PRK08611		576	pyruvate oxidase; Provisional	94.82
TIGR03254		554	oxalate_oxc oxalyl-CoA decarboxylase. In a number	94.79
cd07033		156	TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai	94.74
PRK08659		376	2-oxoglutarate ferredoxin oxidoreductase subunit a	94.67
COG0028		550	IlvB Thiamine pyrophosphate-requiring enzymes [ace	94.66
PRK07119		352	2-ketoisovalerate ferredoxin reductase; Validated	94.59
TIGR03297		361	Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi	94.59
PRK07525		588	sulfoacetaldehyde acetyltransferase; Validated	94.57
PRK07524		535	hypothetical protein; Provisional	94.25
PRK09259		569	putative oxalyl-CoA decarboxylase; Validated	94.14
PRK06457		549	pyruvate dehydrogenase; Provisional	94.12
PRK07064		544	hypothetical protein; Provisional	94.01
TIGR03457		579	sulphoacet_xsc sulfoacetaldehyde acetyltransferase	94.0
PRK06112		578	acetolactate synthase catalytic subunit; Validated	93.92
PRK07979		574	acetolactate synthase 3 catalytic subunit; Validat	93.86
PRK06456		572	acetolactate synthase catalytic subunit; Reviewed	93.79
PRK08266		542	hypothetical protein; Provisional	93.79
PRK08366		390	vorA 2-ketoisovalerate ferredoxin oxidoreductase s	93.78
PRK06276		586	acetolactate synthase catalytic subunit; Reviewed	93.68
PRK07418		616	acetolactate synthase 3 catalytic subunit; Reviewe	93.66
PRK08322		547	acetolactate synthase; Reviewed	93.64
PRK11269		591	glyoxylate carboligase; Provisional	93.64
PRK08273		597	thiamine pyrophosphate protein; Provisional	93.63
PF01855		230	POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta	93.6
PRK06725		570	acetolactate synthase 3 catalytic subunit; Validat	93.52
PRK06466		574	acetolactate synthase 3 catalytic subunit; Validat	93.49
PRK07586		514	hypothetical protein; Validated	93.48
PRK07789		612	acetolactate synthase 1 catalytic subunit; Validat	93.45
PLN02470		585	acetolactate synthase	93.43
TIGR01504		588	glyox_carbo_lig glyoxylate carboligase. Glyoxylate	93.4
PRK07710		571	acetolactate synthase catalytic subunit; Reviewed	93.3
PRK08978		548	acetolactate synthase 2 catalytic subunit; Reviewe	93.22
TIGR00118		558	acolac_lg acetolactate synthase, large subunit, bi	93.19
PRK12474		518	hypothetical protein; Provisional	92.97
PRK09107		595	acetolactate synthase 3 catalytic subunit; Validat	92.92
cd07036		167	TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding	92.86
TIGR03394		535	indol_phenyl_DC indolepyruvate/phenylpyruvate deca	92.82
PRK08155		564	acetolactate synthase catalytic subunit; Validated	92.82
PRK06965		587	acetolactate synthase 3 catalytic subunit; Validat	92.78
PRK08979		572	acetolactate synthase 3 catalytic subunit; Validat	92.72
PF02779		178	Transket_pyr: Transketolase, pyrimidine binding do	92.69
TIGR02720		575	pyruv_oxi_spxB pyruvate oxidase. Members of this f	92.69
PRK08199		557	thiamine pyrophosphate protein; Validated	92.62
PRK06882		574	acetolactate synthase 3 catalytic subunit; Validat	92.6
TIGR00204		617	dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s	92.44
PRK06048		561	acetolactate synthase 3 catalytic subunit; Reviewe	92.38
PRK09627		375	oorA 2-oxoglutarate-acceptor oxidoreductase subuni	92.36
PRK07282		566	acetolactate synthase catalytic subunit; Reviewed	92.11
PRK08367		394	porA pyruvate ferredoxin oxidoreductase subunit al	92.07
PRK05858		542	hypothetical protein; Provisional	92.01
PRK08327		569	acetolactate synthase catalytic subunit; Validated	91.92
TIGR02418		539	acolac_catab acetolactate synthase, catabolic. Ace	91.89
PRK08527		563	acetolactate synthase 3 catalytic subunit; Validat	91.81
TIGR03710		562	OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s	91.78
PRK08617		552	acetolactate synthase; Reviewed	91.57
PRK09622		407	porA pyruvate flavodoxin oxidoreductase subunit al	91.51
CHL00099		585	ilvB acetohydroxyacid synthase large subunit	91.24
KOG4166		675	consensus Thiamine pyrophosphate-requiring enzyme	91.16
PLN02683		356	pyruvate dehydrogenase E1 component subunit beta	90.75
PRK09124		574	pyruvate dehydrogenase; Provisional	90.6
PLN02573		578	pyruvate decarboxylase	90.39
PRK12571		641	1-deoxy-D-xylulose-5-phosphate synthase; Provision	90.36
TIGR00232		653	tktlase_bact transketolase, bacterial and yeast. T	90.3
PRK06154		565	hypothetical protein; Provisional	90.23
PRK06546		578	pyruvate dehydrogenase; Provisional	90.09
PRK05444		580	1-deoxy-D-xylulose-5-phosphate synthase; Provision	90.07
PRK11892		464	pyruvate dehydrogenase subunit beta; Provisional	90.03
PRK07092		530	benzoylformate decarboxylase; Reviewed	89.85
PLN02234		641	1-deoxy-D-xylulose-5-phosphate synthase	89.84
PRK05899		624	transketolase; Reviewed	89.82
PTZ00089		661	transketolase; Provisional	89.29
PLN02582		677	1-deoxy-D-xylulose-5-phosphate synthase	89.22
TIGR00173		432	menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex	89.17
PRK12315		581	1-deoxy-D-xylulose-5-phosphate synthase; Provision	88.56
PLN02225		701	1-deoxy-D-xylulose-5-phosphate synthase	88.35
cd01460		266	vWA_midasin VWA_Midasin: Midasin is a member of th	88.17
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	87.62
COG4032		172	Predicted thiamine-pyrophosphate-binding protein [	87.57
PTZ00182		355	3-methyl-2-oxobutanate dehydrogenase; Provisional	87.03
PRK12754		663	transketolase; Reviewed	86.74
COG0021		663	TktA Transketolase [Carbohydrate transport and met	86.36
PRK09212		327	pyruvate dehydrogenase subunit beta; Validated	86.21
PLN02790		654	transketolase	85.7
PRK12753		663	transketolase; Reviewed	85.52
COG0674		365	PorA Pyruvate:ferredoxin oxidoreductase and relate	85.18
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	84.1
CHL00144		327	odpB pyruvate dehydrogenase E1 component beta subu	81.54

>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion]	Back alignment and domain information

Probab=100.00  E-value=3.3e-93  Score=691.09  Aligned_cols=351  Identities=38%  Similarity=0.656  Sum_probs=336.7

Q ss_pred             CeeEeeCCCCCCCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcc-cccccchhHHHHHHHHhcCCCC-c
Q 016909           13 PCYRVLDDDGQPFPDSSFV--KVSEGVAIKMYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKND-D   88 (380)
Q Consensus        13 ~~~~~~~~~g~~~~~~~~~--~~~~~~l~~~y~~M~~~R~~e~~~~~~~~~g~i~-~~~~~~GqEa~~~~~~~~l~~~-D   88 (380)
                      +.+++++.+|..+.+....  .+++++++++|++|+++|.||+++..++++|+++ |+|+++||||+++|++.+|+++ |
T Consensus         2 ~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~y~~M~l~R~fd~k~~~l~r~G~i~gf~~~~~GqEA~~vg~~~aL~~~~D   81 (358)
T COG1071           2 SLIRVLDEDGRAVDELPGPNAALSKEELLELYRLMLLIRRFDEKMLQLQRQGKIGGFYHLYIGQEAVQVGAAAALRPGED   81 (358)
T ss_pred             CceeccCcccccccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccCcCCcccHHHHHHHHHHhcCCCCC
Confidence            5689999999988886444  7999999999999999999999999999999996 9999999999999999999965 9


Q ss_pred             EEEccccchHHHHHcCCCHHHHHHHhhcCCCCCCCCCCCccccCCCCCCcccccccccCccHHHHHHHHHhhhcCCCc-e
Q 016909           89 FVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDA-C  167 (380)
Q Consensus        89 ~v~~~yR~~~~~l~~G~~~~~~l~e~~g~~~~~~~G~~~~~H~~~~~~~~~~~~g~lG~~~p~AvG~A~A~k~~~~~~-~  167 (380)
                      |++++||+|+++|++|+++.++|++++|+.+|+|+|+++++|++++..++++.++++|+|+|+|+|+|+|.|+++.+. +
T Consensus        82 ~i~~~YR~h~~~l~~G~~~~~~~a~~~G~~~g~~kGr~~~~h~~~~~~~~~~~~~iVg~Q~~~AaG~A~a~k~~~~~~~V  161 (358)
T COG1071          82 WIFPTYRDHGHLLARGVPLKEIMAELLGKATGPCKGRGGSMHYSDKEKGFLGGSGIVGTQIPLAAGAALALKYRGTKDGV  161 (358)
T ss_pred             EeecccCccccceecCCCHHHHHHHHhccccCCCCCCCCcccccccccccCCCCceecccccHHHHHHHHHHHhCCCCcE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999555 9


Q ss_pred             eEEEeCccccCcchHHHHHHHHHHcCCCEEEEEEcCCcceeeecccccCCcCHHHHHhhcCeeEEEEeCCCHHHHHHHHH
Q 016909          168 AVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVH  247 (380)
Q Consensus       168 vv~~~GDG~~~eG~~~Eal~~A~~~~Lpvi~vv~NN~~~i~~~~~~~~~~~~~~~~a~a~G~~~~~VdG~D~~av~~a~~  247 (380)
                      ++|++|||+++||.|||+||||+.|+|||||+|+||+|+||++...++..+.++.++.+||+|+++|||||+.+|+++++
T Consensus       162 a~~~~GDGat~qG~FhEalN~A~v~klPvvf~ieNN~yAiSvp~~~q~~~~~~~~ra~aygipgv~VDG~D~~avy~~~~  241 (358)
T COG1071         162 AVAFFGDGATNQGDFHEALNFAAVWKLPVVFVIENNQYAISVPRSRQTAAEIIAARAAAYGIPGVRVDGNDVLAVYEAAK  241 (358)
T ss_pred             EEEEecCCccccchHHHHHHHHHHhcCCEEEEEecCCceeecchhhcccchhHHhhhhccCCCeEEECCcCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999888877777777789999999999999999999999999


Q ss_pred             HHHHHhhccCCcEEEEEEeecCCCCCCCCCCCCCCChhHHHHHHhCCChHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
Q 016909          248 AAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQIL  327 (380)
Q Consensus       248 ~A~~~ar~~~gP~lIe~~t~R~~gHs~~Dd~~~Yr~~~e~~~~~~~~DPi~~~~~~L~~~g~~t~~~~~~i~~~~~~~v~  327 (380)
                      +|++++|+++||+|||+.|||++|||++|||..||+++|+++|+ ++|||.+++++|++.|+||++++++|+++++++|+
T Consensus       242 ~A~e~AR~g~GPtLIE~~tYR~~~HS~sDd~~~YRskeE~~~~~-~~DPi~r~~~~L~~~g~~see~~~~i~~e~~~~V~  320 (358)
T COG1071         242 EAVERARAGEGPTLIEAVTYRYGGHSTSDDPSKYRSKEEVEEWK-KRDPIVRLRKYLIEAGILSEEELEAIEAEAKAEVD  320 (358)
T ss_pred             HHHHHHHcCCCCEEEEEEEeecCCCCCCCCccccCCHHHHHHHh-ccChHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998 59999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCCccccccccCCCccHHHHHHHHH
Q 016909          328 HALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLR  364 (380)
Q Consensus       328 ~a~~~a~~~~~p~~~~~~~~vy~~~~~~~~~~~~~l~  364 (380)
                      +|+++|+++|.|+++++|++||++.++.+.+|++.+.
T Consensus       321 ea~e~a~~~p~P~~~~~~~~Vy~~~~~~l~~q~~~~~  357 (358)
T COG1071         321 EAVEFAEASPYPDVSELFEDVYAEGPPHLEEQREELE  357 (358)
T ss_pred             HHHHHHHhCCCCChhHhhhcccccCChhHHHHHHhhc
Confidence            9999999999999999999999999999999987664

>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion]	Back alignment and domain information

>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha	Back alignment and domain information

>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed	Back alignment and domain information

>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>PLN02374 pyruvate dehydrogenase (acetyl-transferring)	Back alignment and domain information

>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion]	Back alignment and domain information

>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex	Back alignment and domain information

>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC)	Back alignment and domain information

>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed	Back alignment and domain information

>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component	Back alignment and domain information

>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC)	Back alignment and domain information

>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0450 consensus 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0451 consensus Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK12754 transketolase; Reviewed	Back alignment and domain information

>TIGR00232 tktlase_bact transketolase, bacterial and yeast	Back alignment and domain information

>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2	Back alignment and domain information

>PRK12753 transketolase; Reviewed	Back alignment and domain information

>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates	Back alignment and domain information

>PTZ00089 transketolase; Provisional	Back alignment and domain information

>PRK05899 transketolase; Reviewed	Back alignment and domain information

>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis	Back alignment and domain information

>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E	Back alignment and domain information

>PLN02790 transketolase	Back alignment and domain information

>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>COG0021 TktA Transketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type	Back alignment and domain information

>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O	Back alignment and domain information

>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase	Back alignment and domain information

>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional	Back alignment and domain information

>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed	Back alignment and domain information

>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK05261 putative phosphoketolase; Provisional	Back alignment and domain information

>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL)	Back alignment and domain information

>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor	Back alignment and domain information

>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc)	Back alignment and domain information

>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B	Back alignment and domain information

>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl)	Back alignment and domain information

>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC)	Back alignment and domain information

>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism]	Back alignment and domain information

>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions	Back alignment and domain information

>PRK06163 hypothetical protein; Provisional	Back alignment and domain information

>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS	Back alignment and domain information

>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE)	Back alignment and domain information

>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv	Back alignment and domain information

>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit	Back alignment and domain information

>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit	Back alignment and domain information

>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins	Back alignment and domain information

>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase)	Back alignment and domain information

>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation	Back alignment and domain information

>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC)	Back alignment and domain information

>PRK07524 hypothetical protein; Provisional	Back alignment and domain information

>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor	Back alignment and domain information

>PRK08327 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD)	Back alignment and domain information

>TIGR01504 glyox_carbo_lig glyoxylate carboligase	Back alignment and domain information

>PRK07092 benzoylformate decarboxylase; Reviewed	Back alignment and domain information

>PRK06154 hypothetical protein; Provisional	Back alignment and domain information

>PRK08266 hypothetical protein; Provisional	Back alignment and domain information

>PRK12474 hypothetical protein; Provisional	Back alignment and domain information

>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor	Back alignment and domain information

>PRK06725 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK06546 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK09107 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria	Back alignment and domain information

>PRK11269 glyoxylate carboligase; Provisional	Back alignment and domain information

>PRK07586 hypothetical protein; Validated	Back alignment and domain information

>PRK05858 hypothetical protein; Provisional	Back alignment and domain information

>PRK06882 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK07064 hypothetical protein; Provisional	Back alignment and domain information

>PRK07979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase	Back alignment and domain information

>TIGR02418 acolac_catab acetolactate synthase, catabolic	Back alignment and domain information

>PRK08199 thiamine pyrophosphate protein; Validated	Back alignment and domain information

>PRK09124 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK06112 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PLN02573 pyruvate decarboxylase	Back alignment and domain information

>PRK07710 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK06965 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR02720 pyruv_oxi_spxB pyruvate oxidase	Back alignment and domain information

>PRK06457 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family	Back alignment and domain information

>PRK06466 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08617 acetolactate synthase; Reviewed	Back alignment and domain information

>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase	Back alignment and domain information

>PRK07525 sulfoacetaldehyde acetyltransferase; Validated	Back alignment and domain information

>PRK08155 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase	Back alignment and domain information

>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways	Back alignment and domain information

>PRK08527 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08273 thiamine pyrophosphate protein; Provisional	Back alignment and domain information

>PRK08322 acetolactate synthase; Reviewed	Back alignment and domain information

>CHL00099 ilvB acetohydroxyacid synthase large subunit	Back alignment and domain information

>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated	Back alignment and domain information

>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed	Back alignment and domain information

>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type	Back alignment and domain information

>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PRK08611 pyruvate oxidase; Provisional	Back alignment and domain information

>PLN02470 acetolactate synthase	Back alignment and domain information

>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family	Back alignment and domain information

>PRK06456 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK09259 putative oxalyl-CoA decarboxylase; Validated	Back alignment and domain information

>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed	Back alignment and domain information

>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion]	Back alignment and domain information

>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>PRK06276 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK07282 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK07789 acetolactate synthase 1 catalytic subunit; Validated	Back alignment and domain information

>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated	Back alignment and domain information

>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>COG3960 Glyoxylate carboligase [General function prediction only]	Back alignment and domain information

>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>COG3962 Acetolactate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG3957 Phosphoketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion]	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism]	Back alignment and domain information

>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes	Back alignment and domain information

>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes	Back alignment and domain information

>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX	Back alignment and domain information

>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins	Back alignment and domain information

>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins	Back alignment and domain information

>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor	Back alignment and domain information

>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated	Back alignment and domain information

>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins	Back alignment and domain information

>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins	Back alignment and domain information

>PRK08611 pyruvate oxidase; Provisional	Back alignment and domain information

>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase	Back alignment and domain information

>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins	Back alignment and domain information

>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated	Back alignment and domain information

>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated	Back alignment and domain information

>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase	Back alignment and domain information

>PRK07525 sulfoacetaldehyde acetyltransferase; Validated	Back alignment and domain information

>PRK07524 hypothetical protein; Provisional	Back alignment and domain information

>PRK09259 putative oxalyl-CoA decarboxylase; Validated	Back alignment and domain information

>PRK06457 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK07064 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase	Back alignment and domain information

>PRK06112 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>PRK07979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK06456 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK08266 hypothetical protein; Provisional	Back alignment and domain information

>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed	Back alignment and domain information

>PRK06276 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PRK08322 acetolactate synthase; Reviewed	Back alignment and domain information

>PRK11269 glyoxylate carboligase; Provisional	Back alignment and domain information

>PRK08273 thiamine pyrophosphate protein; Provisional	Back alignment and domain information

>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains	Back alignment and domain information

>PRK06725 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK06466 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK07586 hypothetical protein; Validated	Back alignment and domain information

>PRK07789 acetolactate synthase 1 catalytic subunit; Validated	Back alignment and domain information

>PLN02470 acetolactate synthase	Back alignment and domain information

>TIGR01504 glyox_carbo_lig glyoxylate carboligase	Back alignment and domain information

>PRK07710 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed	Back alignment and domain information

>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type	Back alignment and domain information

>PRK12474 hypothetical protein; Provisional	Back alignment and domain information

>PRK09107 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins	Back alignment and domain information

>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family	Back alignment and domain information

>PRK08155 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>PRK06965 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2	Back alignment and domain information

>TIGR02720 pyruv_oxi_spxB pyruvate oxidase	Back alignment and domain information

>PRK08199 thiamine pyrophosphate protein; Validated	Back alignment and domain information

>PRK06882 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed	Back alignment and domain information

>PRK07282 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed	Back alignment and domain information

>PRK05858 hypothetical protein; Provisional	Back alignment and domain information

>PRK08327 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>TIGR02418 acolac_catab acetolactate synthase, catabolic	Back alignment and domain information

>PRK08527 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit	Back alignment and domain information

>PRK08617 acetolactate synthase; Reviewed	Back alignment and domain information

>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed	Back alignment and domain information

>CHL00099 ilvB acetohydroxyacid synthase large subunit	Back alignment and domain information

>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>PLN02683 pyruvate dehydrogenase E1 component subunit beta	Back alignment and domain information

>PRK09124 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PLN02573 pyruvate decarboxylase	Back alignment and domain information

>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>TIGR00232 tktlase_bact transketolase, bacterial and yeast	Back alignment and domain information

>PRK06154 hypothetical protein; Provisional	Back alignment and domain information

>PRK06546 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PRK11892 pyruvate dehydrogenase subunit beta; Provisional	Back alignment and domain information

>PRK07092 benzoylformate decarboxylase; Reviewed	Back alignment and domain information

>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK05899 transketolase; Reviewed	Back alignment and domain information

>PTZ00089 transketolase; Provisional	Back alignment and domain information

>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase	Back alignment and domain information

>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only]	Back alignment and domain information

>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional	Back alignment and domain information

>PRK12754 transketolase; Reviewed	Back alignment and domain information

>COG0021 TktA Transketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09212 pyruvate dehydrogenase subunit beta; Validated	Back alignment and domain information

>PLN02790 transketolase	Back alignment and domain information

>PRK12753 transketolase; Reviewed	Back alignment and domain information

>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion]	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		380
2j9f_A		400	Human Branched-Chain Alpha-Ketoacid Dehydrogenase-		1e-105
1dtw_A		400	Human Branched-Chain Alpha-Keto Acid Dehydrogenase		1e-104
1x7y_A		400	Crystal Structure Of The Human Mitochondrial Branch		1e-104
1x80_A		400	Crystal Structure Of The Human Mitochondrial Branch		1e-104
1x7w_A		400	Crystal Structure Of The Human Mitochondrial Branch		1e-104
2bff_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		1e-104
1x7x_A		400	Crystal Structure Of The Human Mitochondrial Branch		1e-104
1x7z_A		400	Crystal Structure Of The Human Mitochondrial Branch		1e-103
1olu_A		400	Roles Of His291-Alpha And His146-Beta' In The Reduc		1e-103
1v16_A		400	Crosstalk Between Cofactor Binding And The Phosphor		1e-102
2bfc_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		1e-102
1v11_A		400	Crosstalk Between Cofactor Binding And The Phosphor		1e-102
2bfe_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		1e-102
2bfb_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		1e-101
1v1m_A		400	Crosstalk Between Cofactor Binding And The Phosphor		1e-101
2bfd_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		1e-101
1um9_A		367	Branched-chain 2-oxo Acid Dehydrogenase (e1) From T		1e-61
3duf_A		369	Snapshots Of Catalysis In The E1 Subunit Of The Pyr		4e-57
1w85_A		368	The Crystal Structure Of Pyruvate Dehydrogenase E1		4e-57
1w88_A		368	The Crystal Structure Of Pyruvate Dehydrogenase E1(		1e-56
3dva_A		369	Snapshots Of Catalysis In The E1 Subunit Of The Pyr		2e-56
2bp7_A		410	New Crystal Form Of The Pseudomonas Putida Branched		3e-50
1qs0_A		407	Crystal Structure Of Pseudomonas Putida 2-Oxoisoval		4e-47
3exe_A		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		7e-28
3exf_A		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		7e-28
3exh_C		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		1e-27
2ozl_A		365	Human Pyruvate Dehydrogenase S264e Variant Length =		1e-27
3exi_A		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		2e-27
1ni4_A		365	Human Pyruvate Dehydrogenase Length = 365		4e-25

>pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400