Citrus Sinensis ID: 016966


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLALNPAESKV
ccEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccEEccHHHHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHcccccccccccccccccHHHHccccEEEEEccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccHHccccccccEEEEcccccccHHHHHcccccccHHHHcccccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccEEEccccccccccccccccccEEEccccccccccHHHHHHHHHccccccEEEEEccccccccccccc
ccccccHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHcEEEEEEccccHHcccccccccccEEEEEEcccccccccccccccccHHHHHcccEEEEEcccccccccHHHHHHHcHccccccccccHHHHHHHHHcEEEEcccccHHHccHHHHHHHHcEEEcccccccccEccccHHHHHHHHEEEEEccccccccccccccccHHHHHHHHHHHcccEEEEEEcccHHccccccHccccEEEEEEEccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccccEcccccccEccccEEEEEEEccccccccccccc
mcgmglglfqGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTkrnvftatneqvdgcrewsdgstikhFTSIVLhgikpnllpevlecpqlellfirgggrddpwetspvtipdnfFKSMIEVRVVNLTdmilpsslgllsnlrtlslcscglpdisfVGYLKKLEILCLrgsdivklpvevGELTWlklldlrdccflkvippnilsklSHLEELYIGRESFVDWEEEVEGVKNASLeelkhlpnltslevhvrdvsslprgllleKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRlegsdlalnpaeskv
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISiastkrnvftatneqvdgcrewsdgSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASleelkhlpnltslevhvrdvsslprgllleklerYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGsshlkrlrlegsdlalnpaeskv
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPsslgllsnlrtlslcsCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLErysiyirryfsrKTGIWCRQFRVELNNKICLKDSLIVQLQRIedlelselqeqdVDYFRNELVKVGSSHLKRLRLEGSDLALNPAESKV
****GLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGS**********************
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLALNPA*S**
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLA********
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLALNP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLLSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSRKTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLALNPAESKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
O81825 919 Probable disease resistan yes no 0.691 0.285 0.290 3e-13
Q42484 909 Disease resistance protei no no 0.622 0.259 0.296 9e-12
Q9T048 985 Disease resistance protei no no 0.762 0.293 0.264 2e-11
Q01730277 Ras suppressor protein 1 yes no 0.358 0.490 0.329 1e-07
Q15404277 Ras suppressor protein 1 yes no 0.358 0.490 0.317 9e-07
Q5E9C0277 Ras suppressor protein 1 yes no 0.358 0.490 0.317 9e-07
B0W6M9 628 Leucine-rich repeat prote N/A no 0.517 0.312 0.295 0.0002
O61967 699 Protein lap1 OS=Caenorhab yes no 0.411 0.223 0.269 0.0007
F1MCA7 1536 Leucine-rich repeat-conta no no 0.221 0.054 0.321 0.0008
Q96NW7 1537 Leucine-rich repeat-conta no no 0.221 0.054 0.321 0.0008
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 134/282 (47%), Gaps = 20/282 (7%)

Query: 7   GLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNV 66
           GL  G +  E   N    LV  LK SC+L D +S   +   MHDVVR  AI   S++   
Sbjct: 392 GLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSC--DTVKMHDVVRDFAIWFMSSQGEG 449

Query: 67  FTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPE-VLECPQLELLFIRGGGRDDPW 125
           F +      G  E+     +     + L   K   LP  V+E  +  +L ++G       
Sbjct: 450 FHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGN------ 503

Query: 126 ETSPVTIPDNFFKSMIEVRVVNLTDM---ILPSSLGLLSNLRTLSLCSCG-LPDISFVGY 181
            +    +P+ F ++   +R+++L+ +    LP S   L +LR+L L +C  L ++  +  
Sbjct: 504 -SHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query: 182 LKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRE 241
           L KL+ L L  S I +LP  +  L+ L+ + + +   L+ IP   + +LS LE L +   
Sbjct: 563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query: 242 SFVDWE---EEVEGVKNASLEELKHLPNLTSLEVHVRDVSSL 280
           ++  W    EE EG   A+L+E+  LP+L  L + + DV S 
Sbjct: 623 AY-SWGIKGEEREG--QATLDEVTCLPHLQFLAIKLLDVLSF 661




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=2 SV=3 Back     alignment and function description
>sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 Back     alignment and function description
>sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
255563252 1603 Disease resistance protein RPS5, putativ 0.923 0.218 0.417 3e-55
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.918 0.141 0.410 4e-55
225016144 3196 Rpp4 candidate 2 [Glycine max] 0.754 0.089 0.455 2e-54
356566878 2804 PREDICTED: uncharacterized protein LOC10 0.754 0.101 0.455 2e-54
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.920 0.265 0.394 3e-54
359488101 1677 PREDICTED: disease resistance protein At 0.849 0.192 0.422 6e-54
359488108 1436 PREDICTED: disease resistance protein At 0.860 0.227 0.430 6e-54
328447248 3009 Rpp4 candidate R1 [Glycine max] 0.746 0.094 0.447 9e-54
225016141 3055 Rpp4 candidate 1 [Glycine max] 0.746 0.092 0.447 9e-54
359487924 1731 PREDICTED: uncharacterized protein LOC10 0.854 0.187 0.413 9e-54
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  222 bits (565), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 220/376 (58%), Gaps = 26/376 (6%)

Query: 1   MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIA 60
           M   GLGLF+G++ +  ARNRVH L+  LKA+C+LLD  S+ +    +HDVVR VAISIA
Sbjct: 421 MYSTGLGLFKGIDTLGDARNRVHKLISDLKAACLLLD--SDIKGRVKIHDVVRDVAISIA 478

Query: 61  STKRNVFTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGG 120
           S  +++FT  N  +   +EW +    K  T I L     + LPEVLECP+LEL  +    
Sbjct: 479 SRMQHLFTVRNGAL--LKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFT-- 534

Query: 121 RDDPWETSPVTIPDNFFKSMIEVRVVNLTDM---ILPSSLGLLSNLRTLSLCSCGLPDIS 177
                +   + +PD  F+    +RV+N T M    LP SLG L NL TL L  C L D++
Sbjct: 535 -----QDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVA 589

Query: 178 FVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELY 237
            +G L  L IL  + SDIV+LP E+ +LT LK LDL  C  LKVIP  I+S+L+ LEELY
Sbjct: 590 IIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELY 649

Query: 238 IGRESFVDWEEEVEGV---KNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSI 294
           +   SF  W  +V+G+   +NASL EL+ LP LT+LE+ V D   LP+ L   KLER+ I
Sbjct: 650 MNN-SFDLW--DVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRI 706

Query: 295 YIRRYFSRKTGIW--CRQFRVELN-NKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNE 351
           +I   +S  TG +   R  +++LN + I L+  L + L+  EDL L+E+  + +     +
Sbjct: 707 FIGDVWS-GTGDYGTSRTLKLKLNTSSIHLEHGLSILLEVTEDLYLAEV--KGIKSVLYD 763

Query: 352 LVKVGSSHLKRLRLEG 367
           L   G + LK L ++ 
Sbjct: 764 LDSQGFTQLKHLDVQN 779




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225016144|gb|ACN78968.1| Rpp4 candidate 2 [Glycine max] Back     alignment and taxonomy information
>gi|356566878|ref|XP_003551653.1| PREDICTED: uncharacterized protein LOC100819614 [Glycine max] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488101|ref|XP_002263761.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|328447248|gb|AEB06126.1| Rpp4 candidate R1 [Glycine max] Back     alignment and taxonomy information
>gi|225016141|gb|ACN78965.1| Rpp4 candidate 1 [Glycine max] Back     alignment and taxonomy information
>gi|359487924|ref|XP_003633676.1| PREDICTED: uncharacterized protein LOC100246921 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.688 0.284 0.270 1.6e-09
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.688 0.264 0.250 2.3e-08
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.321 0.136 0.294 3.9e-05
TAIR|locus:2005517 909 RPS2 "RESISTANT TO P. SYRINGAE 0.266 0.111 0.361 9.4e-05
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 170 (64.9 bits), Expect = 1.6e-09, P = 1.6e-09
 Identities = 76/281 (27%), Positives = 124/281 (44%)

Query:     7 GLFQGVNKMEAARNRVHALVRTLKASCMLLDHESEKEELFSMHDVVRHVAISIASTKRNV 66
             GL  G +  E   N    LV  LK SC+L D +S   +   MHDVVR  AI   S++   
Sbjct:   392 GLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSC--DTVKMHDVVRDFAIWFMSSQGEG 449

Query:    67 FTATNEQVDGCREWSDGSTIKHFTSIVLHGIKPNLLPE-VLECPQLELLFIRGGGRDDPW 125
             F +      G  E+     +     + L   K   LP  V+E  +  +L ++G       
Sbjct:   450 FHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKE- 508

Query:   126 ETSPVTIPDNFFKSMIEVRVVNLTDM---ILPXXXXXXXXXXXXXXXXCG-LPDISFVGY 181
                   +P+ F ++   +R+++L+ +    LP                C  L ++  +  
Sbjct:   509 ------VPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query:   182 LKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRE 241
             L KL+ L L  S I +LP  +  L+ L+ + + +   L+ IP   + +LS LE L +   
Sbjct:   563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query:   242 SFVDWE---EEVEGVKNASLEELKHLPNLTSLEVHVRDVSS 279
             ++  W    EE EG   A+L+E+  LP+L  L + + DV S
Sbjct:   623 AY-SWGIKGEEREG--QATLDEVTCLPHLQFLAIKLLDVLS 660




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 38.8 bits (90), Expect = 0.004
 Identities = 40/175 (22%), Positives = 72/175 (41%), Gaps = 6/175 (3%)

Query: 122 DDPWETSPVTIPDNFFKSMIEVRVVNLTDMILPSSLGLL-SNLRTLSLCSCGLPDISF-V 179
            +   ++   + +    + +++   N+TD  +P  +GLL SNL+ L L    +  +   +
Sbjct: 102 LNRLRSNISELLELTNLTSLDLDNNNITD--IPPLIGLLKSNLKELDLSDNKIESLPSPL 159

Query: 180 GYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIG 239
             L  L+ L L  +D+  LP  +  L+ L  LDL       +  P  +  LS LEEL + 
Sbjct: 160 RNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDL--PPEIELLSALEELDLS 217

Query: 240 RESFVDWEEEVEGVKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSI 294
             S ++    +  +KN S  EL +       E      +     L   ++   S 
Sbjct: 218 NNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISS 272


Length = 394

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.8
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.74
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.74
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.54
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.48
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.41
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.32
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.8
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.66
PLN03150623 hypothetical protein; Provisional 98.61
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
PLN03150623 hypothetical protein; Provisional 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.37
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.37
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.15
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.15
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.09
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.97
PRK15386 426 type III secretion protein GogB; Provisional 97.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.71
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.68
KOG4341483 consensus F-box protein containing LRR [General fu 97.66
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.42
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.32
KOG4341483 consensus F-box protein containing LRR [General fu 97.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.12
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.86
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.47
smart0037026 LRR Leucine-rich repeats, outliers. 91.15
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.01
KOG4308478 consensus LRR-containing protein [Function unknown 88.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.81
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.65
KOG4308478 consensus LRR-containing protein [Function unknown 84.97
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.49
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.97  E-value=4.7e-31  Score=263.19  Aligned_cols=336  Identities=25%  Similarity=0.311  Sum_probs=232.5

Q ss_pred             CcccccccccccchHHHHHHHHHHHHHHHHHhccceeccc-cccCeEeechhHHHHHHHHhh-----cccceEEecCCcc
Q 016966            1 MCGMGLGLFQGVNKMEAARNRVHALVRTLKASCMLLDHES-EKEELFSMHDVVRHVAISIAS-----TKRNVFTATNEQV   74 (379)
Q Consensus         1 ~~Wiaeg~i~~~~~~e~~~~~~~~~~~~L~~~~l~~~~~~-~~~~~~~~hdl~~d~~~~~~~-----~~~~~~~~~~~~~   74 (379)
                      .||||||||++....+.|++.+++|+.+|++++|++.... ++..+|+|||+|||+|.++|+     +++  ..+..+. 
T Consensus       435 ~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~--~iv~~~~-  511 (889)
T KOG4658|consen  435 EYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN--QIVSDGV-  511 (889)
T ss_pred             HHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc--eEEECCc-
Confidence            3899999999876777899999999999999999998764 357899999999999999999     666  3333332 


Q ss_pred             ccCcCCCCCCccCCccEEEEeCCCCCCCCCCCCCCCccEEEeecCCCCCCCCCCCcccChhhhhCCCceeEEEecCCC--
Q 016966           75 DGCREWSDGSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMI--  152 (379)
Q Consensus        75 ~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~--  152 (379)
                       ++.+.+....+..+|++++.++.+..++....+++|++|.+.+|..   |   ...++..+|..|+.|++||+++|.  
T Consensus       512 -~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~---~---l~~is~~ff~~m~~LrVLDLs~~~~l  584 (889)
T KOG4658|consen  512 -GLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSD---W---LLEISGEFFRSLPLLRVLDLSGNSSL  584 (889)
T ss_pred             -CccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecch---h---hhhcCHHHHhhCcceEEEECCCCCcc
Confidence             4445566778899999999999998888888888999999999542   1   567888889999999999999887  


Q ss_pred             --CCccccCCCCCcEEEeecCCCCC-cccccCcCCCcEEEeeCCc-CcccchhhcCCCCCCEEeccCCCC-CcccChhhh
Q 016966          153 --LPSSLGLLSNLRTLSLCSCGLPD-ISFVGYLKKLEILCLRGSD-IVKLPVEVGELTWLKLLDLRDCCF-LKVIPPNIL  227 (379)
Q Consensus       153 --lp~~i~~l~~L~~L~l~~~~l~~-~~~~~~l~~L~~L~l~~~~-l~~lp~~~~~l~~L~~L~l~~~~~-~~~~~~~~l  227 (379)
                        +|.+|+.|.+||||+++++.+.. |..++++.+|.+|++..+. +..+|.....|++||+|.+..... ....-...+
T Consensus       585 ~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el  664 (889)
T KOG4658|consen  585 SKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKEL  664 (889)
T ss_pred             CcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccccccchhhHHhh
Confidence              99999999999999999999999 9999999999999999984 445555566699999999876431 111111113


Q ss_pred             CCCCCCcEEEecCCCCcChhhhhhcccccchHhhcCCCCCcE----EEeeccCCCCCCccc-cccCCcEEEEEeeccccc
Q 016966          228 SKLSHLEELYIGRESFVDWEEEVEGVKNASLEELKHLPNLTS----LEVHVRDVSSLPRGL-LLEKLERYSIYIRRYFSR  302 (379)
Q Consensus       228 ~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~----L~l~~~~~~~~~~~~-~~~~L~~L~l~~~~~~~~  302 (379)
                      .++.+|+.+.+.....            .....+..++.|++    +.+.++.....+... .+++|+.|.+..+.....
T Consensus       665 ~~Le~L~~ls~~~~s~------------~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~  732 (889)
T KOG4658|consen  665 ENLEHLENLSITISSV------------LLLEDLLGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEI  732 (889)
T ss_pred             hcccchhhheeecchh------------HhHhhhhhhHHHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchh
Confidence            4444455444432221            02233334444442    332233333233333 678888888855544311


Q ss_pred             CcccccceEEEEeCCcccchHHHHHHhcccceeeccccccccccccccccccccCCCCcEEEecCCCCccCCCC
Q 016966          303 KTGIWCRQFRVELNNKICLKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLALNPAE  376 (379)
Q Consensus       303 ~~~~~~~~~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~  376 (379)
                      .. .|....        ....    .|+++..+.+.+|.  ..+...+..+   .|+|+.|.+..|+.++.|..
T Consensus       733 ~~-~~~~~~--------~~~~----~f~~l~~~~~~~~~--~~r~l~~~~f---~~~L~~l~l~~~~~~e~~i~  788 (889)
T KOG4658|consen  733 VI-EWEESL--------IVLL----CFPNLSKVSILNCH--MLRDLTWLLF---APHLTSLSLVSCRLLEDIIP  788 (889)
T ss_pred             hc-cccccc--------chhh----hHHHHHHHHhhccc--cccccchhhc---cCcccEEEEecccccccCCC
Confidence            11 010000        0000    14566666666666  5666655544   46777777777766665543



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 73.1 bits (180), Expect = 1e-14
 Identities = 36/141 (25%), Positives = 60/141 (42%), Gaps = 21/141 (14%)

Query: 153 LPSSLGLLSNLRTLSLCSCGLPDI-SFVGYLKKLEILCLRG-SDIVKLPVEVGELTWLKL 210
           LP+S+  L NL++L + +  L  +   + +L KLE L LRG + +   P   G    LK 
Sbjct: 198 LPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKR 257

Query: 211 LDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASL----EELKHLPN 266
           L L+DC  L  +P +I  +L+ LE+L +                  +L      +  LP 
Sbjct: 258 LILKDCSNLLTLPLDI-HRLTQLEKLDLR--------------GCVNLSRLPSLIAQLPA 302

Query: 267 LTSLEVHVRDVSSLPRGLLLE 287
              + V     + L +   + 
Sbjct: 303 NCIILVPPHLQAQLDQHRPVA 323


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.89
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.85
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.59
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.58
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.53
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.34
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.87
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.86
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.73
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.69
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.27
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.79
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.73
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.49
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.21
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.64
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.19
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 89.81
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 86.35
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.91  E-value=5.6e-23  Score=188.58  Aligned_cols=264  Identities=19%  Similarity=0.175  Sum_probs=126.6

Q ss_pred             CCccCCccEEEEeCCCCCCCCCCCCCCCccEEEeecCCCCCCCCCCCcccChhhhhCCCceeEEEecCCC---CCccccC
Q 016966           83 GSTIKHFTSIVLHGIKPNLLPEVLECPQLELLFIRGGGRDDPWETSPVTIPDNFFKSMIEVRVVNLTDMI---LPSSLGL  159 (379)
Q Consensus        83 ~~~~~~l~~L~l~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~---lp~~i~~  159 (379)
                      ...++++++|++++|.+..++.+..+++|++|++++|.+.+        ++  .|..+++|++|++++|.   ++. +..
T Consensus        62 ~~~~~~L~~L~l~~n~i~~~~~~~~l~~L~~L~L~~n~i~~--------~~--~~~~l~~L~~L~l~~n~i~~~~~-~~~  130 (347)
T 4fmz_A           62 IEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITD--------IS--ALQNLTNLRELYLNEDNISDISP-LAN  130 (347)
T ss_dssp             GGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCC--------CG--GGTTCTTCSEEECTTSCCCCCGG-GTT
T ss_pred             hhhcCCccEEEccCCccccchhhhcCCcCCEEEccCCcccC--------ch--HHcCCCcCCEEECcCCcccCchh-hcc
Confidence            44556666666666666555555566666666666654322        22  24556666666666665   332 555


Q ss_pred             CCCCcEEEeecCCCCC-cccccCcCCCcEEEeeCCcCcccchhhcCCCCCCEEeccCCCCCcccChhhhCCCCCCcEEEe
Q 016966          160 LSNLRTLSLCSCGLPD-ISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYI  238 (379)
Q Consensus       160 l~~L~~L~l~~~~l~~-~~~~~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l  238 (379)
                      +++|++|++++|.... ++.+..+++|++|++++|.+..++. +..+++|++|++++|.. ..++.  +..+++|+.|++
T Consensus       131 l~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~-~~~l~~L~~L~l~~n~l-~~~~~--~~~l~~L~~L~l  206 (347)
T 4fmz_A          131 LTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTP-IANLTDLYSLSLNYNQI-EDISP--LASLTSLHYFTA  206 (347)
T ss_dssp             CTTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSSCCCCCGG-GGGCTTCSEEECTTSCC-CCCGG--GGGCTTCCEEEC
T ss_pred             CCceeEEECCCCCCcccccchhhCCCCcEEEecCCCcCCchh-hccCCCCCEEEccCCcc-ccccc--ccCCCccceeec
Confidence            6666666666654333 4445555556666665555555443 55555555555555432 22222  344444444444


Q ss_pred             cCCCCcChhhhhhc------------ccccchHhhcCCCCCcEEEeeccCCCCCCccccccCCcEEEEEeeccccc-Ccc
Q 016966          239 GRESFVDWEEEVEG------------VKNASLEELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFSR-KTG  305 (379)
Q Consensus       239 ~~~~~~~~~~~~~~------------~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~-~~~  305 (379)
                      .+|.+....+ ...            .....+ .+..+++|+.|++++|.+..++....+++|+.|+++.+..... ...
T Consensus       207 ~~n~l~~~~~-~~~~~~L~~L~l~~n~l~~~~-~~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~~~  284 (347)
T 4fmz_A          207 YVNQITDITP-VANMTRLNSLKIGNNKITDLS-PLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLN  284 (347)
T ss_dssp             CSSCCCCCGG-GGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGG
T ss_pred             ccCCCCCCch-hhcCCcCCEEEccCCccCCCc-chhcCCCCCEEECCCCccCCChhHhcCCCcCEEEccCCccCCChhhc
Confidence            4444433210 000            000011 1455555555555555555443322455555555543332211 112


Q ss_pred             cccceEEEEe-CCccc--chHHHHHHhcccceeeccccccccccccccccccccCCCCcEEEecCCCC
Q 016966          306 IWCRQFRVEL-NNKIC--LKDSLIVQLQRIEDLELSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDL  370 (379)
Q Consensus       306 ~~~~~~~L~l-~~~~~--~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~  370 (379)
                      .+++...|.+ ++...  .+..+.. +++|+.|++++|+   ++.++. +  ..+++|++|++++|++
T Consensus       285 ~l~~L~~L~L~~n~l~~~~~~~l~~-l~~L~~L~L~~n~---l~~~~~-~--~~l~~L~~L~l~~N~i  345 (347)
T 4fmz_A          285 NLSQLNSLFLNNNQLGNEDMEVIGG-LTNLTTLFLSQNH---ITDIRP-L--ASLSKMDSADFANQVI  345 (347)
T ss_dssp             GCTTCSEEECCSSCCCGGGHHHHHT-CTTCSEEECCSSS---CCCCGG-G--GGCTTCSEESSSCC--
T ss_pred             CCCCCCEEECcCCcCCCcChhHhhc-cccCCEEEccCCc---cccccC-h--hhhhccceeehhhhcc
Confidence            2233335555 22221  2333334 2556666666665   444333 1  2356666666666554



>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 49.2 bits (116), Expect = 4e-07
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 160 LSNLRTLSLCSCGLPDISFVGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFL 219
           L NL  L+L    + DIS V  L KL+ L    + +  +   +  LT +  L        
Sbjct: 306 LKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQIS 364

Query: 220 KVIPPNILSKLSHLEELYI 238
            + P   L+ L+ + +L +
Sbjct: 365 DLTP---LANLTRITQLGL 380


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.11
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.03
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.0
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.81
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.14
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.0
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.81  E-value=1.3e-18  Score=159.17  Aligned_cols=173  Identities=19%  Similarity=0.201  Sum_probs=84.3

Q ss_pred             ccCcCCCcEEEeeCCcCcccchhhcCCCCCCEEeccCCCCCcccChhhhCCCCCCcEEEecCCCCcChhhhhhcccccch
Q 016966          179 VGYLKKLEILCLRGSDIVKLPVEVGELTWLKLLDLRDCCFLKVIPPNILSKLSHLEELYIGRESFVDWEEEVEGVKNASL  258 (379)
Q Consensus       179 ~~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~  258 (379)
                      ...+++++.++++++.++.++. ...+++|++|++++|.. ..++.  +..+++|+.|++.+|.+.+.            
T Consensus       193 ~~~l~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l-~~~~~--l~~l~~L~~L~l~~n~l~~~------------  256 (384)
T d2omza2         193 LAKLTNLESLIATNNQISDITP-LGILTNLDELSLNGNQL-KDIGT--LASLTNLTDLDLANNQISNL------------  256 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCC-CCCGG--GGGCTTCSEEECCSSCCCCC------------
T ss_pred             cccccccceeeccCCccCCCCc-ccccCCCCEEECCCCCC-CCcch--hhcccccchhccccCccCCC------------
Confidence            3344556666666666555542 34455666666666442 23332  45566666666666655542            


Q ss_pred             HhhcCCCCCcEEEeeccCCCCCCccccccCCcEEEEEeecccc-cCcccccceEEEEe-CCcccchHHHHHHhcccceee
Q 016966          259 EELKHLPNLTSLEVHVRDVSSLPRGLLLEKLERYSIYIRRYFS-RKTGIWCRQFRVEL-NNKICLKDSLIVQLQRIEDLE  336 (379)
Q Consensus       259 ~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~-~~~~~~~~~~~L~l-~~~~~~~~~~~~~~~~L~~L~  336 (379)
                      ..++.+++|+.|+++++.+..++....++.++.+.+..+.... ......++...|++ .+.......+.. +++|+.|+
T Consensus       257 ~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l~~l~~-l~~L~~L~  335 (384)
T d2omza2         257 APLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSS-LTKLQRLF  335 (384)
T ss_dssp             GGGTTCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCCGGGGG-CTTCCEEE
T ss_pred             CcccccccCCEeeccCcccCCCCccccccccccccccccccccccccchhcccCeEECCCCCCCCCccccc-CCCCCEEE
Confidence            2355556666666666655555443344555555443222111 11122223334555 222221112333 36666666


Q ss_pred             ccccccccccccccccccccCCCCcEEEecCCCCccCC
Q 016966          337 LSELQEQDVDYFRNELVKVGSSHLKRLRLEGSDLALNP  374 (379)
Q Consensus       337 l~~~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~~  374 (379)
                      +++|.   ++.++. +  .++++|++|++++|+....+
T Consensus       336 L~~n~---l~~l~~-l--~~l~~L~~L~l~~N~l~~l~  367 (384)
T d2omza2         336 FANNK---VSDVSS-L--ANLTNINWLSAGHNQISDLT  367 (384)
T ss_dssp             CCSSC---CCCCGG-G--GGCTTCCEEECCSSCCCBCG
T ss_pred             CCCCC---CCCChh-H--cCCCCCCEEECCCCcCCCCh
Confidence            66665   444442 2  23566666666666555443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure