Citrus Sinensis ID: 017364


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
cEEEEcccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHccccccEEccccHHHHHHccHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccEEEEEcccccHHHHHHHHccccccccccEEEEEcccHHHHHHcccccEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHccccccccHHHHHcccc
ccEEEEEEccHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHcHHHHEcccc
mifpifydlepttvRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANIsgwelkdrnepEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLInkgptdvrmigicgmggigkTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLlnlpdsgvwnvydgMNMIRSRLRHKKVLLVIDDVIELQQLEslagkhdwfgigsriFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKafkshkpwkgyeQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLerdpeneiLDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILnycdfdpiigigglienly
mifpifydlepttvrKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVAnisgwelkdrnepeFIVDIVKEISckisaksetlkelvgldsRLEKLRFLinkgptdvrmIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLEslagkhdwfgiGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRmigicgmggigKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
*IFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIE***
MIFPIFYDLEPTTVRKQTASFKEAFLKHEEA*****EKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRNEPEFIVDIVKEISCKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query373 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.970 0.316 0.423 5e-75
O82500 1095 Putative disease resistan no no 0.930 0.316 0.360 1e-59
Q9FL92 1372 Probable WRKY transcripti no no 0.750 0.204 0.397 6e-51
O23530 1301 Protein SUPPRESSOR OF npr no no 0.932 0.267 0.335 6e-50
Q9FH83 1288 Probable WRKY transcripti no no 0.739 0.214 0.392 3e-47
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.887 0.205 0.342 1e-43
Q9SZ67 1895 Probable WRKY transcripti no no 0.946 0.186 0.291 4e-39
Q9SZA7 816 Probable disease resistan no no 0.584 0.267 0.310 6e-16
P0C8S1 906 Probable disease resistan no no 0.747 0.307 0.288 3e-15
Q9FW44 787 Disease resistance protei no no 0.589 0.279 0.303 5e-15
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  281 bits (719), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 161/380 (42%), Positives = 242/380 (63%), Gaps = 18/380 (4%)

Query: 2   IFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISG-WELKDR 60
           + PIFYD++P+ VR Q  SF +AF +HE  +++++E +Q+WR +L E AN+ G  + +D+
Sbjct: 101 VIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGSCDNRDK 160

Query: 61  NEPEFIVDIVKEIS---CKISAKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMG 117
            + + I  IV +IS   CKIS     L+ +VG+D+ LEK+  L+  G   VR++GI GMG
Sbjct: 161 TDADCIRQIVDQISSKLCKISLS--YLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMG 218

Query: 118 GIGKTTLARVVYDLI------SHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDS 171
           G+GKTT+AR ++D +      S++F+ +CFL +++E   K G+  LQ  L+S+LL    +
Sbjct: 219 GVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKE--NKRGMHSLQNALLSELLR-EKA 275

Query: 172 GVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQ-LESLAGKHDWFGIGSRIFITSRDKHL 230
              N  DG + + SRLR KKVL+V+DD+      LE LAG  DWFG GSRI IT+RDKHL
Sbjct: 276 NYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHL 335

Query: 231 LMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLG 290
           +  +  D +Y    L   E++ LF   AF    P + +E+LS  VV YA GLPLALKV G
Sbjct: 336 IEKN--DIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWG 393

Query: 291 SFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYV 350
           S L    + EW+SA++ ++ +  + I+D L+IS+DGL+  ++++FLDIACF +G+  DY+
Sbjct: 394 SLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYI 453

Query: 351 TKILNYCDFDPIIGIGGLIE 370
            +IL  C      G+  LI+
Sbjct: 454 LQILESCHIGAEYGLRILID 473




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZA7|DRL29_ARATH Probable disease resistance protein At4g33300 OS=Arabidopsis thaliana GN=At4g33300 PE=2 SV=3 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FW44|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query373
255547494 1082 TMV resistance protein N, putative [Rici 0.983 0.339 0.533 1e-101
224126759 515 tir-nbs-lrr resistance protein [Populus 0.991 0.718 0.501 2e-99
356560337 1289 PREDICTED: TMV resistance protein N-like 0.986 0.285 0.513 2e-99
224060459 524 tir-nbs-lrr resistance protein [Populus 0.991 0.706 0.495 3e-99
359493496 1180 PREDICTED: TMV resistance protein N-like 0.970 0.306 0.501 7e-99
255547496 1097 ATP binding protein, putative [Ricinus c 0.989 0.336 0.522 1e-98
359493487 1162 PREDICTED: TMV resistance protein N-like 0.975 0.313 0.504 2e-96
147858727 1177 hypothetical protein VITISV_025072 [Viti 0.970 0.307 0.490 1e-95
105922680 1282 TIR-NBS-LRR-TIR type disease resistance 0.970 0.282 0.517 1e-95
147768286 1206 hypothetical protein VITISV_033530 [Viti 0.978 0.302 0.516 2e-95
>gi|255547494|ref|XP_002514804.1| TMV resistance protein N, putative [Ricinus communis] gi|223545855|gb|EEF47358.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 263/373 (70%), Gaps = 6/373 (1%)

Query: 2   IFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRN 61
           + P+FY ++P  VRKQT  F E+F K+E+ F+ NI KVQ+WR +   +AN+SGW+ ++R+
Sbjct: 100 VLPVFYSVDPAEVRKQTGRFGESFAKYEKLFKNNIGKVQQWRAAATGMANLSGWDTQNRH 159

Query: 62  EPEFIVDIVKEISCKISAKSETL----KELVGLDSRL-EKLRFLINKGPTDVRMIGICGM 116
           E E I +IV+E+  K+   S       K  VG++SRL E +++L  +   DVR +GICGM
Sbjct: 160 ESELIEEIVEEVLKKLRKSSHRFSSASKNFVGMNSRLNEMMKYLGKRESDDVRFVGICGM 219

Query: 117 GGIGKTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNV 176
           GGIGKTT+AR VY  +S EFE SCFLANVRE+ +K+ L  LQ+QL+S+ L      VW++
Sbjct: 220 GGIGKTTIARAVYAELSSEFEGSCFLANVREVEEKNSLS-LQEQLLSETLMERKITVWDI 278

Query: 177 YDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGV 236
           + G N I++RL HKKVL+++DDV  L+QL+SLAG  DWFG GSRI IT+RD+HLL+ HGV
Sbjct: 279 HAGRNEIKNRLSHKKVLIILDDVNHLEQLKSLAGMSDWFGNGSRIIITTRDEHLLLCHGV 338

Query: 237 DEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGR 296
           + +Y    LN+DEAL LF LKAFK+  P   Y +LS   V YA GLPLAL VLGS L+GR
Sbjct: 339 ERIYRVGGLNHDEALRLFSLKAFKNDYPADDYVELSNHFVNYANGLPLALDVLGSCLYGR 398

Query: 297 TIAEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNY 356
           +I EW+SAL RL+  P   ILD L ISF+GL+E EKK+FLDIACF+KG+   YV K+L  
Sbjct: 399 SINEWQSALDRLKEIPNKRILDKLYISFEGLQEIEKKVFLDIACFFKGEDKHYVVKVLES 458

Query: 357 CDFDPIIGIGGLI 369
           C F   IGI  L+
Sbjct: 459 CGFYAEIGIRVLL 471




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224126759|ref|XP_002329466.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870146|gb|EEF07277.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356560337|ref|XP_003548449.1| PREDICTED: TMV resistance protein N-like [Glycine max] Back     alignment and taxonomy information
>gi|224060459|ref|XP_002300210.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222847468|gb|EEE85015.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493496|ref|XP_003634615.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547496|ref|XP_002514805.1| ATP binding protein, putative [Ricinus communis] gi|223545856|gb|EEF47359.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147858727|emb|CAN82909.1| hypothetical protein VITISV_025072 [Vitis vinifera] Back     alignment and taxonomy information
>gi|105922680|gb|ABF81430.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147768286|emb|CAN64759.1| hypothetical protein VITISV_033530 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query373
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.973 0.280 0.419 1.4e-71
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.970 0.316 0.405 3e-67
TAIR|locus:2167457 1191 AT5G36930 [Arabidopsis thalian 0.975 0.305 0.428 4e-66
TAIR|locus:2160487 1085 AT5G41550 [Arabidopsis thalian 0.981 0.337 0.355 1.8e-55
TAIR|locus:2146243 900 AT5G18360 [Arabidopsis thalian 0.959 0.397 0.370 4e-55
TAIR|locus:2151491 1123 AT5G46450 [Arabidopsis thalian 0.978 0.325 0.349 3.1e-54
TAIR|locus:2129670 1008 AT4G14370 [Arabidopsis thalian 0.949 0.351 0.355 4.4e-54
TAIR|locus:2164486 1104 AT5G40910 [Arabidopsis thalian 0.930 0.314 0.351 7.8e-54
TAIR|locus:2195468 1017 AT1G63880 [Arabidopsis thalian 0.970 0.355 0.365 1.6e-53
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.949 0.255 0.362 2.3e-53
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 733 (263.1 bits), Expect = 1.4e-71, P = 1.4e-71
 Identities = 156/372 (41%), Positives = 234/372 (62%)

Query:     2 IFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDRN 61
             I PIFY+++P+ VR+Q  SF E    H +      EKV KW+++LK++A ISG + ++ +
Sbjct:   104 IVPIFYEVDPSDVRRQRGSFGEDVESHSDK-----EKVGKWKEALKKLAAISGEDSRNWD 158

Query:    62 EPEFIVDIVKEISCKISAKS-ETLKELVGLDSRLEKLRFLINKGPTDVRXXXXXXXXXXX 120
             + + I  IVK+IS K+ + S +  K L+G+ S ++ L+ +I+    DVR           
Sbjct:   159 DSKLIKKIVKDISDKLVSTSWDDSKGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVG 218

Query:   121 KTTLARVVYDLISHEFEASCFLANVREISKKSGLVFLQKQLISQLLNLPDSGVWNVYDGM 180
             KTT+A+ +Y+ +S +F+  CF+ NV+E+  + G+  LQ + + ++    D   W+     
Sbjct:   219 KTTIAKYLYNQLSGQFQVHCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCC 278

Query:   181 NMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHGVDEVY 240
             N+I+ R RHK V +V+DDV   +QL  L  +  WFG GSRI +T+RD+HLL++HG++ VY
Sbjct:   279 NIIKERFRHKMVFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVY 338

Query:   241 MHEHLNYDEALGLFCLKAFKSH--KPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTI 298
               + L   EAL LFC  AF+     P  G+E+LS   V YA GLPLAL+VLGSFL+ R+ 
Sbjct:   339 KVKCLPKKEALQLFCNYAFREEIILP-HGFEELSVQAVNYASGLPLALRVLGSFLYRRSQ 397

Query:   299 AEWESALQRLERDPENEILDVLQISFDGLKETEKKIFLDIACFYKGKYIDYVTKILNYCD 358
              EWES L RL+  P ++I++VL++S+DGL E EK IFL I+CFY  K +DYV K+L+ C 
Sbjct:   398 IEWESTLARLKTYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCG 457

Query:   359 FDPIIGIGGLIE 370
             +   IGI  L E
Sbjct:   458 YAAEIGITILTE 469




GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129670 AT4G14370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164486 AT5G40910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195468 AT1G63880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-73
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-39
pfam01582135 pfam01582, TIR, TIR domain 3e-06
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 4e-05
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 6e-04
COG1072283 COG1072, CoaA, Panthothenate kinase [Coenzyme meta 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  247 bits (631), Expect = 2e-73
 Identities = 133/384 (34%), Positives = 221/384 (57%), Gaps = 20/384 (5%)

Query: 1   MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKD- 59
           ++ P+FY L+P+ VRKQT  F EAF K      +  ++  +W+ +L +VANI G+  ++ 
Sbjct: 100 LVIPVFYGLDPSHVRKQTGDFGEAFEK--TCQNKTEDEKIQWKQALTDVANILGYHSQNW 157

Query: 60  RNEPEFIVDIVKEISCKIS-AKSETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGG 118
            NE + I +I  ++  K++   S   ++ VG++  + K+  L++    +VRM+GI G  G
Sbjct: 158 PNEAKMIEEIANDVLGKLNLTPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSG 217

Query: 119 IGKTTLARVVYDLISHEFEASCFLANV-----REISKKSGLV------FLQKQLISQLLN 167
           IGKTT+AR ++  +S +F++S F+         EI   +          LQ+  +S++L+
Sbjct: 218 IGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILD 277

Query: 168 LPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRD 227
             D  ++++      +  RL+H+KVL+ IDD+ +   L++LAG+  WFG GSRI + ++D
Sbjct: 278 KKDIKIYHL----GAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKD 333

Query: 228 KHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALK 287
           KH L AHG+D +Y     + + AL +FC  AFK + P  G+ +L+  V   AG LPL L 
Sbjct: 334 KHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLN 393

Query: 288 VLGSFLFGRTIAEWESALQRLERDPENEILDVLQISFDGLK-ETEKKIFLDIACFYKGKY 346
           VLGS+L GR   +W   L RL    + +I   L++S+DGL  + +K IF  IAC + G+ 
Sbjct: 394 VLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEK 453

Query: 347 IDYVTKILNYCDFDPIIGIGGLIE 370
           ++ +  +L   D D  IG+  L++
Sbjct: 454 VNDIKLLLANSDLDVNIGLKNLVD 477


syringae 6; Provisional. Length = 1153

>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|223998 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 373
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PRK04841 903 transcriptional regulator MalT; Provisional 99.62
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.61
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.58
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.51
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.5
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.49
COG0488530 Uup ATPase components of ABC transporters with dup 99.49
COG3899 849 Predicted ATPase [General function prediction only 99.48
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.41
PF05729166 NACHT: NACHT domain 99.35
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.34
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.24
PRK13342 413 recombination factor protein RarA; Reviewed 99.22
PRK06893229 DNA replication initiation factor; Validated 99.17
COG3903 414 Predicted ATPase [General function prediction only 99.15
PTZ001121164 origin recognition complex 1 protein; Provisional 99.1
PRK12402337 replication factor C small subunit 2; Reviewed 99.09
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.07
PTZ00202550 tuzin; Provisional 99.06
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.04
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.02
PRK00440319 rfc replication factor C small subunit; Reviewed 99.02
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.01
PRK07471365 DNA polymerase III subunit delta'; Validated 99.01
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.99
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.99
PLN03194187 putative disease resistance protein; Provisional 98.99
PLN03025319 replication factor C subunit; Provisional 98.99
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.98
PRK04195 482 replication factor C large subunit; Provisional 98.97
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.95
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.94
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.94
PRK08727233 hypothetical protein; Validated 98.94
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.93
PRK09112351 DNA polymerase III subunit delta'; Validated 98.9
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.9
PF13173128 AAA_14: AAA domain 98.89
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.89
PF14516331 AAA_35: AAA-like domain 98.89
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.89
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.88
PRK07940394 DNA polymerase III subunit delta'; Validated 98.87
PRK05642234 DNA replication initiation factor; Validated 98.87
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.86
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.85
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.85
PRK08084235 DNA replication initiation factor; Provisional 98.85
PRK13341 725 recombination factor protein RarA/unknown domain f 98.85
PRK05564313 DNA polymerase III subunit delta'; Validated 98.85
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.85
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.84
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.84
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.81
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.81
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.81
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.81
PRK14087450 dnaA chromosomal replication initiation protein; P 98.8
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.79
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.78
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.78
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.74
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.74
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 98.74
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.73
KOG2028 554 consensus ATPase related to the helicase subunit o 98.73
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.73
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 98.72
KOG0927614 consensus Predicted transporter (ABC superfamily) 98.72
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.72
PRK09087226 hypothetical protein; Validated 98.71
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.71
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.7
PRK14088440 dnaA chromosomal replication initiation protein; P 98.69
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.68
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.66
PRK03992389 proteasome-activating nucleotidase; Provisional 98.66
CHL00095 821 clpC Clp protease ATP binding subunit 98.64
TIGR00362405 DnaA chromosomal replication initiator protein Dna 98.64
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.61
PRK10636638 putative ABC transporter ATP-binding protein; Prov 98.61
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.6
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.6
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.6
PRK00149450 dnaA chromosomal replication initiation protein; R 98.59
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.59
PRK11147635 ABC transporter ATPase component; Reviewed 98.55
PRK06620214 hypothetical protein; Validated 98.55
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.54
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.54
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.51
PRK10865 857 protein disaggregation chaperone; Provisional 98.51
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.51
PRK14086617 dnaA chromosomal replication initiation protein; P 98.5
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.5
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.5
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.48
PRK07399314 DNA polymerase III subunit delta'; Validated 98.48
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 98.46
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.46
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.45
PRK05707328 DNA polymerase III subunit delta'; Validated 98.45
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.45
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.44
PF00004132 AAA: ATPase family associated with various cellula 98.43
COG0488 530 Uup ATPase components of ABC transporters with dup 98.43
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.43
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 98.43
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.43
PHA02544316 44 clamp loader, small subunit; Provisional 98.42
PRK12422445 chromosomal replication initiation protein; Provis 98.42
CHL00176 638 ftsH cell division protein; Validated 98.41
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.4
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.38
COG0593408 DnaA ATPase involved in DNA replication initiation 98.37
PRK12377248 putative replication protein; Provisional 98.34
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 98.32
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.32
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.32
PRK07952244 DNA replication protein DnaC; Validated 98.31
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.29
CHL00181287 cbbX CbbX; Provisional 98.27
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.26
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 98.25
PLN03073718 ABC transporter F family; Provisional 98.23
cd01128249 rho_factor Transcription termination factor rho is 98.23
PRK08769319 DNA polymerase III subunit delta'; Validated 98.23
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.22
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 98.2
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.18
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.17
PRK08058329 DNA polymerase III subunit delta'; Validated 98.15
CHL00195489 ycf46 Ycf46; Provisional 98.15
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.15
COG4133209 CcmA ABC-type transport system involved in cytochr 98.13
PRK09376416 rho transcription termination factor Rho; Provisio 98.13
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.12
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.12
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 98.11
smart00382148 AAA ATPases associated with a variety of cellular 98.1
PRK08116268 hypothetical protein; Validated 98.1
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.09
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.09
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.09
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.08
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.08
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 98.07
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 98.06
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.06
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.05
PRK08181269 transposase; Validated 98.05
PRK06871325 DNA polymerase III subunit delta'; Validated 98.04
PRK07993334 DNA polymerase III subunit delta'; Validated 98.04
cd03246173 ABCC_Protease_Secretion This family represents the 98.02
PRK06090319 DNA polymerase III subunit delta'; Validated 98.02
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.02
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.01
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.01
TIGR00767415 rho transcription termination factor Rho. Members 98.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 98.0
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 98.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.99
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 97.98
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.98
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.97
PRK06921266 hypothetical protein; Provisional 97.97
PRK06964342 DNA polymerase III subunit delta'; Validated 97.97
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.97
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.96
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.96
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 97.95
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.93
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.93
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.93
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.93
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.92
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.92
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.92
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.92
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.92
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.92
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.92
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.91
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.91
PRK10536262 hypothetical protein; Provisional 97.91
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.91
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.9
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.9
PRK10865857 protein disaggregation chaperone; Provisional 97.9
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 97.87
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.87
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.87
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.87
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 97.87
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.86
KOG0062 582 consensus ATPase component of ABC transporters wit 97.86
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.85
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.85
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.85
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.85
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 97.85
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.84
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.84
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.84
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.84
PRK06526254 transposase; Provisional 97.84
PRK13409590 putative ATPase RIL; Provisional 97.83
PRK06835329 DNA replication protein DnaC; Validated 97.83
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.83
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 97.83
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 97.83
PRK13537306 nodulation ABC transporter NodI; Provisional 97.83
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.83
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.83
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.83
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.82
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 97.82
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.82
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.82
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.81
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.81
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.81
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.81
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.8
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.8
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.8
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.8
PRK09183259 transposase/IS protein; Provisional 97.8
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.8
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.8
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 97.79
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.79
PRK10908222 cell division protein FtsE; Provisional 97.79
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.79
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 97.79
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.78
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.77
PRK11147 635 ABC transporter ATPase component; Reviewed 97.77
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.77
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.77
COG4619223 ABC-type uncharacterized transport system, ATPase 97.77
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.76
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.76
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.76
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.74
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.74
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.74
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.74
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.74
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.74
COG0470325 HolB ATPase involved in DNA replication [DNA repli 97.74
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.74
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.74
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.73
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.73
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.73
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.73
PRK13536340 nodulation factor exporter subunit NodI; Provision 97.72
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.72
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.72
PRK08699325 DNA polymerase III subunit delta'; Validated 97.72
PRK11608326 pspF phage shock protein operon transcriptional ac 97.71
KOG0062582 consensus ATPase component of ABC transporters wit 97.71
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.71
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.71
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.7
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 97.7
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.7
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.7
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 97.7
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.69
TIGR02974329 phageshock_pspF psp operon transcriptional activat 97.69
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.69
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.69
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.68
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 97.68
PRK06067234 flagellar accessory protein FlaH; Validated 97.68
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.67
TIGR01817534 nifA Nif-specific regulatory protein. This model r 97.67
cd01394218 radB RadB. The archaeal protein radB shares simila 97.67
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.67
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.66
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.66
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.66
PRK12608380 transcription termination factor Rho; Provisional 97.66
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 97.66
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 97.66
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.65
PRK08939306 primosomal protein DnaI; Reviewed 97.65
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.65
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.65
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 97.65
PTZ00494664 tuzin-like protein; Provisional 97.65
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.65
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.65
KOG0736953 consensus Peroxisome assembly factor 2 containing 97.65
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.64
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.64
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 97.64
COG1119257 ModF ABC-type molybdenum transport system, ATPase 97.64
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.64
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.63
PRK10938 490 putative molybdenum transport ATP-binding protein 97.63
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.63
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 97.63
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 97.63
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.63
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.63
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.63
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 97.63
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.62
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.62
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.62
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.61
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.61
PHA00729226 NTP-binding motif containing protein 97.61
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.61
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 97.61
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.61
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.6
PRK08118167 topology modulation protein; Reviewed 97.6
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.6
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.59
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.59
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.59
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 97.59
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.59
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.58
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.58
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.58
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.58
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.58
PRK05022509 anaerobic nitric oxide reductase transcription reg 97.58
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.58
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.57
PRK06696223 uridine kinase; Validated 97.57
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.57
PRK11153343 metN DL-methionine transporter ATP-binding subunit 97.57
COG4152300 ABC-type uncharacterized transport system, ATPase 97.56
PRK15429686 formate hydrogenlyase transcriptional activator Fh 97.56
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.56
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.56
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 97.56
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.55
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.55
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.55
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.55
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 97.55
PRK04132846 replication factor C small subunit; Provisional 97.55
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 97.55
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 97.54
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 97.54
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 97.54
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.54
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.54
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.53
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 97.53
PRK09580248 sufC cysteine desulfurase ATPase component; Review 97.53
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 97.53
PRK04296190 thymidine kinase; Provisional 97.52
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.52
COG1127263 Ttg2A ABC-type transport system involved in resist 97.52
CHL00095821 clpC Clp protease ATP binding subunit 97.52
PRK13409 590 putative ATPase RIL; Provisional 97.51
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 97.51
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.51
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 97.51
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.51
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.51
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 97.51
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.51
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.51
KOG0927 614 consensus Predicted transporter (ABC superfamily) 97.51
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 97.5
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.5
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 97.5
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.5
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.5
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.5
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.5
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.49
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 97.49
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 97.49
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 97.49
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 97.49
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.49
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.49
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 97.48
COG0410237 LivF ABC-type branched-chain amino acid transport 97.48
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 97.48
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 97.48
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 97.48
PRK09984262 phosphonate/organophosphate ester transporter subu 97.48
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 97.47
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 97.47
TIGR00064272 ftsY signal recognition particle-docking protein F 97.47
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 97.47
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.47
PRK14235267 phosphate transporter ATP-binding protein; Provisi 97.47
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.46
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 97.46
PRK14237267 phosphate transporter ATP-binding protein; Provisi 97.46
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.45
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.45
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 97.45
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.44
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.44
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.44
PRK07667193 uridine kinase; Provisional 97.44
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.44
PRK14242253 phosphate transporter ATP-binding protein; Provisi 97.44
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 97.44
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 97.44
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.43
PRK14243264 phosphate transporter ATP-binding protein; Provisi 97.43
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 97.43
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.43
COG4988559 CydD ABC-type transport system involved in cytochr 97.43
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 97.42
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 97.42
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.42
PRK10253265 iron-enterobactin transporter ATP-binding protein; 97.41
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 97.41
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.41
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.41
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.41
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 97.41
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 97.4
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.4
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.4
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 97.4
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.4
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 97.4
PLN03073 718 ABC transporter F family; Provisional 97.4
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 97.4
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 97.39
PRK11288501 araG L-arabinose transporter ATP-binding protein; 97.39
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.39
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 97.39
PRK14241258 phosphate transporter ATP-binding protein; Provisi 97.39
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 97.39
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 97.39
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 97.39
PRK14238271 phosphate transporter ATP-binding protein; Provisi 97.39
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.39
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.38
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 97.38
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 97.38
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.38
PRK14240250 phosphate transporter ATP-binding protein; Provisi 97.37
PRK14974336 cell division protein FtsY; Provisional 97.37
COG4586325 ABC-type uncharacterized transport system, ATPase 97.37
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 97.36
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 97.36
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 97.36
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.36
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.35
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 97.35
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 97.35
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 97.35
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.35
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 97.35
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.35
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 97.35
COG3910233 Predicted ATPase [General function prediction only 97.34
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.34
PRK10762501 D-ribose transporter ATP binding protein; Provisio 97.34
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.34
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 97.34
PRK14239252 phosphate transporter ATP-binding protein; Provisi 97.34
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.34
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.33
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 97.33
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.33
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 97.32
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.32
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 97.32
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.32
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 97.32
PRK11607377 potG putrescine transporter ATP-binding subunit; P 97.32
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.32
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 97.31
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 97.31
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.31
PRK00771437 signal recognition particle protein Srp54; Provisi 97.31
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.31
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.31
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.31
PRK14236272 phosphate transporter ATP-binding protein; Provisi 97.3
PRK10070400 glycine betaine transporter ATP-binding subunit; P 97.3
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.3
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.3
PRK13531 498 regulatory ATPase RavA; Provisional 97.3
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 97.29
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 97.29
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 97.29
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=4.6e-57  Score=467.15  Aligned_cols=367  Identities=36%  Similarity=0.692  Sum_probs=318.2

Q ss_pred             CEEeeeecccccccccccchHHHHHHHhHHHhhhhHHHHHHHHHHHHHHHhhcCCcCCC-CChhHHHhhhhhcccccccC
Q 017364            1 MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKD-RNEPEFIVDIVKEISCKISA   79 (373)
Q Consensus         1 ~v~p~~~~v~~~~v~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~-~~~~~~~~~~~~~v~~~~~~   79 (373)
                      +|+||||+|||+|||+|+|.|+++|.++++..  ..+++++|++||+++++++|+.+.. ..|++++++|+.+|..++..
T Consensus       100 ~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~--~~~~~~~w~~al~~~~~~~g~~~~~~~~E~~~i~~Iv~~v~~~l~~  177 (1153)
T PLN03210        100 LVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNK--TEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKLNL  177 (1153)
T ss_pred             eEEEEEecccHHHHhhccchHHHHHHHHhccc--chhHHHHHHHHHHHHhCcCceecCCCCCHHHHHHHHHHHHHHhhcc
Confidence            59999999999999999999999999876653  3457999999999999999998765 77999999999999999887


Q ss_pred             cc-ccccCcccchhhHHHHHHHHhcCCCCeEEEEEeccCCcchhHHHHHHHHHHhccccceEEEeec--hh---hhc---
Q 017364           80 KS-ETLKELVGLDSRLEKLRFLINKGPTDVRMIGICGMGGIGKTTLARVVYDLISHEFEASCFLANV--RE---ISK---  150 (373)
Q Consensus        80 ~~-~~~~~~vGR~~~~~~l~~~l~~~~~~~~~v~I~G~~GiGKTtLa~~~~~~~~~~f~~~~~~~~~--~~---~~~---  150 (373)
                      .+ ...+.+|||+..++++..+|..+.+++++|+|+||||+||||||+.+++++..+|+..+|+...  ..   ...   
T Consensus       178 ~~~~~~~~~vG~~~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g~vfv~~~~v~~~~~~~~~~~  257 (1153)
T PLN03210        178 TPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSAN  257 (1153)
T ss_pred             ccCcccccccchHHHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCCeEEEeeccccccchhhccccc
Confidence            76 5667899999999999999987777899999999999999999999999999999988887531  10   000   


Q ss_pred             ---ccCHHHHHHHHHHHHhCCCCCCCcchhhhHHHHHHhhCCCceEEEecccccHHHHHHHhcCCCCCCCCcEEEEEeCC
Q 017364          151 ---KSGLVFLQKQLISQLLNLPDSGVWNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRD  227 (373)
Q Consensus       151 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~LlvlDdv~~~~~l~~l~~~~~~~~~g~~iliTtR~  227 (373)
                         ......+..+++..++.........    ...+++.+.++++||||||+|+..+++.+.....++++|++||||||+
T Consensus       258 ~~~~~~~~~l~~~~l~~il~~~~~~~~~----~~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd  333 (1153)
T PLN03210        258 PDDYNMKLHLQRAFLSEILDKKDIKIYH----LGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKD  333 (1153)
T ss_pred             ccccchhHHHHHHHHHHHhCCCCcccCC----HHHHHHHHhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCc
Confidence               0112334555566655443222211    245778889999999999999999999998888888999999999999


Q ss_pred             hhhHhhcCCCceEeCCCCCHhHHHHHHHHhhcCCCCCCchHHHHHHHHHHHhCCCchHHHHHHHHhcCCCHHHHHHHHHH
Q 017364          228 KHLLMAHGVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQR  307 (373)
Q Consensus       228 ~~~~~~~~~~~~~~l~~L~~~ea~~l~~~~~~~~~~~~~~~~~~~~~i~~~~~g~Plal~~~~~~l~~~~~~~~~~~l~~  307 (373)
                      ..++...+....|+++.|+.++|++||+..+|+...+.+...+++.+|+++|+|+||||+++|++|++++..+|..++..
T Consensus       334 ~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~  413 (1153)
T PLN03210        334 KHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPR  413 (1153)
T ss_pred             HHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHH
Confidence            99988777788999999999999999999999877666678899999999999999999999999999999999999999


Q ss_pred             hcCCCCchHHHHHHhchhCCch-hhHHHHhhhcccCCCCCHHHHHHHHHhCCCCcccchhhhhccCC
Q 017364          308 LERDPENEILDVLQISFDGLKE-TEKKIFLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIENLY  373 (373)
Q Consensus       308 l~~~~~~~i~~~l~~s~~~L~~-~~~~~l~~la~f~~~~~~~~l~~l~~~~~~~~~~~l~~L~~~~L  373 (373)
                      ++......+..+|+.||+.|++ .+|.||+++|||+++.+.+.+..++..+++.+..+++.|++|||
T Consensus       414 L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksL  480 (1153)
T PLN03210        414 LRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSL  480 (1153)
T ss_pred             HHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCC
Confidence            9988888999999999999986 59999999999999999999999999999999999999999997



syringae 6; Provisional

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
3ozi_A204 Crystal Structure Of The Tir Domain From The Flax D 2e-09
3jrn_A176 Crystal Structure Of Tir Domain From Arabidopsis Th 1e-07
>pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 2/70 (2%) Query: 1 MIFPIFYDLEPTTVRKQTASFKEAFLKHEEAFRENIEKVQKWRDSLKEVANISGWELKDR 60 +I PIFY ++P+ VR QT +K+AF KH F + + +Q W+D+LK+V ++ GW + Sbjct: 125 IILPIFYMVDPSDVRHQTGCYKKAFRKHANKF--DGQTIQNWKDALKKVGDLKGWHIGKN 182 Query: 61 NEPEFIVDIV 70 ++ I D V Sbjct: 183 DKQGAIADKV 192
>pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-41
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 8e-38
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-37
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 6e-31
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 3e-30
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-25
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 1e-10
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  151 bits (383), Expect = 2e-41
 Identities = 55/365 (15%), Positives = 94/365 (25%), Gaps = 36/365 (9%)

Query: 13  TVRKQTASFKEAFLKHEEAFRENIE----KVQKWRDSLKEVANISGWELKDRNEPEFIVD 68
           T  ++ A+F   + +        I+      Q       E          D   P  I  
Sbjct: 49  TRLERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAP 108

Query: 69  IVKEISCKISAKS---ETLKELVGLDSRLEKLR-FLINKGPTDVRMIGICGMGGIGKTTL 124
                                    +  ++++   L      D   + + G  G GK+ +
Sbjct: 109 QFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVI 168

Query: 125 ARVVY---DLISHEFEASCFLANVREISKKSGLVFLQKQL-----ISQLLNLPDSGVWNV 176
           A       D +      S         + KS        L        LLN P       
Sbjct: 169 ASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTS 228

Query: 177 YDGMNMIRSRLR-HKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLL-MAH 234
                MI + L      L V DDV++ + +           +  R  +T+RD  +   A 
Sbjct: 229 VVLKRMICNALIDRPNTLFVFDDVVQEETIR------WAQELRLRCLVTTRDVEISNAAS 282

Query: 235 GVDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLF 294
              E      L  DE                K  E +    ++ + G P  L +      
Sbjct: 283 QTCEFIEVTSLEIDECYDFLEAYGMPMPVGEK-EEDVLNKTIELSSGNPATLMMFFKSCE 341

Query: 295 GRTIAEWESALQRLERDP-----------ENEILDVLQISFDGLKETEKKIFLDIACFYK 343
            +T  +      +LE                 +   LQ   + L + ++           
Sbjct: 342 PKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPP 401

Query: 344 GKYID 348
           G  I 
Sbjct: 402 GVDIP 406


>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query373
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.8
2fna_A357 Conserved hypothetical protein; structural genomic 99.77
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.77
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.71
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.65
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.64
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.64
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 99.62
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.54
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 99.53
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.46
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.39
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.28
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.2
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.15
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.13
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.02
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.02
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.0
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.0
3bos_A242 Putative DNA replication factor; P-loop containing 98.99
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.97
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.94
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.93
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.91
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.89
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.88
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.88
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 98.87
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.85
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.85
3pvs_A 447 Replication-associated recombination protein A; ma 98.84
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.82
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 98.81
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.79
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.78
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.77
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 98.77
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.75
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 98.71
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.71
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.71
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.7
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 98.63
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.6
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.56
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.52
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.5
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 98.5
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 98.5
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 98.49
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.48
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.47
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.46
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.46
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.44
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.44
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.41
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.39
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 98.37
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.35
2r62_A268 Cell division protease FTSH homolog; ATPase domain 98.34
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.33
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.32
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.31
1ojl_A304 Transcriptional regulatory protein ZRAR; response 98.3
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.19
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 98.14
3co5_A143 Putative two-component system transcriptional RES 98.1
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.1
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.09
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.08
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 98.03
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.02
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.93
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.93
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.92
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.91
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 97.9
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.9
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.88
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 97.85
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.85
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.84
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.83
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.8
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.8
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.8
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.78
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.78
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.75
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.75
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.74
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.73
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.72
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.7
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.69
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 97.67
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.67
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 97.66
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.65
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.64
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.62
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.59
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.58
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 97.57
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 97.57
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 97.55
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 97.54
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.53
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 97.51
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.49
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.49
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 97.48
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.48
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.48
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.46
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 97.44
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.43
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.43
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.39
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 97.39
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.39
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.38
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.37
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.36
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.36
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.36
2r44_A331 Uncharacterized protein; putative ATPase, structur 97.35
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.35
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.3
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 97.29
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.28
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.27
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.26
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.22
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 97.21
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.2
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 97.2
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.18
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.17
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 97.17
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.17
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.16
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.15
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.14
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.14
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.1
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.09
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 97.07
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.06
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.05
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.05
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.05
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.02
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.01
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.01
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.98
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.98
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.96
3io5_A333 Recombination and repair protein; storage dimer, i 96.95
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.95
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.95
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.94
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.93
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.92
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.91
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.91
2qgz_A308 Helicase loader, putative primosome component; str 96.9
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.89
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.89
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.88
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.87
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.87
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.85
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.85
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 96.85
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 96.85
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.84
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.83
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.83
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 96.83
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.83
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 96.82
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.82
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.81
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.8
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.79
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.79
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.79
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.78
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.78
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.77
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.77
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.76
2z43_A324 DNA repair and recombination protein RADA; archaea 96.76
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 96.76
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 96.75
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.73
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.72
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.72
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.69
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.68
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.68
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.67
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.67
2og2_A359 Putative signal recognition particle receptor; nuc 96.67
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.66
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.65
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.65
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.64
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.63
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.62
1g6h_A257 High-affinity branched-chain amino acid transport 96.62
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 96.61
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.61
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.61
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 96.6
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.59
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.59
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.59
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.57
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.56
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.55
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.55
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.55
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.54
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.54
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.53
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 96.53
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.53
1via_A175 Shikimate kinase; structural genomics, transferase 96.53
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.53
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 96.53
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.52
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.52
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.51
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.51
1tue_A212 Replication protein E1; helicase, replication, E1E 96.5
3ice_A422 Transcription termination factor RHO; transcriptio 96.5
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.49
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.49
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.48
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.48
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.48
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.48
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.48
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.47
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.47
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.47
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.46
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.46
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 96.46
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.45
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.45
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.43
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.43
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.42
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.42
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.41
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.41
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.39
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 96.39
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.38
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.37
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.37
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.37
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.34
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.34
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.34
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.33
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.33
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.31
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.31
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.31
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.31
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.31
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.3
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.28
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.26
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.25
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.25
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.24
3fwy_A314 Light-independent protochlorophyllide reductase I 96.24
1p9r_A418 General secretion pathway protein E; bacterial typ 96.24
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.24
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.19
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.18
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.16
2ghi_A260 Transport protein; multidrug resistance protein, M 96.15
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.14
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.12
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.1
2xxa_A433 Signal recognition particle protein; protein trans 96.1
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.1
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.09
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.06
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.04
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.02
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.01
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.0
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.0
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 96.0
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 95.99
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.99
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.98
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 95.97
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.95
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.94
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.94
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 95.93
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.93
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.93
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.93
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.92
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 95.92
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.92
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.88
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.88
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.86
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.85
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.84
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.83
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 95.82
3kta_A182 Chromosome segregation protein SMC; structural mai 95.82
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.81
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 95.79
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.77
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.76
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.76
2oap_1511 GSPE-2, type II secretion system protein; hexameri 95.71
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.7
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 95.69
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.69
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.69
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.67
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 95.66
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 95.64
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.64
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 95.61
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.61
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.61
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.6
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 95.6
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.58
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.57
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.57
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.57
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.56
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.54
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.53
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.53
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.49
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.41
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.34
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.34
3end_A307 Light-independent protochlorophyllide reductase ir 95.33
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.3
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.29
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.29
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 95.28
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.24
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.22
2ged_A193 SR-beta, signal recognition particle receptor beta 95.21
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.19
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 95.18
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 95.16
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 95.14
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.14
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.13
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.12
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 95.1
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.07
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 95.05
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.03
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 95.01
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.0
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.99
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 94.99
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.97
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.95
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.92
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.92
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 94.91
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 94.89
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.86
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 94.84
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.84
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.83
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 94.83
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 94.82
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.82
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.81
1nrj_B218 SR-beta, signal recognition particle receptor beta 94.81
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 94.81
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 94.8
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.8
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.78
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 94.78
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 94.77
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 94.76
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 94.76
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.75
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.74
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 94.74
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.72
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 94.72
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 94.72
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.71
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 94.71
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.7
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.69
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 94.69
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 94.67
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 94.67
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 94.66
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 94.66
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 94.63
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 94.62
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.62
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 94.62
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 94.61
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.6
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 94.59
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 94.58
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.58
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 94.53
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.53
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 94.53
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 94.5
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 94.5
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 94.49
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.47
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.46
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.45
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.41
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 94.4
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 94.4
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.4
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.4
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 94.39
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 94.38
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.35
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.34
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 94.34
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.33
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.3
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 94.3
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.3
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 94.3
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 94.29
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.29
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 94.28
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.27
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.26
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 94.26
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 94.26
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.25
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 94.25
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.25
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.24
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 94.23
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 94.21
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.2
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.19
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 94.19
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 94.16
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.16
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 94.14
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 94.14
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 94.13
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.12
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 94.11
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.11
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 94.11
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.11
2fh5_B214 SR-beta, signal recognition particle receptor beta 94.1
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.07
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 94.07
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.07
3t1o_A198 Gliding protein MGLA; G domain containing protein, 94.04
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 94.04
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.02
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.02
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 93.99
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 93.97
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 93.96
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 93.95
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 93.93
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 93.93
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.93
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 93.92
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 93.91
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 93.9
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 93.89
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 93.88
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-40  Score=317.34  Aligned_cols=274  Identities=16%  Similarity=0.116  Sum_probs=201.3

Q ss_pred             ccchhhHHHHHHHHhcC-CCCeEEEEEeccCCcchhHHHHHHHH----HHhccccceEEEeechhhhcccCHHHHHHHHH
Q 017364           88 VGLDSRLEKLRFLINKG-PTDVRMIGICGMGGIGKTTLARVVYD----LISHEFEASCFLANVREISKKSGLVFLQKQLI  162 (373)
Q Consensus        88 vGR~~~~~~l~~~l~~~-~~~~~~v~I~G~~GiGKTtLa~~~~~----~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (373)
                      +||+.+++.|..+|..+ ..++++|+|+|+||+||||||+.+++    ++..+|+.++|+. ++.... .+...+...++
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~-vs~~~~-~~~~~~~~~il  208 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAP-KSTFDLFTDIL  208 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCST-THHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEE-ECCCCC-CCHHHHHHHHH
Confidence            49999999999999754 34579999999999999999999997    5788899999984 322111 35677888888


Q ss_pred             HHHhCCCC-CC-----CcchhhhHHHHHHhhCCC-ceEEEecccccHHHHHHHhcCCCCCCCCcEEEEEeCChhhHhhcC
Q 017364          163 SQLLNLPD-SG-----VWNVYDGMNMIRSRLRHK-KVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLLMAHG  235 (373)
Q Consensus       163 ~~~~~~~~-~~-----~~~~~~~~~~l~~~l~~~-~~LlvlDdv~~~~~l~~l~~~~~~~~~g~~iliTtR~~~~~~~~~  235 (373)
                      ..+..... ..     ..+...+...+++.+.++ ++||||||+|+..++ .+..     .+||+||||||+..++..++
T Consensus       209 ~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~~  282 (549)
T 2a5y_B          209 LMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAAS  282 (549)
T ss_dssp             HHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGCC
T ss_pred             HHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHcC
Confidence            88765421 11     123344578889999996 999999999998865 2222     15999999999999887764


Q ss_pred             -CCceEeCCCCCHhHHHHHHHHhhcCCCCCCchHHHHHHHHHHHhCCCchHHHHHHHHhcCCCHHHHHHHHHH-hcCCCC
Q 017364          236 -VDEVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQR-LERDPE  313 (373)
Q Consensus       236 -~~~~~~l~~L~~~ea~~l~~~~~~~~~~~~~~~~~~~~~i~~~~~g~Plal~~~~~~l~~~~~~~~~~~l~~-l~~~~~  313 (373)
                       ....++|++|+.++|++||.+.++.... .+...+.+.+|+++|+|+||||+.+|+.++..... |...+.. +.....
T Consensus       283 ~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~-~~~~l~~~l~~~~~  360 (549)
T 2a5y_B          283 QTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFE-KMAQLNNKLESRGL  360 (549)
T ss_dssp             SCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHH-HHHHHHHHHHHHCS
T ss_pred             CCCeEEECCCCCHHHHHHHHHHHhcCCCC-chhHHHHHHHHHHHhCCChHHHHHHHHHhccchHH-HHHHhHHHhhcccH
Confidence             3367999999999999999999876432 35777889999999999999999999999777533 3233332 221123


Q ss_pred             chHHHHHHhchhCCchhhHHHHh-----------hhcccCCCCCHHHHHHHHHhC--CCCccc-----------chhhhh
Q 017364          314 NEILDVLQISFDGLKETEKKIFL-----------DIACFYKGKYIDYVTKILNYC--DFDPII-----------GIGGLI  369 (373)
Q Consensus       314 ~~i~~~l~~s~~~L~~~~~~~l~-----------~la~f~~~~~~~~l~~l~~~~--~~~~~~-----------~l~~L~  369 (373)
                      .++..++..||+.||++.+.||.           +||+||++++++  +.+|.++  |+....           .++.|+
T Consensus       361 ~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~  438 (549)
T 2a5y_B          361 VGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLS  438 (549)
T ss_dssp             STTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTT
T ss_pred             HHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHH
Confidence            33444555555555555555555           999999999877  7899998  665433           488999


Q ss_pred             ccCC
Q 017364          370 ENLY  373 (373)
Q Consensus       370 ~~~L  373 (373)
                      ++||
T Consensus       439 ~rsL  442 (549)
T 2a5y_B          439 KRGA  442 (549)
T ss_dssp             TBSS
T ss_pred             HcCC
Confidence            9886



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 373
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 9e-44
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 3e-04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score =  150 bits (380), Expect = 9e-44
 Identities = 38/260 (14%), Positives = 83/260 (31%), Gaps = 18/260 (6%)

Query: 87  LVGLDSRLEKL-RFLINKGPTDVRMIGICGMGGIGKTTLARVVYD----LISHEFEASCF 141
               +  ++++ + L      D   + + G  G GK+ +A         LI   +++  +
Sbjct: 22  CYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW 81

Query: 142 LANVREISKKSGLVFLQKQLISQLLNLP-----DSGVWNVYDGMNMIRSRLRHKKVLLVI 196
           L +     K +  +F    L+ +  +          V +V     +  + +     L V 
Sbjct: 82  LKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVF 141

Query: 197 DDVIELQQLESLAGKHDWFGIGSRIFITSRDKHL-LMAHGVDEVYMHEHLNYDEALGLFC 255
           DDV++ +             +  R  +T+RD  +   A    E      L  DE      
Sbjct: 142 DDVVQEET------IRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLE 195

Query: 256 LKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLERDPENE 315
                     +  E +    ++ + G P  L +       +T  +      +LE      
Sbjct: 196 AYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVG 254

Query: 316 ILDVLQISFDGLKETEKKIF 335
           +  +   S+  L    ++  
Sbjct: 255 VECITPYSYKSLAMALQRCV 274


>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query373
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.57
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.22
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.14
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.08
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.07
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.05
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.05
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.98
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.96
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.94
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.89
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.85
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.84
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.83
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.83
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.77
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.75
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.74
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.71
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.67
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.64
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.63
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.07
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.04
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.04
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.03
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.99
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.93
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.92
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.92
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.89
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.88
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.86
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.86
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.85
d2qy9a2211 GTPase domain of the signal recognition particle r 97.83
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.82
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.82
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.8
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.78
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.77
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.76
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.69
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.65
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.63
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.63
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.62
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.6
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.59
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.58
d1vmaa2213 GTPase domain of the signal recognition particle r 97.55
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.54
d1okkd2207 GTPase domain of the signal recognition particle r 97.51
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.47
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.47
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.46
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.43
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.42
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.39
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.36
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.32
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.32
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 97.31
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.31
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.3
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.28
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.24
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.23
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.19
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.13
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.12
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.12
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.08
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.07
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.07
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.07
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.07
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.06
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.06
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.05
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.03
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.02
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.0
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.0
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.91
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.9
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.86
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.86
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.85
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.84
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.8
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.8
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.78
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.77
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.76
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.74
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.73
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.72
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.69
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.69
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.67
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.65
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.58
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.57
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.56
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.5
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.49
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.44
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.35
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.34
d1xpua3289 Transcription termination factor Rho, ATPase domai 96.27
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.27
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.25
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.25
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.21
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.15
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.13
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.09
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.04
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.96
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.93
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.92
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.88
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.88
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.87
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.81
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.8
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.73
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.7
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.64
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.63
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.61
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.6
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.59
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.58
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 95.56
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.55
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.54
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.53
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.49
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.49
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.44
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.36
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 95.32
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.3
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.27
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.26
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.25
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.24
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.24
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.23
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.21
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.21
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.21
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.2
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.17
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.16
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.15
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.15
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.14
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.14
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.14
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.13
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.11
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.09
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.08
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.07
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.06
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.05
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.04
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.04
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.03
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.02
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.01
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 94.97
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.97
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.94
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.91
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.89
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.84
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.83
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.82
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.82
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.82
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.81
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.75
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.73
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.71
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.66
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.65
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.64
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.64
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.61
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.6
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.59
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.58
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 94.54
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.54
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.45
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.43
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.41
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.4
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.34
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.28
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.21
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.13
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.13
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.1
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 94.07
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.06
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 93.97
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.92
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.88
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.88
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.8
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.77
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.68
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.64
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.61
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.41
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.36
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 93.17
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 93.05
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 92.96
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.93
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 92.66
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 92.42
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.34
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 92.16
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 92.12
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 91.38
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 91.32
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 91.03
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 90.9
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.82
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 90.54
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.31
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 89.69
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 89.47
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.28
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 88.56
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 88.01
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 87.88
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 87.82
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 87.73
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 87.28
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 86.28
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.11
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 85.78
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.66
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 85.45
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 83.25
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 83.2
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 82.95
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00  E-value=1.1e-39  Score=285.25  Aligned_cols=248  Identities=14%  Similarity=0.125  Sum_probs=192.0

Q ss_pred             cccCcccchhhHHHHHHHHhc-CCCCeEEEEEeccCCcchhHHHHHHHHH----HhccccceEEEeechhhhcccCHHHH
Q 017364           83 TLKELVGLDSRLEKLRFLINK-GPTDVRMIGICGMGGIGKTTLARVVYDL----ISHEFEASCFLANVREISKKSGLVFL  157 (373)
Q Consensus        83 ~~~~~vGR~~~~~~l~~~l~~-~~~~~~~v~I~G~~GiGKTtLa~~~~~~----~~~~f~~~~~~~~~~~~~~~~~~~~~  157 (373)
                      ....++||+.++++|..+|.. .+.+.++|+|+||||+||||||+++++.    ....|++++|+......+ ...+...
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~-~~~l~~~   96 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAP-KSTFDLF   96 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCST-THHHHHH
T ss_pred             CCCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCC-HHHHHHH
Confidence            345678999999999999864 3445789999999999999999999987    445688899986432221 1222223


Q ss_pred             HHHHHHHHhCCCCCCC------cchhhhHHHHHHhhCCCceEEEecccccHHHHHHHhcCCCCCCCCcEEEEEeCChhhH
Q 017364          158 QKQLISQLLNLPDSGV------WNVYDGMNMIRSRLRHKKVLLVIDDVIELQQLESLAGKHDWFGIGSRIFITSRDKHLL  231 (373)
Q Consensus       158 ~~~~~~~~~~~~~~~~------~~~~~~~~~l~~~l~~~~~LlvlDdv~~~~~l~~l~~~~~~~~~g~~iliTtR~~~~~  231 (373)
                      ...++...........      .........+...+.++++|+||||+|+...++.+...      |++||+|||+..++
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~~------~srilvTTR~~~v~  170 (277)
T d2a5yb3          97 TDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQEL------RLRCLVTTRDVEIS  170 (277)
T ss_dssp             HHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHHT------TCEEEEEESBGGGG
T ss_pred             HHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhccc------CceEEEEeehHHHH
Confidence            3333333322221111      11222234567778999999999999999999877543      88999999999998


Q ss_pred             hhcCCC-ceEeCCCCCHhHHHHHHHHhhcCCCCCCchHHHHHHHHHHHhCCCchHHHHHHHHhcCCCHHHHHHHHHHhcC
Q 017364          232 MAHGVD-EVYMHEHLNYDEALGLFCLKAFKSHKPWKGYEQLSKSVVKYAGGLPLALKVLGSFLFGRTIAEWESALQRLER  310 (373)
Q Consensus       232 ~~~~~~-~~~~l~~L~~~ea~~l~~~~~~~~~~~~~~~~~~~~~i~~~~~g~Plal~~~~~~l~~~~~~~~~~~l~~l~~  310 (373)
                      ..+... ..|++++|+.+||++||+.+++..... +..++++++|+++|+|+||||+++|+.++.++...|.+..+.+..
T Consensus       171 ~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~  249 (277)
T d2a5yb3         171 NAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLES  249 (277)
T ss_dssp             GGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHH
T ss_pred             HhcCCCCceEECCCCCHHHHHHHHHHHhCCccCc-hhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhc
Confidence            876544 679999999999999999988765433 456788999999999999999999999999999999999998877


Q ss_pred             CCCchHHHHHHhchhCCchhhHHHHhhh
Q 017364          311 DPENEILDVLQISFDGLKETEKKIFLDI  338 (373)
Q Consensus       311 ~~~~~i~~~l~~s~~~L~~~~~~~l~~l  338 (373)
                      .....+..++..||+.||++.|.||.++
T Consensus       250 ~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         250 RGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             CcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            7778889999999999999999999864



>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure