Citrus Sinensis ID: 017141


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------
MAAYMPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFALST
ccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccEEEEccccccccHHHHHcccEEEEEEEccccccccccEEEEEEEEEEEccccEEEEEccccccccccccEEEEcccccccccEEEccccccEEEEEcc
ccEEEEcccccccccEccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEEccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHcHHHcccccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEcccccEEEEEcccccHHHcccEEEEEEcEEcccEEEEEEcccccccccccc
maaympqtenpspaiyiprewsdaadsiaydsntspppiaficgakncgkttFSRHLVNVLLQRYKKVayldtdvgqpeftapgflsltvvdtltpdltipclktpkrcyffgdvsskrdptAYLKYITTLYDYYRKEYYmfnesespgrtelplivntpgwvkgIGYDILVDMLKYITPTHVVKINISFekknlpagafwldnfegvdvNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRqcfpsdlnITIIKELAQALaayppyqvpissikirhlycqvprseifYSLNATIVGLAIssdasenlphcvglGIVRGIDTLKGLLyvitpvppgiLEKVDLFLQGFIQIPTCLLQVTISFGQQYFALST
maaympqtenpspaiyIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDltipclktpkrcyffgdvsskrdptayLKYITTLYDYYRKEYYMFNEsespgrtelplIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISsarqdsfnrsvlvqkdaRLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFALST
MAAYMPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFlsltvvdtltpdltIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFALST
**************IYIPREWSDAADSIAY******PPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESE*PGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFA***
**A************YI**EWSD***************IAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFAL**
*********NPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFALST
*AA*MPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFAL**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAYMPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQVTISFGQQYFALST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query376 2.2.26 [Sep-21-2011]
Q8VYP6368 Polynucleotide 5'-hydroxy yes no 0.930 0.951 0.628 1e-134
E1BPN0694 Polynucleotide 5'-hydroxy yes no 0.805 0.436 0.294 4e-35
Q3TZX8714 Polynucleotide 5'-hydroxy yes no 0.805 0.424 0.290 5e-35
Q5SY16702 Polynucleotide 5'-hydroxy yes no 0.805 0.431 0.296 2e-34
Q9UU96736 Polynucleotide 5'-hydroxy yes no 0.835 0.426 0.258 2e-22
Q54Z27683 Polynucleotide 5'-hydroxy yes no 0.420 0.231 0.322 3e-22
P0CM78744 Polynucleotide 5'-hydroxy yes no 0.888 0.448 0.253 3e-22
P0CM79744 Polynucleotide 5'-hydroxy N/A no 0.888 0.448 0.253 3e-22
Q4IR18720 Polynucleotide 5'-hydroxy yes no 0.781 0.408 0.273 6e-22
A8WQV9548 Polynucleotide 5'-hydroxy N/A no 0.832 0.571 0.284 2e-19
>sp|Q8VYP6|NOL9_ARATH Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Arabidopsis thaliana GN=At5g11010 PE=2 SV=1 Back     alignment and function desciption
 Score =  477 bits (1227), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/361 (62%), Positives = 290/361 (80%), Gaps = 11/361 (3%)

Query: 5   MPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQR 64
           M + EN  P  +IP EWS+AA S++   ++  P IA +CG KN GK+TFSR+LV VLLQR
Sbjct: 1   MSEAENKLP--FIPEEWSNAASSVS--CSSLQPVIALVCGPKNSGKSTFSRNLVEVLLQR 56

Query: 65  YKKVAYLDTDVGQPEFTAPGFLSLTVVDT--LTPDLTIPCLKTPKRCYFFGDVSSKRDPT 122
           YK+VAYLDTDVGQPEFTAPGFLSLT+VD   L  D T+PC+KTP+RC+F+GDVSSKRDP 
Sbjct: 57  YKRVAYLDTDVGQPEFTAPGFLSLTIVDKSILESDWTVPCVKTPERCFFYGDVSSKRDPK 116

Query: 123 AYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTH 182
           AYL+Y+ TL+DYY+  +   +E+    +TELPL++NTPGWVKGIGY++LVD+L+Y++P+H
Sbjct: 117 AYLRYVYTLFDYYQLHFCKSSEN----KTELPLVINTPGWVKGIGYELLVDVLRYVSPSH 172

Query: 183 VVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIM 242
           VVKINIS   KNLPAG FWLD  +    +LIEI SA QD +N+S+L+ KDARL+RD+RI+
Sbjct: 173 VVKINISAYNKNLPAGLFWLDGNDDETAHLIEIQSAYQDRYNQSILIHKDARLMRDMRII 232

Query: 243 AYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVG 302
           AYFRQCF     +  IKEL   LA++ PY+VPISS+ I HL+CQ+P SE++YSLNA+IVG
Sbjct: 233 AYFRQCFKGK-EVNTIKELTHELASHIPYEVPISSLTINHLHCQIPSSEVYYSLNASIVG 291

Query: 303 LAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQ 362
           L IS++  E+LP CVGLGIVRGIDT +G+LYVITPVP  ++EKVDL LQG+IQ+PTCLL+
Sbjct: 292 LGISTEVFEDLPSCVGLGIVRGIDTERGILYVITPVPENLVEKVDLLLQGYIQLPTCLLE 351

Query: 363 V 363
           V
Sbjct: 352 V 352




Polynucleotide 5'-kinase involved in rRNA processing.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: -
>sp|E1BPN0|NOL9_BOVIN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Bos taurus GN=NOL9 PE=3 SV=1 Back     alignment and function description
>sp|Q3TZX8|NOL9_MOUSE Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Mus musculus GN=Nol9 PE=1 SV=1 Back     alignment and function description
>sp|Q5SY16|NOL9_HUMAN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens GN=NOL9 PE=1 SV=1 Back     alignment and function description
>sp|Q9UU96|GRC3_SCHPO Polynucleotide 5'-hydroxyl-kinase grc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grc3 PE=1 SV=1 Back     alignment and function description
>sp|Q54Z27|NOL9_DICDI Polynucleotide 5'-hydroxyl-kinase nol9 OS=Dictyostelium discoideum GN=nol9 PE=3 SV=1 Back     alignment and function description
>sp|P0CM78|GRC3_CRYNJ Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GRC3 PE=3 SV=1 Back     alignment and function description
>sp|P0CM79|GRC3_CRYNB Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GRC3 PE=3 SV=1 Back     alignment and function description
>sp|Q4IR18|GRC3_GIBZE Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GRC3 PE=3 SV=2 Back     alignment and function description
>sp|A8WQV9|NOL9_CAEBR Polynucleotide 5'-hydroxyl-kinase nol-9 OS=Caenorhabditis briggsae GN=nol-9 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
255540835381 conserved hypothetical protein [Ricinus 0.962 0.950 0.782 1e-167
225456594378 PREDICTED: polynucleotide 5'-hydroxyl-ki 0.962 0.957 0.782 1e-166
118484105375 unknown [Populus trichocarpa] 0.952 0.954 0.770 1e-163
224121594377 predicted protein [Populus trichocarpa] 0.952 0.949 0.765 1e-162
449469486379 PREDICTED: polynucleotide 5'-hydroxyl-ki 0.962 0.955 0.752 1e-160
449487795379 PREDICTED: polynucleotide 5'-hydroxyl-ki 0.962 0.955 0.75 1e-159
356513953372 PREDICTED: polynucleotide 5'-hydroxyl-ki 0.933 0.943 0.725 1e-153
356507198370 PREDICTED: polynucleotide 5'-hydroxyl-ki 0.933 0.948 0.711 1e-149
356519009354 PREDICTED: polynucleotide 5'-hydroxyl-ki 0.930 0.988 0.702 1e-145
30683442368 Pre-mRNA cleavage complex II protein fam 0.930 0.951 0.628 1e-132
>gi|255540835|ref|XP_002511482.1| conserved hypothetical protein [Ricinus communis] gi|223550597|gb|EEF52084.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 284/363 (78%), Positives = 322/363 (88%), Gaps = 1/363 (0%)

Query: 1   MAAYMPQTENPS-PAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVN 59
           MA+ + +TE  S P+I+IP+EWS+AA++IAYDS TSP P++ ICGAKNCGKTTFSR+L+N
Sbjct: 1   MASNILETEEASSPSIHIPQEWSEAANTIAYDSPTSPLPVSLICGAKNCGKTTFSRYLLN 60

Query: 60  VLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKR 119
            LLQRY++V YLDTDVGQPEFT PGF+SLTVVD LTPDLTIPCLKTP+RC+FFGDVSSKR
Sbjct: 61  TLLQRYRRVGYLDTDVGQPEFTTPGFVSLTVVDKLTPDLTIPCLKTPERCFFFGDVSSKR 120

Query: 120 DPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYIT 179
           DP+ YLKYI+TL +YYRKEY + N SES  +TELPL+VNTPGWVKG+GYDILVDM+K I 
Sbjct: 121 DPSTYLKYISTLCNYYRKEYCISNTSESTAKTELPLVVNTPGWVKGVGYDILVDMVKCIA 180

Query: 180 PTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDL 239
           P+HVVKINIS E+KNLPAGAFWLD     +VNLIEI+SAR DSFNRSVLVQKDARLLRDL
Sbjct: 181 PSHVVKINISSERKNLPAGAFWLDEDFCEEVNLIEINSARHDSFNRSVLVQKDARLLRDL 240

Query: 240 RIMAYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNAT 299
           RIMAYFRQCF S LNIT IKELA ALA++PPYQVPISSIKIRHL+CQVP +EIFYSLNA+
Sbjct: 241 RIMAYFRQCFSSSLNITTIKELANALASHPPYQVPISSIKIRHLHCQVPHTEIFYSLNAS 300

Query: 300 IVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTC 359
           IVGLA+SS+ SE LP C GLGIVRGIDT KGLLY+ITPVPP  LEKVDL LQGFIQIPTC
Sbjct: 301 IVGLAVSSEQSETLPWCSGLGIVRGIDTSKGLLYMITPVPPSSLEKVDLLLQGFIQIPTC 360

Query: 360 LLQ 362
           LLQ
Sbjct: 361 LLQ 363




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225456594|ref|XP_002267234.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9 [Vitis vinifera] gi|297734062|emb|CBI15309.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|118484105|gb|ABK93937.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224121594|ref|XP_002318622.1| predicted protein [Populus trichocarpa] gi|222859295|gb|EEE96842.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469486|ref|XP_004152451.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487795|ref|XP_004157804.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513953|ref|XP_003525672.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Glycine max] Back     alignment and taxonomy information
>gi|356507198|ref|XP_003522357.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Glycine max] Back     alignment and taxonomy information
>gi|356519009|ref|XP_003528167.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase NOL9-like [Glycine max] Back     alignment and taxonomy information
>gi|30683442|ref|NP_850805.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana] gi|42573337|ref|NP_974765.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana] gi|75161516|sp|Q8VYP6.1|NOL9_ARATH RecName: Full=Polynucleotide 5'-hydroxyl-kinase NOL9; AltName: Full=Nucleolar protein 9 homolog gi|17979299|gb|AAL49875.1| unknown protein [Arabidopsis thaliana] gi|20465981|gb|AAM20212.1| unknown protein [Arabidopsis thaliana] gi|332004238|gb|AED91621.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana] gi|332004239|gb|AED91622.1| Pre-mRNA cleavage complex II protein family [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
TAIR|locus:2183830368 AT5G11010 [Arabidopsis thalian 0.930 0.951 0.606 4.2e-118
UNIPROTKB|E1BPN0694 NOL9 "Polynucleotide 5'-hydrox 0.414 0.224 0.302 9.5e-33
UNIPROTKB|Q5SY16702 NOL9 "Polynucleotide 5'-hydrox 0.414 0.222 0.337 3.2e-32
UNIPROTKB|E2R0I7520 NOL9 "Uncharacterized protein" 0.414 0.3 0.302 9.4e-32
UNIPROTKB|I3LBV6694 NOL9 "Uncharacterized protein" 0.414 0.224 0.308 4.2e-31
MGI|MGI:1921285714 Nol9 "nucleolar protein 9" [Mu 0.359 0.189 0.328 2.9e-29
UNIPROTKB|G3V7B0714 Nol9 "Protein Nol9" [Rattus no 0.417 0.219 0.286 5e-29
DICTYBASE|DDB_G0277945683 nol9 "NUC156 family protein" [ 0.430 0.237 0.306 7.4e-27
POMBASE|SPCC830.03736 grc3 "polynucleotide kinase Gr 0.760 0.388 0.262 3.1e-21
RGD|1566167303 Nol9 "nucleolar protein 9" [Ra 0.327 0.405 0.347 3.7e-19
TAIR|locus:2183830 AT5G11010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1163 (414.5 bits), Expect = 4.2e-118, P = 4.2e-118
 Identities = 219/361 (60%), Positives = 279/361 (77%)

Query:     5 MPQTENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQR 64
             M + EN  P  +IP EWS+AA S++  S    P IA +CG KN GK+TFSR+LV VLLQR
Sbjct:     1 MSEAENKLP--FIPEEWSNAASSVSCSS--LQPVIALVCGPKNSGKSTFSRNLVEVLLQR 56

Query:    65 YKKVAYLDTDVGQPEFTAPGFXXXXXXXXXXXXX--XIPCLKTPKRCYFFGDVSSKRDPT 122
             YK+VAYLDTDVGQPEFTAPGF                +PC+KTP+RC+F+GDVSSKRDP 
Sbjct:    57 YKRVAYLDTDVGQPEFTAPGFLSLTIVDKSILESDWTVPCVKTPERCFFYGDVSSKRDPK 116

Query:   123 AYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYITPTH 182
             AYL+Y+ TL+DYY+  +   +E+    +TELPL++NTPGWVKGIGY++LVD+L+Y++P+H
Sbjct:   117 AYLRYVYTLFDYYQLHFCKSSEN----KTELPLVINTPGWVKGIGYELLVDVLRYVSPSH 172

Query:   183 VVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIM 242
             VVKINIS   KNLPAG FWLD  +    +LIEI SA QD +N+S+L+ KDARL+RD+RI+
Sbjct:   173 VVKINISAYNKNLPAGLFWLDGNDDETAHLIEIQSAYQDRYNQSILIHKDARLMRDMRII 232

Query:   243 AYFRQCFPSDLNITIIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVG 302
             AYFRQCF     +  IKEL   LA++ PY+VPISS+ I HL+CQ+P SE++YSLNA+IVG
Sbjct:   233 AYFRQCFKGK-EVNTIKELTHELASHIPYEVPISSLTINHLHCQIPSSEVYYSLNASIVG 291

Query:   303 LAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQIPTCLLQ 362
             L IS++  E+LP CVGLGIVRGIDT +G+LYVITPVP  ++EKVDL LQG+IQ+PTCLL+
Sbjct:   292 LGISTEVFEDLPSCVGLGIVRGIDTERGILYVITPVPENLVEKVDLLLQGYIQLPTCLLE 351

Query:   363 V 363
             V
Sbjct:   352 V 352




GO:0005525 "GTP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006777 "Mo-molybdopterin cofactor biosynthetic process" evidence=IEA
UNIPROTKB|E1BPN0 NOL9 "Polynucleotide 5'-hydroxyl-kinase NOL9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SY16 NOL9 "Polynucleotide 5'-hydroxyl-kinase NOL9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0I7 NOL9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LBV6 NOL9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1921285 Nol9 "nucleolar protein 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V7B0 Nol9 "Protein Nol9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277945 nol9 "NUC156 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPCC830.03 grc3 "polynucleotide kinase Grc3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1566167 Nol9 "nucleolar protein 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYP6NOL9_ARATH2, ., 7, ., 1, ., -0.62880.93080.9510yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
COG1341398 COG1341, COG1341, Predicted GTPase or GTP-binding 1e-33
pfam06807188 pfam06807, Clp1, Pre-mRNA cleavage complex II prot 2e-33
pfam03205126 pfam03205, MobB, Molybdopterin guanine dinucleotid 1e-12
COG5623424 COG5623, CLP1, Predicted GTPase subunit of the pre 9e-07
PRK05541176 PRK05541, PRK05541, adenylylsulfate kinase; Provis 0.004
>gnl|CDD|224260 COG1341, COG1341, Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
 Score =  128 bits (324), Expect = 1e-33
 Identities = 78/359 (21%), Positives = 135/359 (37%), Gaps = 76/359 (21%)

Query: 17  IPREWSDAADSIA-----YDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYL 71
           +P + S+  + IA        +     +  + G  + GK+T + +L N LL R +KVA +
Sbjct: 48  VPEDRSEPLEEIADTWESKSESAGKVGVVMVVGPVDSGKSTLTTYLANKLLARGRKVAII 107

Query: 72  DTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTL 131
           D DVGQ E   PGF+SL   ++    L       P   YF G +S +  P  Y+  +  L
Sbjct: 108 DADVGQSEIGPPGFISLAFPESPVISL---SELEPFTLYFVGSISPQGFPGRYIAGVARL 164

Query: 132 YDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGI-GYDILVDMLKYITPTHVVKINISF 190
            D  +KE                 +++T GW+KG  G ++   ++  I P  +    I+ 
Sbjct: 165 VDLAKKE---------ADFI----LIDTDGWIKGWGGLELKRALIDAIKPDLI----IAL 207

Query: 191 EKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFP 250
           E+ N    +  L+  E +    +++  A     +R           ++LR   Y R    
Sbjct: 208 ERANEL--SPLLEGVESIVY--LKVPDA-VAPRSREE--------RKELREEKYRRYFEG 254

Query: 251 SDLNITIIKEL---------AQALAAYPPY--QVPISSIKIRHLYC------------QV 287
           S +    + ++          + +        +  I    +    C            + 
Sbjct: 255 SKIRTVDLDDVRIQGTPIFQGEPIDDEEEKLLEKLIKKGILHAEKCGGRPYVVKSDLEEG 314

Query: 288 PR---SEIFY-----SLNATIVGLAISSDASENLPHCVGLGIVRGIDTLKGLLYVITPV 338
           PR              L   +VGL       +N   C+GLG++R ID  +  L + T V
Sbjct: 315 PRLVSGNDVRVVPSEELKGLLVGL------IDNDGFCIGLGVLRRIDFKENELTIYTRV 367


Length = 398

>gnl|CDD|219184 pfam06807, Clp1, Pre-mRNA cleavage complex II protein Clp1 Back     alignment and domain information
>gnl|CDD|217424 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B Back     alignment and domain information
>gnl|CDD|227910 COG5623, CLP1, Predicted GTPase subunit of the pre-mRNA cleavage complex [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235498 PRK05541, PRK05541, adenylylsulfate kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 376
KOG2749415 consensus mRNA cleavage and polyadenylation factor 100.0
COG1341398 Predicted GTPase or GTP-binding protein [General f 100.0
KOG2750587 consensus Uncharacterized conserved protein simila 100.0
COG5623424 CLP1 Predicted GTPase subunit of the pre-mRNA clea 100.0
PF06807195 Clp1: Pre-mRNA cleavage complex II protein Clp1; I 99.97
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 99.56
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.08
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.78
KOG1534273 consensus Putative transcription factor FET5 [Tran 98.64
KOG1533290 consensus Predicted GTPase [General function predi 98.52
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 98.39
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 98.34
PRK13768253 GTPase; Provisional 98.34
cd03115173 SRP The signal recognition particle (SRP) mediates 98.31
TIGR00064272 ftsY signal recognition particle-docking protein F 98.28
PRK00771437 signal recognition particle protein Srp54; Provisi 98.25
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.23
PRK10867433 signal recognition particle protein; Provisional 98.22
cd02034116 CooC The accessory protein CooC, which contains a 98.22
TIGR00959428 ffh signal recognition particle protein. This mode 98.12
PRK14974336 cell division protein FtsY; Provisional 98.07
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 98.05
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 98.02
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.0
TIGR03029274 EpsG chain length determinant protein tyrosine kin 97.98
KOG0780483 consensus Signal recognition particle, subunit Srp 97.88
cd02036179 MinD Bacterial cell division requires the formatio 97.87
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 97.85
cd03114148 ArgK-like The function of this protein family is u 97.84
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 97.84
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.83
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.81
PRK00889175 adenylylsulfate kinase; Provisional 97.78
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.77
TIGR01968261 minD_bact septum site-determining protein MinD. Th 97.77
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 97.75
PRK10416318 signal recognition particle-docking protein FtsY; 97.75
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.74
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.74
PRK13849231 putative crown gall tumor protein VirC1; Provision 97.73
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 97.71
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 97.7
PRK09435332 membrane ATPase/protein kinase; Provisional 97.69
cd02040270 NifH NifH gene encodes component II (iron protein) 97.68
PRK07667193 uridine kinase; Provisional 97.67
CHL00175281 minD septum-site determining protein; Validated 97.67
PRK10818270 cell division inhibitor MinD; Provisional 97.66
PHA02518211 ParA-like protein; Provisional 97.66
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.65
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.65
smart00382148 AAA ATPases associated with a variety of cellular 97.65
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.62
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 97.61
cd03116159 MobB Molybdenum is an essential trace element in t 97.61
PRK05541176 adenylylsulfate kinase; Provisional 97.6
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.59
PRK08118167 topology modulation protein; Reviewed 97.59
PRK13230279 nitrogenase reductase-like protein; Reviewed 97.58
PRK13869405 plasmid-partitioning protein RepA; Provisional 97.58
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.57
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 97.57
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 97.57
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 97.57
cd02117212 NifH_like This family contains the NifH (iron prot 97.55
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.55
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 97.53
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.53
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 97.52
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 97.51
PRK13705388 plasmid-partitioning protein SopA; Provisional 97.5
PRK06762166 hypothetical protein; Provisional 97.47
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.46
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.46
PRK06696223 uridine kinase; Validated 97.45
cd02032267 Bchl_like This family of proteins contains bchL an 97.45
TIGR01287275 nifH nitrogenase iron protein. This model describe 97.44
PRK03846198 adenylylsulfate kinase; Provisional 97.42
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.41
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 97.4
COG1192259 Soj ATPases involved in chromosome partitioning [C 97.4
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.4
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.4
PRK05480209 uridine/cytidine kinase; Provisional 97.4
cd03111106 CpaE_like This protein family consists of proteins 97.39
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.38
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 97.38
PF13173128 AAA_14: AAA domain 97.38
PRK13886241 conjugal transfer protein TraL; Provisional 97.37
CHL00072290 chlL photochlorophyllide reductase subunit L 97.36
PRK11519719 tyrosine kinase; Provisional 97.35
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.34
PRK05439311 pantothenate kinase; Provisional 97.34
PRK13232273 nifH nitrogenase reductase; Reviewed 97.34
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 97.33
COG0489265 Mrp ATPases involved in chromosome partitioning [C 97.33
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.33
PRK07261171 topology modulation protein; Provisional 97.32
cd03110179 Fer4_NifH_child This protein family's function is 97.31
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.31
PF09140261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 97.3
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 97.3
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.3
PRK10037250 cell division protein; Provisional 97.3
PRK06217183 hypothetical protein; Validated 97.3
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 97.29
PRK13235274 nifH nitrogenase reductase; Reviewed 97.28
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.28
PRK03839180 putative kinase; Provisional 97.25
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.24
cd01394218 radB RadB. The archaeal protein radB shares simila 97.24
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.24
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 97.24
PRK13949169 shikimate kinase; Provisional 97.23
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.22
PRK15453290 phosphoribulokinase; Provisional 97.21
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 97.21
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.21
PF00004132 AAA: ATPase family associated with various cellula 97.21
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.2
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 97.19
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 97.19
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.18
PHA02519387 plasmid partition protein SopA; Reviewed 97.17
PRK00131175 aroK shikimate kinase; Reviewed 97.17
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.17
COG4240300 Predicted kinase [General function prediction only 97.17
PRK13233275 nifH nitrogenase reductase; Reviewed 97.17
PRK06547172 hypothetical protein; Provisional 97.14
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 97.14
PRK14530215 adenylate kinase; Provisional 97.13
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.13
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 97.08
PRK08084235 DNA replication initiation factor; Provisional 97.07
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.06
PRK00625173 shikimate kinase; Provisional 97.06
PRK08233182 hypothetical protein; Provisional 97.06
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.06
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.06
PRK13234295 nifH nitrogenase reductase; Reviewed 97.04
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.04
PRK13231264 nitrogenase reductase-like protein; Reviewed 97.04
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.03
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.03
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.02
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.01
PRK09183259 transposase/IS protein; Provisional 97.01
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.01
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.99
PRK05057172 aroK shikimate kinase I; Reviewed 96.99
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 96.98
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.96
PRK11670369 antiporter inner membrane protein; Provisional 96.95
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.95
PRK05642234 DNA replication initiation factor; Validated 96.94
PRK06067234 flagellar accessory protein FlaH; Validated 96.94
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 96.94
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 96.93
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.92
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 96.92
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 96.92
PRK06893229 DNA replication initiation factor; Validated 96.91
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 96.9
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 96.9
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 96.89
PLN02748 468 tRNA dimethylallyltransferase 96.88
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.88
PRK13947171 shikimate kinase; Provisional 96.87
PRK13236296 nitrogenase reductase; Reviewed 96.87
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.86
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 96.86
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.86
PLN02840421 tRNA dimethylallyltransferase 96.84
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.83
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 96.83
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.82
TIGR00235207 udk uridine kinase. Model contains a number of lon 96.81
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.81
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.81
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.8
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 96.8
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.8
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.79
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 96.79
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.78
PRK06526254 transposase; Provisional 96.77
PF13479213 AAA_24: AAA domain 96.77
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.77
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.77
PHA00729226 NTP-binding motif containing protein 96.77
PRK13948182 shikimate kinase; Provisional 96.76
PTZ00301210 uridine kinase; Provisional 96.75
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 96.75
PRK05973237 replicative DNA helicase; Provisional 96.74
PRK14531183 adenylate kinase; Provisional 96.74
PRK14532188 adenylate kinase; Provisional 96.72
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 96.72
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.72
PTZ00088229 adenylate kinase 1; Provisional 96.71
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.71
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.7
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 96.7
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.7
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.7
PF1324576 AAA_19: Part of AAA domain 96.7
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.69
PRK00698205 tmk thymidylate kinase; Validated 96.69
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.69
PF05729166 NACHT: NACHT domain 96.69
PRK14527191 adenylate kinase; Provisional 96.68
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 96.66
PRK03731171 aroL shikimate kinase II; Reviewed 96.65
PF12846304 AAA_10: AAA-like domain 96.65
PRK14730195 coaE dephospho-CoA kinase; Provisional 96.64
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.61
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.6
PRK08727233 hypothetical protein; Validated 96.59
PRK14495 452 putative molybdopterin-guanine dinucleotide biosyn 96.58
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.58
PRK09825176 idnK D-gluconate kinase; Provisional 96.58
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.57
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.57
PRK06851367 hypothetical protein; Provisional 96.56
PRK04296190 thymidine kinase; Provisional 96.56
PRK13946184 shikimate kinase; Provisional 96.55
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.55
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.54
PLN02674244 adenylate kinase 96.54
PRK00279215 adk adenylate kinase; Reviewed 96.54
PRK08181269 transposase; Validated 96.53
PHA02530300 pseT polynucleotide kinase; Provisional 96.53
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 96.53
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.53
PLN02796347 D-glycerate 3-kinase 96.53
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.52
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.52
PRK06761282 hypothetical protein; Provisional 96.52
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.5
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 96.48
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 96.48
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.48
COG0703172 AroK Shikimate kinase [Amino acid transport and me 96.44
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 96.42
PRK07952244 DNA replication protein DnaC; Validated 96.41
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 96.41
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.41
COG1100219 GTPase SAR1 and related small G proteins [General 96.41
PRK12377248 putative replication protein; Provisional 96.39
PRK00081194 coaE dephospho-CoA kinase; Reviewed 96.39
PRK04328249 hypothetical protein; Provisional 96.39
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.38
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 96.38
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.36
PLN03046460 D-glycerate 3-kinase; Provisional 96.36
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 96.36
PRK13851344 type IV secretion system protein VirB11; Provision 96.33
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 96.33
PLN03025319 replication factor C subunit; Provisional 96.32
PRK04182180 cytidylate kinase; Provisional 96.31
PRK09354349 recA recombinase A; Provisional 96.31
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 96.3
PRK00440319 rfc replication factor C small subunit; Reviewed 96.3
PRK06921266 hypothetical protein; Provisional 96.29
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 96.29
PRK06835329 DNA replication protein DnaC; Validated 96.28
cd03112158 CobW_like The function of this protein family is u 96.28
TIGR00101199 ureG urease accessory protein UreG. This model rep 96.28
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 96.27
COG0218200 Predicted GTPase [General function prediction only 96.27
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.26
COG1855604 ATPase (PilT family) [General function prediction 96.24
COG4559259 ABC-type hemin transport system, ATPase component 96.24
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.24
PRK00300205 gmk guanylate kinase; Provisional 96.23
PRK13833323 conjugal transfer protein TrbB; Provisional 96.21
PRK07933213 thymidylate kinase; Validated 96.2
PRK06851367 hypothetical protein; Provisional 96.2
PRK14528186 adenylate kinase; Provisional 96.2
PRK08116268 hypothetical protein; Validated 96.19
PRK02496184 adk adenylate kinase; Provisional 96.18
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.17
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.17
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.17
PLN02348395 phosphoribulokinase 96.15
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 96.14
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.14
PLN02199303 shikimate kinase 96.14
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 96.12
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.12
PLN02200234 adenylate kinase family protein 96.11
PRK13764602 ATPase; Provisional 96.11
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.1
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.1
PRK12402337 replication factor C small subunit 2; Reviewed 96.09
COG4619223 ABC-type uncharacterized transport system, ATPase 96.09
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.09
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.07
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.06
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.05
PRK14733204 coaE dephospho-CoA kinase; Provisional 96.04
PRK11823446 DNA repair protein RadA; Provisional 96.04
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.03
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.02
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.01
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 96.0
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 96.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 95.99
PRK12608380 transcription termination factor Rho; Provisional 95.99
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 95.99
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 95.99
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.96
PLN02924220 thymidylate kinase 95.95
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 95.94
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.94
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 95.94
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 95.93
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.93
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 95.92
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.91
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.91
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 95.91
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.9
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.9
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.9
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.89
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.89
TIGR00152188 dephospho-CoA kinase. This model produces scores i 95.88
cd00154159 Rab Rab family. Rab GTPases form the largest famil 95.88
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 95.87
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.86
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 95.86
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.86
PRK09302 509 circadian clock protein KaiC; Reviewed 95.86
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 95.85
cd03234226 ABCG_White The White subfamily represents ABC tran 95.85
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.85
PRK13695174 putative NTPase; Provisional 95.84
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.84
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 95.83
PRK13973213 thymidylate kinase; Provisional 95.83
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 95.83
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 95.83
cd03246173 ABCC_Protease_Secretion This family represents the 95.83
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 95.82
PRK14491 597 putative bifunctional molybdopterin-guanine dinucl 95.82
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 95.81
PRK01184184 hypothetical protein; Provisional 95.8
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 95.8
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.8
PRK08356195 hypothetical protein; Provisional 95.79
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 95.79
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.79
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.79
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 95.79
PRK12422445 chromosomal replication initiation protein; Provis 95.78
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 95.78
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 95.78
cd03215182 ABC_Carb_Monos_II This family represents domain II 95.78
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 95.78
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 95.77
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 95.75
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.75
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.75
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 95.75
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 95.75
PRK08939306 primosomal protein DnaI; Reviewed 95.74
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 95.73
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 95.73
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.73
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.73
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 95.73
PRK12339197 2-phosphoglycerate kinase; Provisional 95.72
PRK04040188 adenylate kinase; Provisional 95.71
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 95.71
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 95.71
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 95.71
KOG0781587 consensus Signal recognition particle receptor, al 95.7
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 95.7
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 95.7
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 95.7
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 95.7
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 95.69
PRK11608326 pspF phage shock protein operon transcriptional ac 95.69
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.69
CHL00181287 cbbX CbbX; Provisional 95.69
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 95.69
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.68
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.68
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 95.68
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 95.68
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.68
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.68
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 95.68
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 95.67
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 95.67
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 95.67
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 95.67
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 95.66
COG1149284 MinD superfamily P-loop ATPase containing an inser 95.66
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 95.66
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.66
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.65
PRK14731208 coaE dephospho-CoA kinase; Provisional 95.65
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.64
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.64
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 95.63
PRK04220301 2-phosphoglycerate kinase; Provisional 95.63
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.63
cd00876160 Ras Ras family. The Ras family of the Ras superfam 95.63
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 95.62
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.61
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 95.61
PLN02165334 adenylate isopentenyltransferase 95.61
PRK08154309 anaerobic benzoate catabolism transcriptional regu 95.61
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 95.61
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 95.6
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 95.6
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 95.59
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 95.59
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 95.59
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 95.58
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 95.58
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 95.58
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.57
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 95.57
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 95.56
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.55
PRK11545163 gntK gluconate kinase 1; Provisional 95.55
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 95.55
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 95.54
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 95.54
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.54
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 95.53
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 95.53
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 95.53
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 95.52
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 95.51
PRK12338319 hypothetical protein; Provisional 95.51
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 95.51
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 95.51
PRK14734200 coaE dephospho-CoA kinase; Provisional 95.51
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.51
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 95.5
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 95.49
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 95.48
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 95.48
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.47
PRK14737186 gmk guanylate kinase; Provisional 95.47
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 95.47
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 95.46
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 95.46
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 95.46
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.45
PRK13975196 thymidylate kinase; Provisional 95.44
cd01878204 HflX HflX subfamily. A distinct conserved domain w 95.44
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 95.44
PRK10908222 cell division protein FtsE; Provisional 95.44
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 95.44
PRK14732196 coaE dephospho-CoA kinase; Provisional 95.43
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 95.43
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 95.43
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 95.42
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 95.41
PRK14526211 adenylate kinase; Provisional 95.41
PRK10646153 ADP-binding protein; Provisional 95.4
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.4
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.39
PTZ00451244 dephospho-CoA kinase; Provisional 95.39
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 95.38
PRK07429327 phosphoribulokinase; Provisional 95.38
PLN02318 656 phosphoribulokinase/uridine kinase 95.37
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 95.37
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 95.37
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.36
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 95.36
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 95.35
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 95.34
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.33
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.33
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 95.33
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 95.33
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 95.33
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.33
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 95.33
PRK14242253 phosphate transporter ATP-binding protein; Provisi 95.32
cd01128249 rho_factor Transcription termination factor rho is 95.32
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 95.32
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 95.32
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 95.32
PRK09112351 DNA polymerase III subunit delta'; Validated 95.31
COG0003322 ArsA Predicted ATPase involved in chromosome parti 95.31
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 95.3
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 95.3
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 95.3
COG4987573 CydC ABC-type transport system involved in cytochr 95.3
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 95.29
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 95.29
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 95.29
PRK00149450 dnaA chromosomal replication initiation protein; R 95.29
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 95.28
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 95.28
>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=1.3e-49  Score=378.45  Aligned_cols=305  Identities=21%  Similarity=0.343  Sum_probs=242.6

Q ss_pred             HHHHHHHhhcc--CCCCCCCEEEEEcCCCCcHHHHHHHHHHHHHHcCCcEEEEcCCCCCCCCCCCceEEEEecccCCCCC
Q 017141           21 WSDAADSIAYD--SNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSLTVVDTLTPDL   98 (376)
Q Consensus        21 W~~~~~~i~~~--~~~~~~~~vlV~G~~~sGKSTl~r~L~N~ll~~~~~v~~lDlD~GQ~~~~~PG~vSl~~i~~~~~~~   98 (376)
                      -+.+++.+...  ...+.|||+||+||.++||||+||+|+||+++.|++|.|+|+||||+.++.||+||+..++.+.+..
T Consensus        85 lH~ale~~R~~~e~~~~~GPrv~vVGp~d~GKsTl~r~L~nyavk~gr~Plfv~LDvgQ~sitiPGsiaA~~i~~~~D~~  164 (415)
T KOG2749|consen   85 LHAALEKRRMQAEEESSYGPRVMVVGPTDVGKSTLCRILLNYAVKQGRRPLFVELDVGQGSITIPGSIAAIPIEMPLDVI  164 (415)
T ss_pred             HHHHHHHHhhhhhhhhccCCEEEEECCCccchHHHHHHHHHHHHHcCCcceEEEcCCCCCceecccchhheecccccchh
Confidence            34555544321  1223599999999999999999999999999999999999999999999999999999999975422


Q ss_pred             CCCCCCCCceeEEcCCCCCCCChHHHHHHHHHHHHHHHHHhhhcccCCCCCCCCCcEEEeCCCccccccHHHHHHHHHHh
Q 017141           99 TIPCLKTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVKGIGYDILVDMLKYI  178 (376)
Q Consensus        99 ~~~~~~~p~~~~f~G~~sp~~~~~~y~~~v~~L~~~~~~~~~~~~~~~~~~~~~~~lIInT~Gwv~g~G~~ll~~~i~~~  178 (376)
                      ....+.+| +.|+||+++|..|+++|..++.+|++.+.+++.     .+++.+.+++|||||||++|.|++.|.++|++|
T Consensus       165 eGf~l~~p-LV~~FG~~sp~~N~~LY~~~~s~La~v~~~~~~-----~n~~ar~sG~iInT~g~i~~egy~~llhai~~f  238 (415)
T KOG2749|consen  165 EGFSLTAP-LVYNFGLTSPSTNLELYKALVSELAEVLKQRLS-----LNPEARVSGCIINTCGWIEGEGYAALLHAIKAF  238 (415)
T ss_pred             hCcccCCc-eeeeccCCCCCcCHHHHHHHHHHHHHHHHHHhc-----cCchhcccceEEeccceeccccHHHHHHHHHHc
Confidence            21224566 689999999999999999999999999999874     355678999999999999999999999999999


Q ss_pred             CCCEEEEEecCcccccCCCCcccccCCCCcceEEEEecCCCCCCCcccccchHHHHHHHHHHHHHHhhhcCCCCCchhhh
Q 017141          179 TPTHVVKINISFEKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNITII  258 (376)
Q Consensus       179 ~p~~Vv~l~~~~~~~~l~~~~~~~~~~~~~~v~vv~l~~~~~~~~~rs~~~~~~~~~~R~~~~~~YF~~~~~~~~~~~~~  258 (376)
                      +.|.||+++++.....+.+.     -..+..++++.+|+++++ .+|+   ..-++..|..++++||||....++.+   
T Consensus       239 ~v~vviVLg~ErLy~~lkk~-----~~~~~~v~vv~lpKsgGv-~~Rs---~~~r~~~r~~~I~eYFYG~~~~~lsP---  306 (415)
T KOG2749|consen  239 EVDVVIVLGQERLYSSLKKD-----LPPKKNVRVVKLPKSGGV-VARS---KEVRRKLRGRSIREYFYGSVRNELSP---  306 (415)
T ss_pred             CccEEEEeccHHHHHHHHhh-----ccccccceEEEecCCCCe-Eeeh---HHHHHHHhhhhHHHhcccccCCcccc---
Confidence            99999999987544433321     112356789999999984 5666   34578899999999999966554432   


Q ss_pred             HHhhhhhcCCCCeeeecCceEEEEeecCC-Cch------------------hHHHHhhccEEEEEEcCCCCCCC--CceE
Q 017141          259 KELAQALAAYPPYQVPISSIKIRHLYCQV-PRS------------------EIFYSLNATIVGLAISSDASENL--PHCV  317 (376)
Q Consensus       259 ~~~~~~L~~~~P~~v~~~~l~i~~~~~~v-~~~------------------~i~~~lngslVaL~~~~~~~~~~--~~~l  317 (376)
                                ..+.|.|+++++++++.+. |.+                  .+-..|...+.|+..+.+..+++  ++++
T Consensus       307 ----------~t~~Vkf~Dl~v~riga~~~p~S~lp~g~~~e~~~~k~~~vt~~~~l~h~vLAiS~A~~~ed~Vi~S~V~  376 (415)
T KOG2749|consen  307 ----------FTFNVKFSDLTVYRIGAPQAPDSCLPLGMTRENNQLKLVPVTITERLQHHVLAISFAEEPEDNVIKSPVA  376 (415)
T ss_pred             ----------eeEeeecceEEEEEecCCCCCccccccccccccCceEEEecccCHHHheeeEEEEecccchhhhhcCcce
Confidence                      1267999999999987332 111                  13345667788887665444433  4889


Q ss_pred             EEEEEeeeecCCCEEEEEcCCCCCCCCcccEEEecccc
Q 017141          318 GLGIVRGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQ  355 (376)
Q Consensus       318 GlgiVr~ID~~~~~i~iltP~~~~~l~~v~~Lv~G~i~  355 (376)
                      ||.+|..||.++++|++|+|+|+.+|++  .|+.|.+.
T Consensus       377 Gfv~VteVd~~~~kit~lsP~p~~LPsk--~Li~g~l~  412 (415)
T KOG2749|consen  377 GFVLVTEVDLEKRKITVLSPVPRTLPSK--ALILGDLK  412 (415)
T ss_pred             eEEEEEeccchheeEEEecCCCCCCCcc--eEEeeeee
Confidence            9999999999999999999999999998  88888765



>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>KOG2750 consensus Uncharacterized conserved protein similar to ATP/GTP-binding protein [General function prediction only] Back     alignment and domain information
>COG5623 CLP1 Predicted GTPase subunit of the pre-mRNA cleavage complex [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06807 Clp1: Pre-mRNA cleavage complex II protein Clp1; InterPro: IPR010655 This entry consists of several pre-mRNA cleavage complex II Clp1 (or HeaB) proteins Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 5e-47
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 8e-04
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Length = 460 Back     alignment and structure
 Score =  165 bits (418), Expect = 5e-47
 Identities = 55/334 (16%), Positives = 107/334 (32%), Gaps = 31/334 (9%)

Query: 32  SNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQ-RYKKVAYLDTDVGQPEFTAPGFLSLTV 90
            +    P   I G    GKT+ SR L +  L+    +  Y++ D  QP FT PG +S T 
Sbjct: 133 MSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATP 192

Query: 91  VDTLTPDLTIPCLKTPK-----------RCYFFGDVSSKRDPTAYLKYITTLYDYYRKEY 139
           +  +         ++                 FG      +   YL+ I+ L     +  
Sbjct: 193 ISDILDAQLPTWGQSLTSGATLLHNKQPMVKNFGLERINENKDLYLECISQLGQVVGQRL 252

Query: 140 YMFNESESPGRTELPLIVNTPGWVK-GIGYDILVDMLKYITPTHVVKINISFEKKNLPAG 198
           +       P       IV+TP   +       L  +++ +    ++   +  E   L   
Sbjct: 253 H-----LDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNIMLV--LCSETDPLWEK 305

Query: 199 AFWLDNFEGVDVNLIEI-SSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLN-IT 256
                  E  + N+  I       + +         R L+   I  YF     + L+   
Sbjct: 306 VKKTFGPELGNNNIFFIPKLDGVSAVDDVYK-----RSLQRTSIREYFYGSLDTALSPYA 360

Query: 257 IIKELAQALAAYPPYQVPISSIKIRHLYCQVPRSEIFYSLNATIVGLAISSDASENLPH- 315
           I  +        P         ++      +  S + +++ A  +  A        +   
Sbjct: 361 IGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIA--ITFAERRADQATVIKS 418

Query: 316 -CVGLGIVRGIDTLKGLLYVITPVPPGILEKVDL 348
             +G  ++  ++  +  L V+ PVP  +  K  +
Sbjct: 419 PILGFALITEVNEKRRKLRVLLPVPGRLPSKAMI 452


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Length = 171 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.83
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 98.23
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.22
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 98.16
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.1
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 98.06
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.06
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 97.85
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 97.78
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 97.71
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 97.7
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.7
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 97.68
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.67
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 97.66
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.63
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 97.62
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 97.61
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.6
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.6
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.59
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.58
3end_A307 Light-independent protochlorophyllide reductase ir 97.57
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.57
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.54
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 97.54
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.54
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.51
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 97.51
2xxa_A433 Signal recognition particle protein; protein trans 97.49
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.48
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.47
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.45
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.45
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.45
3cwq_A209 Para family chromosome partitioning protein; alpha 97.43
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 97.43
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.42
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.42
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 97.41
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.4
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 97.4
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.4
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.4
3bos_A242 Putative DNA replication factor; P-loop containing 97.36
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 97.35
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.35
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.35
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.34
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.33
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.32
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.32
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.31
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.31
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.28
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.27
2og2_A359 Putative signal recognition particle receptor; nuc 97.27
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.26
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.25
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.23
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.23
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.23
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.23
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.22
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.22
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.21
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.2
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 97.2
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.19
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 97.16
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.15
3fwy_A314 Light-independent protochlorophyllide reductase I 97.14
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.14
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.13
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.13
1via_A175 Shikimate kinase; structural genomics, transferase 97.13
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.13
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.12
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.11
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.11
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 97.1
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 97.1
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.09
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.08
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.07
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 97.07
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.06
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.05
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.05
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.05
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.05
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 97.04
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.04
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.04
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.03
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.02
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.02
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.01
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.01
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.0
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.0
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.98
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.97
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.97
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.97
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.95
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.94
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.92
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.92
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.92
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.9
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.9
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.9
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.9
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.89
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.89
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.89
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.87
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.86
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.86
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.85
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.85
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.84
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.83
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.83
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.81
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.81
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 96.8
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.78
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.77
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.77
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.76
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.76
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.75
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.73
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.73
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.7
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.7
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.68
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 96.68
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.68
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.68
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.67
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.66
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.66
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.66
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.65
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.64
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.64
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.63
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 96.63
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.62
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.62
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 96.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.6
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.6
2qgz_A308 Helicase loader, putative primosome component; str 96.59
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.59
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.58
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.57
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.56
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.52
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.52
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.52
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 96.52
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.51
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.51
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 96.51
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.51
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.5
1p9r_A418 General secretion pathway protein E; bacterial typ 96.49
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.48
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.47
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 96.47
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 96.47
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.47
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 96.46
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 96.46
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.45
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.44
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.42
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.4
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.4
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.4
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.4
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.37
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.37
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.36
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.35
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.34
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.34
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.33
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.33
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.32
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.31
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.3
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.29
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.28
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.24
2z43_A324 DNA repair and recombination protein RADA; archaea 96.23
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.23
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.22
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.22
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.22
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.21
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.2
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.2
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.17
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.15
3io5_A333 Recombination and repair protein; storage dimer, i 96.14
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.13
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.12
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.11
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.11
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.11
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.08
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.07
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.05
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.01
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 96.0
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 95.98
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.97
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 95.95
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.95
3co5_A143 Putative two-component system transcriptional RES 95.94
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.93
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.93
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.93
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.91
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 95.88
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.88
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.86
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.85
3t1o_A198 Gliding protein MGLA; G domain containing protein, 95.84
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.82
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.81
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.8
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.8
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.79
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 95.78
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.78
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 95.77
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.77
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.76
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.75
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.75
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.73
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.73
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.72
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.7
2chq_A319 Replication factor C small subunit; DNA-binding pr 95.7
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.68
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.68
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.66
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 95.65
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.64
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.62
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.61
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.6
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.6
1sgw_A214 Putative ABC transporter; structural genomics, P p 95.59
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.58
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.57
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 95.56
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.56
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 95.55
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.55
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.55
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 95.54
1b0u_A262 Histidine permease; ABC transporter, transport pro 95.52
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 95.52
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.52
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.51
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 95.51
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.51
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.51
1g6h_A257 High-affinity branched-chain amino acid transport 95.51
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 95.5
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.5
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 95.5
1ji0_A240 ABC transporter; ATP binding protein, structural g 95.49
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.49
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.49
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.48
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.48
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.46
2ghi_A260 Transport protein; multidrug resistance protein, M 95.46
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.46
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.46
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.45
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.44
2ged_A193 SR-beta, signal recognition particle receptor beta 95.44
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.43
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 95.43
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.43
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 95.42
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.42
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.41
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.41
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.4
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 95.4
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.4
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.39
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 95.39
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 95.38
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 95.37
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.37
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.34
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.32
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.3
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.3
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.29
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.29
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 95.27
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.27
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.27
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.26
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 95.25
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.25
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.24
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 95.22
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 95.21
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 95.21
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.2
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.2
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.19
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 95.19
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.17
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.17
1nrj_B218 SR-beta, signal recognition particle receptor beta 95.16
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.16
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.16
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.15
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.14
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 95.14
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.14
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.14
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.13
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.13
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.12
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 95.11
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.11
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.11
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.1
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 95.1
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.09
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.08
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.08
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.04
2fna_A357 Conserved hypothetical protein; structural genomic 95.03
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.03
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.02
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.02
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.0
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 95.0
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.0
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 95.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 94.99
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.99
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 94.98
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.98
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.97
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 94.96
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.96
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.96
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 94.96
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 94.96
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.93
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.93
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.92
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.89
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 94.89
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.88
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.88
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 94.88
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 94.86
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 94.85
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.85
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.83
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.82
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.82
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.82
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.82
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.8
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.8
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 94.8
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.79
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 94.75
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.74
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.74
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 94.73
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 94.73
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.72
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 94.72
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.71
2oap_1511 GSPE-2, type II secretion system protein; hexameri 94.7
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.69
3llu_A196 RAS-related GTP-binding protein C; structural geno 94.67
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 94.66
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.66
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.66
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 94.66
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.65
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.65
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.64
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.61
3igf_A374 ALL4481 protein; two-domained protein consisting o 94.61
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.59
2fh5_B214 SR-beta, signal recognition particle receptor beta 94.58
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.58
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.58
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 94.58
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.58
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.57
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 94.57
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 94.57
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 94.55
2r44_A331 Uncharacterized protein; putative ATPase, structur 94.55
1tue_A212 Replication protein E1; helicase, replication, E1E 94.55
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 94.54
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 94.54
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.54
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 94.53
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.52
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 94.52
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.5
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 94.49
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 94.49
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.47
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 94.46
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 94.45
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.42
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.41
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.4
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 94.38
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 94.37
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.37
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 94.37
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 94.36
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.35
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 94.34
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 94.34
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.32
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.32
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 94.27
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 94.27
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 94.25
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 94.21
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.18
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.16
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 94.13
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 94.13
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.12
3ice_A422 Transcription termination factor RHO; transcriptio 94.1
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 94.09
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 94.07
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.07
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 94.07
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 94.05
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.04
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.04
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 94.01
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.99
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 93.98
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.97
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 93.94
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 93.93
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 93.89
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 93.86
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 93.86
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 93.85
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 93.85
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 93.85
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.84
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 93.84
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.81
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 93.75
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.75
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 93.7
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 93.7
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 93.69
3iby_A256 Ferrous iron transport protein B; G protein, G dom 93.68
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 93.66
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.62
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 93.61
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 93.56
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 93.54
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 93.45
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.4
3pvs_A447 Replication-associated recombination protein A; ma 93.39
3kta_A182 Chromosome segregation protein SMC; structural mai 93.34
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 93.33
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 93.32
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 93.29
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 93.29
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 93.26
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 93.22
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.21
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.19
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.83  E-value=3e-19  Score=181.14  Aligned_cols=288  Identities=19%  Similarity=0.229  Sum_probs=193.4

Q ss_pred             CCCEEEEEcCCCCcHHHHHHHHHHHHHHcCC-cEEEEcCCCCCCCCCCCceEEEEecccCCC----CCCCCC-------C
Q 017141           36 PPPIAFICGAKNCGKTTFSRHLVNVLLQRYK-KVAYLDTDVGQPEFTAPGFLSLTVVDTLTP----DLTIPC-------L  103 (376)
Q Consensus        36 ~~~~vlV~G~~~sGKSTl~r~L~N~ll~~~~-~v~~lDlD~GQ~~~~~PG~vSl~~i~~~~~----~~~~~~-------~  103 (376)
                      .|.+++|+|++|||||||+|+|++++...+. +++++|.|+++.....|+.+++..+.....    .+....       -
T Consensus       137 ~Ge~v~IvGpnGsGKSTLlr~L~Gl~~p~~G~~pI~vdg~~~~~i~~vpq~~~l~~~~~~~tv~eni~~~~~~~~~~~~~  216 (460)
T 2npi_A          137 EGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINLDPQQPIFTVPGCISATPISDILDAQLPTWGQSLTSGATLLH  216 (460)
T ss_dssp             SCCCEEEEESTTSSHHHHHHHHHHTTHHHHCCCCEEEECCTTSCSSSCSSCCEEEECCSCCCTTCTTCSCBCBSSCCSSC
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCcccccCCceeEEEcCCccCCeeeeccchhhcccccccchhhhhcccccccCcchHH
Confidence            4889999999999999999999999887777 778899999999999999998865433211    011000       0


Q ss_pred             CCCceeEEcCCCCCCCChHHHHHHHHHHHHHHHHHhhhcccCCCCCCCCCcEEEeCCCccc-cccHHHHHHHHHHhCCCE
Q 017141          104 KTPKRCYFFGDVSSKRDPTAYLKYITTLYDYYRKEYYMFNESESPGRTELPLIVNTPGWVK-GIGYDILVDMLKYITPTH  182 (376)
Q Consensus       104 ~~p~~~~f~G~~sp~~~~~~y~~~v~~L~~~~~~~~~~~~~~~~~~~~~~~lIInT~Gwv~-g~G~~ll~~~i~~~~p~~  182 (376)
                      ..-...+++|..+..+...++-...++++-...+|+..     ++..+.+++|+|.|.|.. +...+++.++++.++.+.
T Consensus       217 ~~~~ll~~~gl~~~~~~~~LSgGq~qrlalAra~rL~~-----~p~i~~sGLlLDEpPts~LD~~~~~l~~l~~~~~~tv  291 (460)
T 2npi_A          217 NKQPMVKNFGLERINENKDLYLECISQLGQVVGQRLHL-----DPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVNI  291 (460)
T ss_dssp             CBCCEECCCCSSSGGGCHHHHHHHHHHHHHHHHHHHHH-----CHHHHHSCEEEECCCGGGSCSSCHHHHHHHHHTTCCE
T ss_pred             HHHHHHHHhCCCcccchhhhhHHHHHHHHHHHHHHhcc-----CcccCcceEEEeCCcccccChhHHHHHHHHHHhCCCE
Confidence            01124678898877666678877777777655544432     233456789999976653 233788999999999998


Q ss_pred             EEEEecCc------ccccCCCCcccccCCCCcceEEEEecCCCCCCCcccccchHHHHHHHHHHHHHHhhhcCCCCCchh
Q 017141          183 VVKINISF------EKKNLPAGAFWLDNFEGVDVNLIEISSARQDSFNRSVLVQKDARLLRDLRIMAYFRQCFPSDLNIT  256 (376)
Q Consensus       183 Vv~l~~~~------~~~~l~~~~~~~~~~~~~~v~vv~l~~~~~~~~~rs~~~~~~~~~~R~~~~~~YF~~~~~~~~~~~  256 (376)
                      |++..+..      +...+.      +.  ...++++.+++.++.. ..+   +.+.+..|..++++||++.....+   
T Consensus       292 iiVth~~~~~l~~~~~~~~~------dr--~~~~~vi~l~k~G~iv-~g~---~~~~~~~~~~~i~~~f~g~~~~~l---  356 (460)
T 2npi_A          292 MLVLCSETDPLWEKVKKTFG------PE--LGNNNIFFIPKLDGVS-AVD---DVYKRSLQRTSIREYFYGSLDTAL---  356 (460)
T ss_dssp             EEEECCSSCTHHHHHHHHHH------HH--HCGGGEEEECCCTTCC-CCC---HHHHHHHHHHHHHHHHHCCTTTCB---
T ss_pred             EEEEccCchhhhHHHHHHhc------cc--ccCCEEEEEeCCCcEE-ECC---HHHHhhhhHHHHHHHhCCCCCCCc---
Confidence            88877643      111110      00  0011356677555433 322   233444567889999988542221   


Q ss_pred             hhHHhhhhhcCCCCeeeecCceEEEEeecC----------CCchhHHHHhhccEEEEEEcCCCC--C--CCCceEEEEEE
Q 017141          257 IIKELAQALAAYPPYQVPISSIKIRHLYCQ----------VPRSEIFYSLNATIVGLAISSDAS--E--NLPHCVGLGIV  322 (376)
Q Consensus       257 ~~~~~~~~L~~~~P~~v~~~~l~i~~~~~~----------v~~~~i~~~lngslVaL~~~~~~~--~--~~~~~lGlgiV  322 (376)
                                .....+++|+++.++.+...          .|.......|.++|+|++..+...  +  ....++||..|
T Consensus       357 ----------~p~~~~v~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~l~~~ilav~~~~~~~~~~~v~~~~v~Gf~~v  426 (460)
T 2npi_A          357 ----------SPYAIGVDYEDLTIWKPSNVFDNEVGRVELFPVTITPSNLQHAIIAITFAERRADQATVIKSPILGFALI  426 (460)
T ss_dssp             ----------CCEEEEEESTTCCEEEECCSTTTSSCCSCEEECCCCHHHHTTEEEEEESSCTTCCHHHHTTSCEEEEEEE
T ss_pred             ----------CCccEEEecCCeEEEEecCCCCCCCCceeeecCCCCChhhhCcEEEEEecCcCCCccccccccCccEEEE
Confidence                      11235688888888776531          111233456788999998774321  1  13479999999


Q ss_pred             eeeecCCCEEEEEcCCCCCCCCcccEEEecccc
Q 017141          323 RGIDTLKGLLYVITPVPPGILEKVDLFLQGFIQ  355 (376)
Q Consensus       323 r~ID~~~~~i~iltP~~~~~l~~v~~Lv~G~i~  355 (376)
                      ..||.+++++++|+|.+++++++  .|+.|+++
T Consensus       427 ~~Vd~~~~~~~vl~p~~~~lp~~--~l~~~~~~  457 (460)
T 2npi_A          427 TEVNEKRRKLRVLLPVPGRLPSK--AMILTSYR  457 (460)
T ss_dssp             EEEETTTTEEEEEESSSSCCCCS--CEEEEEEE
T ss_pred             EEEEcCCCEEEEEcCCCCCCCCC--ceeeeeeE
Confidence            99999999999999999999987  47788765



>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 376
d2p67a1327 c.37.1.10 (A:1-327) LAO/AO transport system kinase 2e-04
d1hyqa_232 c.37.1.10 (A:) Cell division regulator MinD {Archa 7e-04
d1g3qa_237 c.37.1.10 (A:) Cell division regulator MinD {Archa 0.001
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.001
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 0.002
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Length = 327 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: LAO/AO transport system kinase ArgK
species: Escherichia coli [TaxId: 562]
 Score = 40.6 bits (94), Expect = 2e-04
 Identities = 22/154 (14%), Positives = 42/154 (27%), Gaps = 4/154 (2%)

Query: 9   ENPSPAIYIPREWSDAADSIAYDSNTSPPPIAFICGAKNCGKTTFSRHLVNVLLQRYKKV 68
           E+  P     +  S            +   +  + G    GK+TF      +L++   KV
Sbjct: 30  ESRHPRH---QALSTQLLDAIMPYCGNTLRLG-VTGTPGAGKSTFLEAFGMLLIREGLKV 85

Query: 69  AYLDTDVGQPEFTAPGFLSLTVVDTLTPDLTIPCLKTPKRCYFFGDVSSKRDPTAYLKYI 128
           A +  D   P          T ++ L           P   +  G     R+     +  
Sbjct: 86  AVIAVDPSSPVTGGSILGDKTRMNDLARAEAAFIRPVPSSGHLGGASQRARELMLLCEAA 145

Query: 129 TTLYDYYRKEYYMFNESESPGRTELPLIVNTPGW 162
                         +E+E     +  + +   G 
Sbjct: 146 GYDVVIVETVGVGQSETEVARMVDCFISLQIAGG 179


>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.33
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.17
d2qy9a2211 GTPase domain of the signal recognition particle r 98.02
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 97.81
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 97.79
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.79
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 97.78
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.76
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.75
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.72
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.68
d1okkd2207 GTPase domain of the signal recognition particle r 97.67
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.67
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 97.65
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.62
d1vmaa2213 GTPase domain of the signal recognition particle r 97.59
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.57
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 97.56
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.52
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 97.52
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.5
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.49
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.48
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.47
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.46
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.4
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.37
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.37
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.33
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 97.32
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.31
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.31
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.3
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.27
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.27
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.24
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.22
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 97.22
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.2
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.15
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.13
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.09
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.03
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.98
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.97
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.95
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.95
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.92
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.89
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.88
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.87
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.83
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.81
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.8
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.77
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.77
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.73
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.65
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.54
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.51
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.5
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.5
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.49
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.44
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.4
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.35
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.34
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.33
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.32
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.28
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.21
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 96.21
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.19
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.19
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.17
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.17
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.11
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.11
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.11
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.11
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.1
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.08
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.06
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.98
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.96
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.93
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.88
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.87
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.87
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.85
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.78
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.77
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.74
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.74
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.73
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.7
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.68
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.68
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.68
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.66
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.65
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.65
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.65
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.65
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.63
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.62
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.61
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.6
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.59
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.59
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.57
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.57
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.56
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 95.55
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.54
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.53
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 95.52
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.51
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.51
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.49
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.48
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.48
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.48
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.47
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.47
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.47
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.45
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.43
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.43
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.42
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.4
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.38
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.38
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.38
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.37
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.36
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.35
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.35
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.35
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.34
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.32
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.29
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.28
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.28
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.26
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.24
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.22
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.19
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.19
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.18
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.17
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.14
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.12
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.11
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.11
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.11
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.07
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.04
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.03
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.03
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.0
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.97
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.94
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.93
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.93
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.88
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.85
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.85
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.82
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.79
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.74
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.69
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.67
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.64
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.62
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.6
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.59
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.55
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.51
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 94.49
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.47
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.39
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.37
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.34
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.34
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.31
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.3
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 94.22
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.19
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 94.12
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.09
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 94.06
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.03
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.94
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 93.81
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 93.79
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 93.77
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.71
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.68
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.65
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 93.64
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.52
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.47
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.47
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.33
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.29
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.09
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.03
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.93
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.89
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 92.86
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 92.85
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 92.77
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.75
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.73
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.62
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.61
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 92.52
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.49
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.43
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 92.17
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 92.13
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.73
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 91.53
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 91.53
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 91.51
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 91.36
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 91.34
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.08
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.7
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.59
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.54
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.5
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.33
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 90.08
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.94
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.83
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 89.79
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 89.41
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.02
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 88.61
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 87.88
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.08
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 86.88
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 86.38
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 85.96
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 85.39
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 85.19
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 85.03
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 84.7
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 83.93
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 83.87
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 83.6
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 83.14
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.0
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 82.11
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 81.59
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 81.45
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Escherichia coli [TaxId: 562]
Probab=98.33  E-value=2.5e-07  Score=77.00  Aligned_cols=51  Identities=22%  Similarity=0.273  Sum_probs=38.0

Q ss_pred             CEEEEEcCCCCcHHHHHHHHHHHHHHcCCcEEEEcCCCCCCCCCCCceEEE
Q 017141           38 PIAFICGAKNCGKTTFSRHLVNVLLQRYKKVAYLDTDVGQPEFTAPGFLSL   88 (376)
Q Consensus        38 ~~vlV~G~~~sGKSTl~r~L~N~ll~~~~~v~~lDlD~GQ~~~~~PG~vSl   88 (376)
                      |++.|+|.+|||||||++.|++++-++|.+|++++-|.+..++..++.=+.
T Consensus         3 Pvi~itG~~GSGKTTL~~~L~~~l~~~g~~v~v~~~d~~~~~~~~~~~d~~   53 (170)
T d1np6a_           3 PLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSY   53 (170)
T ss_dssp             CEEEEECCTTSCHHHHHHHHHHHHHHTTCCEEEEEECCC------------
T ss_pred             CEEEEEcCCCCCHHHHHHHHHHHHHHCCCeEEEecccccccccccccCccH
Confidence            789999999999999999999999999999999999998877666654443



>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure